packages/0000755000175200017520000000000011517102173012272 5ustar tyndurtyndurpackages/wget/0000755000175200017520000000000011517102173013240 5ustar tyndurtyndurpackages/wget/1.11/0000755000175200017520000000000011517102174013621 5ustar tyndurtyndurpackages/wget/1.11/bin/0000755000175200017520000000000011517102173014370 5ustar tyndurtyndurpackages/wget/1.11/bin/wget0000755000175200017520000163670111517102173015302 0ustar tyndurtyndurELF@@44 (@@__``@`@+QtdSvU=@t8v$`@ҡ$`@ut h,_@!@ÐUth@h,_@`@tt h`@ЃÐQSP UWVS] o $'t&1vYvyEE$D$y$`@")ċEt$|$ t$D$$ `@=`@s& `@sBwҁ`@rt$<$:Eá@$#~$#iÉ$ Ǎ")čt$|$t$$toUSM] E9sP@9tf9s J9u[1[fUWVSEExu EE܋UU؀?t V*?8u<FuG?ut%U܄]؅t<.u;u t tʀ~/uĸe[^_À[t\uEuG랊EtՋU؅/Re]t(R]t@u!^EGUU8E| :U]Eu \HȈʊ]܅t /2G-u]tWMu \H zEu>GUv@F?t *t >/?u܀>u>.u;u Et~/uv<.;u E܅~/p"@]t1GUu<\t <]tusG EUf}[DUWVS}_l [^_ËGE w1ҍs ۍ ˍ O ЍE @EQEUE)G@)WRE)))Od؉љt S؉љ:fUWVSlӉMEEEEEEEEEftF@G@@l@G@@tfll@G@@uCuut]tE@ }t1MUBdљ]uFUle[^_À%tl:uCFl3CC% uM@+1El0< U싵lDЉ‰EFl0< vՃ }W芖ƃ }Pjlh^@l uMr@l< ull< t0< clPl le[^_þe[^_Ðh uh SPht@-밃 VO믃Vh@9vUWVSt`<"ta< t ABBt<&uABBuA PƊ ASCtDB<w$ @v룃&Q;<DgABtB;SCue[^&AaAmApA;&AqAuAoAtA;q&A#A3A2A;V,e[^fUVS] }t*@t~S5@ʉt+e[^f@tSP襉u1f}tUrL}t[}tN1f S VP5@1e[^à j5@k@뽾<`@붾4`@믾8`@US@t" PY5@胇@@t" PZ5@X@@t P=@tN]SPxv u Suu 5@@@t P]ÐUS] @t] @E]1 j@U Phd-@5@qUS]@th@tKEPEPS5@訃t+S5@"XuXu]à j_@롃 jK@널US ] uSu%u5@譇Xu<$41]fUVSu @@tru 5@1Ph$h@h@V5@"u& S&É4$ SP5@e[^à j\@w jE@VUWVS@@EPMQu 5@uVua}tMtE8uA8FCuu5@tWu 5@ XuXuE m uXu  SP5@܆EPMQu5@u1 u ^u SP5@薆e[^_Ãu5@fXu_u맀;*Љ@j\ Hu h@ hV@(vUj @fUWVSE 0Evs_Zvst e[^_flje[^_UWVS׉M20ut\ËwE C]tDÃsVDusw/űG;CuċUE؍e[^_ËE1ۉ؍e[^_ÐUWVSÉ֍EPEP23fptKM?…tsMtt@AEFKK=!@t* h`@vF 6EQVu3uC=!@ue[^_ËEFՋ@F됋FVU؋~ubEl@V tCEs@t@z@NVtHO@uWuuPQSR6h@0Eq@뻸@뾃 P7E܃딻@UWVSt] hZ@SGE9 jUj@ uEEEt'@G@@t*]@G@@tCu u렋]#t; SUCtUv< tBuU9t:tJMBt< tMv< t E}uU9UttMAM}Gk< c< tFu;uKCFEF2< *UU< t EċMĊu}9}E@EȋUĊB< MȉM< t E̋}̊uU9UMAMЋ}̊G< M< t EԋUԊuM9Mwo}G}1ыE؍LM9sA< B< uMwEuuzUBY_uugMAXZVuV}GE)Eă}1MQ UEEA U)U}eEEUB }P)Pj:SƃH9P@G@E@G@tnETBЉUA9w^ u<e[^_à 5"@PSh<@jr e[^_É] uE9wuut UMQ;.؃uP }h@-@]E URh@uv0EـE@@Ets}fE޴ fEm_mހO UEn5@u]@uIM9MA؋E딋E UWVSƉU1ҋ}ӍSRuVu ؍e[^_Ð1e[^_fUWVS É׉ΊE EuS t}tCt9tf1e[^_ft3Wu݋SEJt΋UtUe[^_ÐUWVSEE1}у)̍t$/uFP&.E !")čD$E U2ju 1e[^_ËE fE] E1vj.S=XSM1lt UMBUG9}NjEt jc@EoEE}EUt"PjWVMU :<][uEM9MuƋE}E)čD$EEEUdM؋}u jv[t`WEPdVMU tًMI};1IJEBE뮺.E eEE؋E9ExU19UPhh@h@dMMMhL?@j uu }9}E EċUUЉӃ UGCEދUЋz wpt0}9}tBs}E ރE 9uv+}9}uЃwMq?t붉]ɋU+UȉȍBxh;@j PuZEE1Ez1ˋzыE)؍DEE܃ x9}uDxEԃ PMO}EEEŰM S1щlIM{IM}>QuRPzE0=x> usP\}}E9E}7;D7 }EE x9UgEP19UPh$h@h@bh;@j ju1ۃ\]ԃ SA1룍vUWVSt/v ủ t9 "@| 9"@w¸e[^_ÍvEX 1߈щMFELjыETB~B )čL$MtkEh?@uq]1E=!@t h@ uEe[^_À=!@t h@ u[ u뾃 p j$X\ NjX@ @EXSh?@G=!@ uZ_Pht@|Ph@!@Ph@t h@˙ h@趙=!@ h@蔙PWu|uRuhD@p ;Ph@Zw h[@E1 h@)Ph@}PVWh@EEEE=!@ h@="@EE j$fZ Nj\@ @Euu@^_Ph*@H hx@3Ph@hVlSlPh@ ^1UWVSlj։MЅxJ8T8 D8 ËUډ%x))J+M!ÉZ[^_ÐB뱍vH@АUWVSL)čD$E P' u1} IQu u}IQuܦXZEPu¦E1EЋE1EԋEЉEEԉEE~P1ۍuv u襦 ujV苦Y_}WuqE1EЋE1EԋEЉEEԉEC;]u@EE1}}fEEEE1ҍEsƻڍE]ƃ@uE 1ҍE<@`@@=@;@ƀ@ s E@`@C{{t~B<0 _ E@`@Gwt{4 ~ !E@`@F^~t8 { ,EE@`@Cs{tuh48 ^ 7E @`@FC=!@uf@e[^_À=@t=@뒀K{~h@hP@aUWVSuFE^ u 1E<Ћv\t!vPu փu9tu1e[^_Ë}ɋtUtUEtGUe[^_UWVS E}X@ ÉE9s.;t QWsPU u9tu9]wӍe[^_ÍvUEM PQ@ ‰A fUS]SK 9r %9vtBCBC[1[ÍvUE@ÐUSU؄t"Btэv)؉ÊAAu[ÐUSM@I@؄t%Qtf)@I@QAu[ÍvUU Љ1‰Љ 1‰ Љ1‰щ 1UE 9EÍvUu ubfUu uefUS]C PhsiC]ÍvUS]sR]]sRvUVSÉ֋Fw-@9~ @f@GtQ9|@[^ fUWVS8u }j"SÃ3{C@}h@}fE fEm]mES]P‰C EP $}fE fEm[m4VRC VhPhC؍e[^_Ív|@3Z@OfU hв@h8@ufU h@h@ufUWVS]CEs u 1E<Ћ[]\tPu Uu 9tu1e[^_Ív}ȃ?tGe[^_ÍvUWVS(E@EUZ u 1E4ЋUz\tPu ׃u9tu1e[^_Ëu˃>tE@ EURUEEUJEU|9tktL SU1uE Ѓt9t9t8uFA9uuue[^_ÍvM봉딍vUWVS(E@EUZ u 1E4ЋUz\tPu ׃u99t0uUB;B}8E@U EFe[^_fu믃>tЋE UVe[^_ËERU܋UB U܍‰UUPE؋UB @M}fE fEmZmu VOǃ VhPeExU9UsI]܍t7t3 PU1u؍ ׃9tf99uCA9]w uNE@EUZ ^u 1E4ЋUz\Pu ׃9tufuUWVS]CEs u 1E<Ћ[]\tPu Uu$9tu@e[^_f}ċ@e[^_ÐUMQE EÐUE@ UE@ UWVS];] ;:;] ^EEE1vC AG@tM@h0 ƁwoE;] uπ}t }ZEE1}[^_Ív:uk}u9Uu%E؉Ef@J@7 Ɓv1[^_Ív;] t}E1E@C;] tр;:u.uƒ} ;} s1E1(BuE}G;} tEPЃ vˀ.lb}X11E1}?}3EvUSp7K$/K]ÍvUS]E 9CPhh@h@C@C;|C]ÍvUVSu] 9^,1;Pj`h@h4@Fe[^f1UVS @ttuVPB7] ujJ1{Phsh@h@h Vu 5 @ @e[^UWVSU1} IM2UE ȉE1I˅xc}x_<}E }8}䊇@I@:@I@u= }f;} t.AW@I@IO8@I@uKuݸ[^_AtEpEq1[^_ÍvUS]1{PhAh@h@4 @tsPZYt! @t sPZY]f1]Ð]ÐUS]CHC=!@u"C~]f=!@u؋]HPSjh\@趇PSjh@裇fUWVSjIǃtj1ېCujhh@h@F$'IGG1ɃfGPA9ue[^_jhh@h@$HGGe[^_fUE@EzfUWVS(uE @E߄tqE u3 @tbuP2tOƀ=!@2F @t/uPt P7^_u5 @[E t| uvà @0h@jKCWƃ}t<= @9F ud9 VP5 @=!@"e[^_à u/ Ph@jׅ[u6và @0h@j超CƋǃ~OGE1fC9t< FPPZYPjޅ9]~փh@jDžC9uċ9th@j誅h@j蘅EEEEƉe[^_ÿY j @uh$@z~*1ۃ FPZYPhE@OC9؃ h@:PVuh@#vUVSEu tf~H1Ґхu D;Ft B9u1[^ø[^UWVSCUȉUȉrRMȋBAEUԋEf@I@Bue[^_fM̅3B7vJM9JBAǃ Mq1PUEȉ8@ Bz9dJ6AG@MEEAHЋEMGE9 EL6AG@@~@J@HE9v?;t}vME؈@EEGJ0JzPrqfUWVS Džt=)֍F)č\$QVRSS3XZSWe[^_Ðe[^_ÍvUWVSLE uƍEEEEE]DžƅUEP)Pjta/t\C9w}uAEE܋EEEEue[^_à <e[^_à u<믉9u@G@@C9w}tEt~;t.ƅ!9t vwf91$ @9 PDžF9sz-cz-Y9{-I>ux-u߀x-u@VKv:Ph>h@h@i;C:P;C'2<"Ph0h@h@CǺ <-1-Ph^h@h@;C e1-PhCh@h@;C5<- G<]w<=t <>t/vEqMƅDž@G@@C9wx$T@x-tB9-t>x-vv @9-t>@b /tB;>t^B<]=t~>ty/tt;wC9@G@@u>DC9Z jEƅ;@G@@t G9wB<]`=rDžt'E ktዅ@9&ѥ9싕9@P7ƅR؋EC jEIECXE(S)C  f/>=QO9wvA9l@G@@u"A'8>y97Q@G@@tG9@G@@u>u9Dž E܉EċUȋE̅~%1ɋBE܉BE܉BA;u㋕UЋEC]؃uEPU9e) RP66ËR PSJA918t6u tC9w>uPf뾍{9t-DžDžU$@t P(@t PwfUWVS8u_)Eԃ=!@EԋPډU9EEQE)Pj SIp9@G@@v@G@@B9u9tyQR'ǡD!@tWPÉ<$.3߃EPWà W3$ B4U؅U܉BE܉;u! u$E؍e[^_ÉڍNF@G@@uE9uۋ]܅tE܉0Uz }UBe[^_1e[^_fUWVSljUMPEUBÃWSƃ=!@jVà V.=!@ j 0/][UB P]+Q@ A}tIUBt$HJȍe[^_Ð?/tIUBu܋]KKȍe[^_fEX'=!@}t|jW@Ã<=!@1f=!@u| V-1Ƀe PWSEp h@*l 3h@lWUr h@jHl1ɃRWp h@kJWVUr h@kjPW]s ho@k1ɃUWVSu 1ɺL@f1ɺ@Vth@P;th@S;te[^_1ɺ@ Åthl@P;Gv;tÃj,S=8xQ)Ph@S:uE@뿍vM@k@G@1v|BA@G@u;-QA@G@@tB@G@@u@J@UB@J@RB@J@Lz=ZB@G@@tC@G@@u MuDƒ@z `BfE@e[^_1э| 1!vUVS] M@ZtF Muƃt-1ɺ@/Åt9h@P9u Ne[^Ðh@S9tߍvN e[^ÐUM@E t MuU 9tHUVSuM@E ÅtD MVU t.H Ft PM)FtSPFe[^à S)Fe[^fUVSu65$@1Ph@h@h@u V3Se[^UWVS11B M9`@u1UPhrh@h$@E XEEURUM Q EDE}M<`@;}uvMDI`@Ft] 9uTM Q sE47uӃ uMU EotStHtH FuEEUE 9PKe[^_E1UVSƉ1ې\@\@ACBuF [^ÍvUSË@t?tHt]f 3"']f 3'Xs']Ð s&]ÐUWVS Nj@t P&W ~11ۍvGfF 9w Gt P& W&e[^_fU`@t Ph&P@t P\fUP@t5!@P\ÐUWVS}] uEE@G@@tvA@G@@uu 1Y[^_É u#K9 u41Y[^_Ív=t:UtAt@G@@tK9 uΐA@G@@u8Utu%FE8Y[^_À=uYQ@G@@tC@G@@u"tau vCt8Eu^;t(C@G@@tB@G@@tJV9uE8t|AeCSuv@"uFXP@G@@tC@G@@ut:Uu v8Et Cu}uC끍vUWVS<1ۍuf 1WV4 @u7u#A@G@@ut0Gt?+t-tCue[^_A@G@t߃ V#e[^_ÀyMuŀyTufUWVS =!@uDX@ \@5\@:X`@5`@#1߫}e[^_Ã5\@ht@bfUWVS lj)֍F)č\$PVRS83$[PWhE@jb e[^_UWVS\EȉUċE1LjӋEȋxэ\ UȋR U܅~GMȋIME1vEԋ<1ʋMԋ|))EЃ }9}u΍CEC!)čT$U1}эyPWuR7E @EMȋQ׈эY SRu7E xm@f EEȋ@ EEfu؋Ur1׈IMPQRuF7EE:@ EV׈эY SRu7E @ EEE UE9P wM A Aȃ+E;EPhghx@h@3=!@uU hjEHPuuM;à x ؍e[^_à u8 Ph@jG`؍e[^_Ãuh@_떐UWVSUʋXuEEe[^_ÐsKt1}IMU4utUU4EEVUEt<E)9E}܋M<:uPQuW0/uET;Ur 4vB;UtN@G@@u vM;UsMA@G@@uEMU E?U؍vUuQ1@ÍvUVS΍M]St?Eu e[^ËU]KE)9(PSRV4e[^1e[^ÍvUWVSEUMEEUz ~FEX1F 9t43ug.uQUMKECe[^_ËMQ9~IMAWQ UMHUPe[^_Ã}t}uMMe[^_1APqUBz 둍vUWVSEUj:R 0ƅte+]C)č|$PSuWe3^F@G@@tC@G@@u W$ى‹Ee[^_ÍvUWVS E1։׉Ӎ\{K )̍t$Ruh@VKVUUU))ԍ\$PSWV jSh@e[^_ÐUWVS];] tiE )H~]E U Mt 9s9H vA9v*Ȁ u t uY[^_Ày u؍X  t31ۉ[^_É륋E@9މ׉uxx u빍vUS M]Su 1]Ívuuz]fUWVS`LH@@D@H@`j,EPMQ`WzStiE쉅\u)1ۋ @1I9t Cu뫍vQVR\n)u @uutH@f@@LL>H0] %Mi)č\$ Si SLSIQLi Sjh@iH@ S׊SIQRki Sjh@[i SHSIQH4iXZuVSiE$"i S}SIQuh Sjh@h S} SIQu hY_VShE!$h Sj EPh Sjh@h@@ S׊SIQRfh Sjh@Vh Sj EPGhXZVS2hqLSITH@эq@@эY} эQD@@SщI T~PX qPu 5@@5H@Lh@XA D@X1ыX\1эD @ǥ f 5D@S)1fD "Xe[^_à PD@t P@@uDžXXe[^_1 PsDžXXe[^_UWVSljӉE!@Phhx@h@>~ 1e[^_|w=!@|M~Ff hj؃|~MPPWf3 ~;)ր=!@u[|w=!@u}e[^_Ðv멀=!@_un@Ph@U1@PPQh@yU덃VSZYPh@]U( h@HU W-뉐UWVS0,(W=0!@t = @^ƅ,@@@ @@@ @$@( j4@$`T4BW @u 01{4G ,H@j@(,AQ  !@9 jN@R@40G(EG,EEUjPRwnE E]]}tt0P(ƅTEL!@*P!@ jY@4]H0w wjËG w P j:P%҃19 @W$m@4^=!@!@) j@@4>!@1IhDžllhn$R$@4,!@t%t4,!@uDžLƅUƅVƅSl h u"HB Z=X@t =h@ L L4*!@=!@? hjhPL?, M @RPh@j>Q("hhh@L軭X =!@X j\X:y11ېr9}99|P\q\G\BLtJ t? t@j ""@< t҉< eƀy uV9~49|P\q&\C@t )؃U Dž<Dž`=!@`d `HP ,XD!@,zHRD1эq#)̍\$=!@ uV,pD\B,BD1 P ,ALEAPYTEAX= @ hٺ@\"@Pj jSJӃ w h@jJh@jJ42e[^_Ë\Gh h6@ `Dž<=!@vh@jJ\AH}1һ(< t>?@\GڋLL9vՊA< uI9sɊA< uI뿋!@0 "=!@h @S+t11 t踄^;l) th1l1 Phhx@h@}=!@y h@xHdVRډ2 j_@4 jh@W@uW@G@@t ƅUt0J( VƅSLʉ6끸O@!@q@ud 0Ųa;d@!5`@S 5\@ ! \@L h@Vd@ 5`@@SPh@jxG =!@=i@4x X1vF 9p3h_@]uމG4Q B9~P)RPC PS4K fEHw w)LL4 5"@<@މS9v4C@DžhDžl pT@tVP=!@AVhX@?ƅT+vRjhy@W~hW@G@@uP0YT@ S5T@R SR jP5T@Q=!@Sh@>v"@Jh@j?=X@tL9 \@ L4ntU4L<,{,Go `8 `m,A(`t `@\8t2j;P…ufB@G@@t J98r@\F,C @\-C$=!@ hٺ@\Dž@DžD\Ct P \<-cw (<--S<3S<,(8tWj hK@8 \ (=!@t(<jD @E D,3S@3C % 8t 8=X@ L8,vPjMQ5\@SjS ƃ}WP藷É4$襳&i@ LC Ph@j;=X@tL9\@ Lo4 h@R,B(S94[@G@u@G@B9w=!@Sډ j_@4nƅT+ tv9l79h&Z tsvB@G@@ufA@G@@;r.;@G@B;uCEy@큽<,,C V P2.@RPh;@j9gt W=X@tL9=\@ LN8 8,B b(vXh@8P,pDh,@j8( X,qDE( &YPjhk@S_!:||@G@@t||@G@@ufPh@7!@1=P@Phhx@h@蠠1ɃGUu)֍F)č\$PVRS 3$0pp p5P@HAO UR]S @\{ǃu4||@G@11BЙ||@G@uǀ-g|B|A@G@HB @G@u//B@G@BB@G@u@D|L9\@?&"@O@!h@j6,_G(8t 8=X@[ L &~,wDj.VNÅt2hk@Phs@S1эyQV,BD.htmf@l= @u%=!@u=!@u= @u !@t( G rDtXRPhp@,ADPMX,pDt˃Sh@m4DLhX@R4ƅgL j蕣T@Lh@3 h@C(4Hs5 @h@j3RL9=\@\y,WVh4@U3BdVjhU@8<(<5@D,Xp @t(8t 8(WtX,@@gu+=X@ L 'Cv'65"@ @t#,BD8-WPh@j[2=!@t3,A Au%V1XIQjXo X#@Ë,WO|AD @u,OG0G4uDžDžP,8P,,0PQRVL,B0xagu(=X@tL9 \@tz L "@u Vl,xd L` $,C=X@tL9=\@ut됃 ,qDy=!@t ,sDX,G G= @u(=!@u=!@u= @u !@h+@,pDsƃ 5"@)FP,wDh@j/ =X@u2 Lxh@wDsƃ떋L9\@ufDj,rDƃ="@FP,qDh0@jO/=X@8 LL9\@K',GGWgtL =X@L9\@tx@ hy@j.#@VS@Y_Pj.|# VS Ph|@j.D @tE|x~jXZSPh@j- 8t[ 8& Ph@j-ywh Ph@j\-뛃h@j->= @t)@Pj-c"@ՋL9\@+ CPZ,BDZY5 @PS,BD7UWVSUED jh hx@h0@!@t8-  P UE =!@t&P@!@t=L@v=!!@Pj\j`PEE!@ PEƅOU= @Lƅ[=!@t =!@ƅNƅM1DžTG W~$$ƃ= @t M @{[t MU"=!@t O `dptEE uM`E$!$\Et PPU 5vsf$ @Ot/ƅ[vx1vE=!@[ph@jf*_5"@?Puh@j) rfEt P4Et P!Et P|t PEt PEt P؍e[^_ËUD@%Y^d` SPuP\h( @j(ulhXZd`WVSPE0\hH @j(0`d@D!@@D"@ "@U uj  u0UsƅMTtthld1ڋ`1 txuJ!@uC!@+="@t-ÀNtEt 8ETSfuuuuP"@E"@`d@DhlD1ڋ@1  x#!@9D| 9@D@$P\hh @j& 5 @Wz @l9d)v=2!@U"juKÃPWh[@`Pڎ$`RVh@j[& S,v=!@tƅO}v Urr$h\@jt& DžpDžtvEPu%7E%p= E؉ptfh@j%Y uq$aƅ[P5P@[!L@@U @R1ۨE-ƅME 0Zh@j$ u贙EƅOjh hx@h0@(XPVh@jz$M1=!@E P`T@EtƅN[=!@UHt{EttTtkT;EDhl!@u}11 oWV Ph@j#h@j#E= @t+= @UhL@j#E ƅM1ƅOVc1P@!@|SQXZd` VSPP\h @j" juvà Ph@j"UEGjSuh@j""|D@TY^SPP\h @j<" Hh|@j"= @ S跇XZh@j!h@jS"tt SK"]h@@j"vh(@j" P藽T"uj u$u\h@j"! ,E|D@ZYPuP\h~@j ]d` WSPU2\h@j `d@Dju3Ãih@jb h@jK PHh@j0 jUWVSÉ։M9rvC9@G@@u-+E9s[1Eh@@G@uF.u2u,C9u؀}tx}tE[^_1[^_Ðu" @AP$EC9t&냍v @AP<$EC9uـ}u뢀-EC6U"@t PZÍvUM @I@t4:}t+1}эA~ۋMD8/uũS6e[^_à 6e[^_fUSE ]8t" PZYP3]à 3r]ÍvUWVS É׉1hPhwh,@h @x=!@u P[ @VW @e[^_V[4 @Wh3@ŐU$MUEPE(t%u5 @h$ @5@@$`YMUE:t uXuà j.YfUWVS u 1}у )̍\$-C-uCP,1Phh,@hJ@w E te[^_à jXfUWVS$Eh @PRƃOl@E VÃEE EPMUtsNMUEEt PEt P SGpt t*]W Wu5 @hH @5@0?E 딃Wuu5 @hl @5@?E i Wu5 @hp@5@>E Al@ VeI1}e[^_à 5"@s#$u5 @hV@5@> ĐUh@t P Pu1Ë@ u1vUWVS } ]t PF=l@t?~t We[^_fw/uZEt1}щHt(U|/uT vBJ/tjVh@u넍vUWS}Wu u-u 1e[_Ë1эD 9sPx/t fBJ=@u==L@uD@e[^f @u @u= @t֍v1=L@te[^U5 @hl@ZfÐU5@h6@>f5@j2jh@j< 5@hjh@P<5@j;jh@<< 5@j8jh@%<$)HUS 5@h@eLXZ5@5@<@Y=5@4@<@;=Cnu jGL$qUWVSQtIpj/1W @h@ @E @EE1*vF{t M:AMEEp`@`@dtՋE@Ed@}~ CtUBUS-@@CmH1{PhRh6@h6@xeCF{MHF}:G}EEp sF @]!@ E @t$PEP @PRMEE= @+= @ "@ "@ m5"@5"@RPP|"@=@}fE fEm]mME.4)ƍ))ų )Í[))Ѹ)R)[-QRh6@h@%\5 "@5"@RË5!@$*Z$Ʋ |h@SVPh@jm!@!@ t/; "@'|;"@sRP Ph@j- !@tK=!@t =!@`~1ۃ h4eC9u1}eY[^_ɍaà D@p4虳hW= @=!@ @;@uK؃QRSVh6@h@Z vV5 @h6@jO 5H!@Ow @xn@"@ j %XZ5 @h<@.Y$r;1$ Ph?@h@Y؃ QRSh6@h@Y 5!@$$ ; h`@Qhx6@5@h4@5 @hg6@ h@ h`@US]t5 t(6@ PAYXhtT@SH]ø6@֐6@ΐU帜fU vU vUUE#Eg@@ܺ@ vT2@@@UME QPQPQ P ÍvUWVSE UTƒTXM t][duvl} p‹MQQ9vAX9TT6Put7xj׋l3p#d3pdT@xEpV苅d3l!3lыTv|ul>p $d1!3dˋT@ EEd8ν1!1 ދT@EEč|1!1T}}ȍ*ƇG1!1ыT@EE̍F01!1ˋT}}Ѝ7F1!1 ދT@ EEԍؘi1!1T$}}؍D1!1׋TI(MM܍[1!1hTI,MM1\1#h1Ѝ h\Tv0uu䍌"kh1#\1\T@4EE荜8q\3h!3hˋTR8UU싽h:Cy\1!3\ދT@ 3` }}` 1Ѝ4x`8] 1ȍ <0EO~o 18] , 1E0C 1Ѝ4E8N 1؍ <0M~S 1 8E5: 1|0* 1ȍE8ӆ 1؍ tdlpT9Xt] dsl{pC Ĥ[^_UWVSu} EXuG@w&tERWVPWUze[^_fuSVރ? v)؉}9w:UUQuVPUEPӉ]@wu+}rEPSuE?E]PSu赼EUB 뻍vUWVS }E EwGG9vG7vcx)GERSh>@P_ 3GD9WG ‰T9 WQuEE }e[^_v8)뛐U8tfBBuUVS]tMs Ct P9Ct P&t P Sue[^UWVS EU2t Ct2s ރ jצÃ1߫EE0e[^_Ívt P虥Ct P膥Ct PsfUWVS\= !@t. @t,5!@tU :aETe[^_o!@@t1у%)̍D$Eh@>@Sh^@PL$̤XZEPucEEhZ@u'EEE u5EE}@G@@}@G@@t EEuу}t$}t@G@@EEu u`ftuP~t0[ u]}ugv u_t$Wsǵ CU7CU C$}UU#L"1ۋ}u)/f",\EE u@G@@t֋U:tBU}w9}$>@Eu(N>@Puu5 @h>@5@j EEEl] uբCƍUE^] u财릋] u藢C눋EuG>@TfEEEoN>@uE- uUEXu藡MʉM1Eu‹B J MMEuȣ!@ }}1}EFU }FV>@uuYUEd 5"@{$u5 @hV@5@E S8@@@uu EG>@uu E^>@uu E8@ uu Euuu5 @hh>@5@ qU@ÐU@@fU@H fU@HfU @hf@jCÍvUWVSuj:V蜱t1)1PSV@@聭t0u1e[^_ð1эYUWVS EEtJj:u0ƅtf+}}@@Ruu3 tX@t'E>@뭉@@Kt!ue[^_1}IM덍e[^_UVSEU EU]u@t @t/@]uEUEU @He[^v h>@fUWVS]h>@Et>@tv @t2@te[^_f@E>@e[^_u 5@$tEt>@ut럐UWVSDŽO@;=p@tx=p@co Ճ ų )Ⱥ<әRVE.)Ph ?@h@D @e[^_Ív?@ffPWh6@h@D@e[^_Ív <љRV)Sh>@h@QD @e[^_ÐPE.)Sh?@h@D@e[^_Ð EU U)щE؉U܍ș)Ӎ[)QVų +EPh?@h@C @e[^_UWVSdEE]UX$‹REUUBREUuu蕋EMQ 1}эA } )ǃ1MAQ qbm d@@RP,$}fE޴ fEm]mދu1dPh4h?@h#?@Bc100%C MAQ ?0RP,$W$E(}fE޴ fEm]mދumm]m19}$hKh?@hA+E9~A+UA BB9]YPuh_?@SA_XjS譫ËM݁pEux|  --.C-K/s}zUrz HUBREЉUԃ9@h@@EEU1E1 t9Et,ܠ@@EtwPVh5?@S@+u}WV,$Mm@@=@}fE޴ fEm]mދM؋UEݚ1҉VPho?@S#@ZYjSIÉ؋U+B$;B Phh?@h?@@My y$9s @9ue[^_ؾx?@ߥ 렾?@ߥfjSͩ@E؃uu萂 Ph?@Sa?jS胩5E EPEEܠ$QR1EP@@ p@@x@@/R$Phf?@S>jSq =@}fE޴ fEm]mދE1PS1녃MI(MT?ȉљG9}ur[K~5FEȍC1ҍ^9t69t:@ B@9t;Uu@ăt?)놃UVSà jYXh?@jXZSjy‰$e[^fUVSuE ]N^ |~fFVV9|M9rIuusF$kXZh@jXv$ue[^vFV 밃v듐UWVS,u }E]MAQEUAQAQ EЉUԃ|#OM]EXM؉]9]EEܠ@@EtW l@@u>UƂЃ,QhTjPWMǁǁvء @!1EE`@@Eut*uu1ҋEUB$EMYe[^_Ð&U؋M܋]SK f]tƃh@EH,݀pd0ɉË)x|T0ݛpx|EݛǃǃAK,C,v@z@tX, @-@9tSBMA Rq$>]C$ @9Mf@P@9u1ɃfUWVSEU EU]uh[NjEUW؉;uEUfGW @t @t"y@u]@P @@HG 5@覒G$XZh@j[^jj1҉G$e[^_Ã,@-뜍v;]_EUTUS]tJ;tEhV>@S۠u<!@!@!@ !@2]Ív!@uh?@S芠u-!@ !@!@!@0]Ãh?@SHu-!@!@!@!@0hh?@Su-!@!@!@!@ &PSh@@5@ UWVS\EE]U!@Ɖ !@ϋ!@١!@EʉUċUBEЉMԋuuЋUU֋EeЉUB5!@=!@%!@ӉMȉ]̀}t MAEŰ]CS }]uċUREUuuRP蕐M13E  EPEMa$VS)E슈`@@ p@@1҃P$Rh?@j"EUR }ыBR t3+EURP,$ɋQ)EUm@@Ek؍e[^_ÐUB !@ʋ!@%!@]Kˉf@EtZ؃uux Ph?@jNe[^_Ívx@@u vf=@}fE޴ fEm]mދEغRPh@je[^_fVm d@@RP,$}fE޴ fEm]mދEPh?@jCEЉ]ԃuuuu)v=@}fE޴ fEm]mދEغCQPhE@j)e[^_fUWVS(EEE ]5!@=!@!@EjUZufh?@j=C9!@~!ؙ=!@u؃h?@jăuuE_Xh@j$TUUe[^_ӋEjE؉U܋M΋]4x, RPs Ph?@jUZ>ʐUWVS8}E UE؉UE]С!@!@EUơ!@E虉UjEGG9~Lv=!@h"@jG@G;!@G)G9GuGMȋ]eMʋ]e RPr Ph?@jG=!@Zvh?@jI@GGuu1҉0G)G9EEe[^_rcUWVSXEU EUċ]uj$NjUMĉHXp  / !@!@M̡!@EUuEƋEEUuuuu}ƙM])ӉM؉] EEuup Ph?@j9uX]ۉ]+]'h@jGދEU̍9"G=!@u˃h?@j뷋G;!@Phh?@h?@0wuuuuG e[^_ËE؋U܋M܅xZ EUEURPUO~.Xuuo$hO@Sh?@j 뜐UE@ÐU@@ÐUS ]jS11҉CS CS]fUS]jEPM+ E+C1RP,$5@Q$CCEuًEUSSfS]U[vUSj蒈É$L؋]ÐUVSƋtSCt>CCUC U N=!@u. Se[^ÐF빍v1e[^Rs3h@@=!@tPv vh@@렐UWVS,ƉU؉Mԋ;=!@Wu .yt_= @u=!@b1e[^_Ívjus2Ã=!@ S=!@tvjs-E߃= @t Ff S<= @ @ s KLC$8 P}t% @H;E=!@ s$~uy=!@Ps$WhB@Y=!@ h/A@<1f{u=!@=!@ h0B@말EpsC,tL= @uCSUE؋pRVMt&=!@,PVuhC@Df=!@t}u=!@s s ƃsV u=!@Wu v h@@=!@| h@@ @Urs!+Eps5C U;B =!@t Fs Ep Hy=!@RUr s hB@Cv=!@Ps WhB@=!@ hTB@fWhA@,E0hB@gEPW; tH uYXubQVs sN ' hA@qjhO@ ƃ뻃Wh@C@@UWVSƉUˋE EjNjE_EGEG GF@F;F ~F =!@u%Ftx~te[^_É>e[^_PuuhHA@=!@tSv vh@@먍vUWVSd]EPS6>ER jnE$/E[E0uZYjj1ɉ‹E^_M1usEfE!@!@ t\; "@T| ;"@sJfMQEPM؍U܋E_ u聀E؃tǃ Pn빐}tEPEPMUEt@tuP2EEjEPuMQEPu\E }tM؅t (EM܉Mt} uE܉E}tF @M9}t=!@t9#B9=!@vE؅=!@= @1Ҁ=!@{E؄= @,D@vQPRj芾Xu h@j۾Xuڥ u~Et P~E؅ P~f@끐Lu5@c-$~E؃=!@}@uPp @M9EEPEPuu,LE=!@t }]|ju:EMMlH(ajhLhkA@hA@%XZju)EE}Gu-}tt#MuuU9fuŀ}- u'[uv 5"@ Ph@j膼fEEȃju9EЅPhnhkA@hsA@$ju91PhqhkA@hA@$j }É0XZuuMȋUЉE_u&4$&$[|}=!@Et PuM!@_E@E uj|X0^|ZYSu‹E^X0unzuunEԃE u{Xu&Xum!@!@ uH1}De[^_E;1}PhLhkA@hA@Q#E; "@}33e[^_à u{ u ;"@o뿃 u$PShbA@jI e[^_Ät!A@PhC@ҹ!@`= @tA@SPuhtC@襹 A@VRQhC@艹uhC@qUVSƋ~1ې F4zC9Ft Py Vye[^US$@tU]SP%f uyE} S%uڃ 5$@&$@]fUVS]hVD@S2ZYPS!É4$Qyۉ؍e[^ÐUWVSu hVD@u2!@E @EY_hD@j!@ @XZjjjjVSF ǃE!@E @Sxtt Px1e[^_ÍvUWVS$1}ӍsE E虉UuuZ?D)č\$PVuS؍43: uuFVn?$@t SP&e[^_ÐUWVS41}ӍsE EؙUuu>D)č\$PVuSP43: uuFV>$@tlEPEPS5$@V"t+Et7Puu5$@'e[^_f Sw uP5$@'e[^_à j%$@fUWVS,EoU؅bU U@EEEEԉŠ}E EЊM-%8BEЊEЊG%uϊBE6AG@tBEBE?AG@t}@Eƀ}@ExЍ47CCPscuCCЊUPUP0e[^ÐC뾍vB딐UWVS8]E ؉Ej uE܃;]EEEEEPE)Pj Vx9wF9@G@@u#C9v9tC@G@@t;#u9wv9}SC@G@@u19PhhuD@h{D@f@G@u-uE@ÃUVSju+ƃt! à VM1e[^1e[^ÍvUWVSTu1!@1RP5D))č\$EPV:uE%p= te[^_jVhSE@SY_SVe[^_fUVS]t:st PCt Pm Smuƍe[^ÍvU=t@t t@x!@ـE@u<p!@ـE@tU=l!@t}~J$P[Ív}~Eu؃EHP$$[[p!@=@ɀ=!@uك$ZÃT$$hE@] EfUE 9EtfE@E E鬬YE@E E闬vUWVS,EEˋE ulEЃEt EE t U EPu:)ǃu; u^PuhbA@j被ulEE̍e[^_ËEEEEEfEEÅqEPS(ƃPXGt VHEt V}1}PhhrE@hyE@PEt P!kuut$Yuk]XZEPS'à ujY3BkEEԡ @9E ujUUЉ<$*}u)!@E܋!@U!@!@EVuuUREPWH}Ẽ G1fG9WSh@F@j觩4$Yuj}U܉!@E!@E1!!@]ԅt4 jEPVuWPE̋E t E< PEPVuWẼ EUUEt UWU U  WEԅEt E u i}uQ u7Xu谡SPhbA@jrWi^uh[uh}U܉!@E!@E̍e[^_RPhE@j $<$^uh[uzh}tU܉!@E!@E"K!@USEUЋE P_iU EP7蘐MԅubEuBE u PShF@jQk PgZu7GE2SuytSuKuE1VvUWVSE}} QjjP`5EU]EvEEC!@!@ t/; "@'}E3 uE܍e[^_;"@rۀ= @u{=!@ur1PEPjMQEP0E܃ Et =!@uhEt PdfEt PQff[+`fxtj5!@ 0E܃!@f P{at=!@Puh@jcXuuAeR tR5!@xu!@y P1E\ 5"@ Ph@j뜠 @E{ hhF@|QUWVS ]u EU}Ph%hrE@hE@ Ph&hrE@hE@  EE@tpVS,$u@Eue[^_@Eu G@e[^_Ð@Eu% G@e[^_Ð[ =@] G@e[^_U$EPuuu u؃E4G@hE@h@@ @@U uj u Eyt@ÍvUWVS(]SdE1;]PhhrE@hE@ ]E {fuu hj+EPVu~à .PSVuU Et:])PhhrE@hE@T 5U9 jjSVu EMUut9}O;}:]tWM9M}TeU9U~U䐃uuZcEEx@EPu8cEuƃUe뻃 udb"@EEe[^_Ë}t u3bEEe[^_Åuʃ Qb"@E뫍vEe[^_fUhhhء@uÐUWVS|EUEUUME,Ã]>UM @EE!@ !@ EE!@!@ E@1]EEEEEEUMU9UUt uX$uE(t u](Et u5E tEUċM QE$tEȋŰM$Qe[^_f]T!@}VE@a u"ET!@(G@ƒEkE$Sh`@u|ǃ %E u؃~B u]}uċE t;uh| ;}])]uv!@ !@uH u=S$RWu` $M9M5EU+EU;U| ;EvET!@}$Sh`@u{ǃ hff?hfffff!@ !@ f uh@ `@d@ `@d@SQ,$-!@Ebp@UU@@E=!@-E EE)t>`@ЉӉu PjQ(]uXu Y^u EEFf="@1(G@؀=!@ uj]XZuuNKXueEp@=@EtJ G@Et7`@d@ uh@p@ËE E11UMQRVSUt.EU@I@:@I@u΀;t>u1e[^_À;u>e[^_1sUS]1Ph}h@hL@O@]ÐUWVS‹XtE1֋Zt1΋Rt1Ή[^_1UWVS ƉӋPt#1эy/CPWRSkVt#1эy;CPWRSkVt!1I?CSQRPZke[^_ÍvUVSEƃ @PVɋEE3؍e[^US]sjUXsaUX3YUCt PFUCt P3UCt P UC(t P UC,t PT s TXs$T]]TUWVS ljֈMt!1f񄈀M@tBuu.}t}Ee[^_à WTEEe[^_)Ӊ] @PhUEGÃGt6Љ񄊀M@t_%@C@CGGuʉ+E;EPhh@hK@Ee[^_fCGfUUWVS/SuuP[E8e[^_ÍvMMe[^_Ef0E܀x/@U1x/PW)Pj/RWZuԄ+]ދE؉E @PEǃtQSuP[Z7RuuPHZU:@+]4 FPEǃ SuPZ uuSY>judVz/}FExj#u7V+]M4 r E@PD1+S+uVj/u4Ytx/ti E@PD1RuuPCYM9;PSuW'Y+] SzD1+]UډU @PUDǃu 1}EыUD QSuPX؃TvUWVSxuGEREt\F1!fM@Gt*%u܉AG@tGAG@uCGuօuuȋE@1ыuȍLM܃h} u 1e[^_ËE Y]̋E)Ẽ E@P?ÉEȃNt&f%tJM@tX CFNu+]1;]Phh@hK@qAG@tFAG@u%%%Š@C@CF눃j]GPPۃx?EEF5;EEFH/tAt=. H/t9}'f/G@9f?/tAG9?/uGyE&uFuuVKE]9]"uV@G@0UU, @G@uDAЉE=B9Uw΋EjWNEjC]VS7KHÊEE]/O9}rC]VSJ.ËEE]eCVSJE]}C]VSJËEE] hO@<F Xu <F$1E}6E9E*E9EEȉ{}E}EЊPHjV?MEjS)MjSMjSMjSLE u;UÍvUSUM t0= @u/ӐtR8uNACCut t u1 [^_]Ít&$U$H)ƉfUWVS u} &}$ÍGE$9u>uӃ 1[^_]Ð$$ة )É[^_]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4${tt$|$$؋u]}]ÐU1M9t :u)]ÐU1ɉWVS E] 8Eԍ&u9ut(t&Љ Tu]1ɅTt*t& ȃtu+M [^_]ÐU(E ]]u}0u؋]u}]ÍvE$E썴&t18Ѝ{tt&EU<$D$T$tf1떐UWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]&UWVS ]} &$ڞu+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%h@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$肝u<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$WHAEEs{xC{$EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]4t&]Eu}]t&FED$$W1 f?[D$E "@D$U$]uɍFD$ ED$E<$D$U("@FD$ ED$E<$D$@v'UUE @U]FUW V "@S1ۃED$D$$D$ED$E$t&߃ t;>t[ "@D$ED$$]u˃1[^_]Í& tED$ "@D$$pE ("@[^_]Ív'UD$'@@dE "@&@ =#@uÐUWVS }1 v@t$$dt&9{u@t$$h$`ƍ [^_]UWVS }1 v9{t+@t$$u [^_]}t&@t$$$ [^_]QUVS@$ƋE@F@1&@;Fw@\$$Lu@\$t$$補E D$F$葈^[^][@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$\$D$D$ E D$E$9[]ÍUED$E D$ D$D$E$Q9 UED$E D$ D$D$E$9 UED$D$ED$ E D$E$8U@+@@Ít&UWVS,EUM=@G@@ Eu&)ċE\$#D$D$$ED$ED$C$E\$t$ |$D$$8t&1 &@\$$ԘtF;~u@\$$ؘE;uL;~t)&&떍#vދE;u֍ e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$V\$ƋG 4$D$QG $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1${$s]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEJ@t`$É0E{C<$|$ƋE4$D$*s \$@$f]u}]t&뙐U]Ít&'UV1SiM֍&9ws [^]fÍ&9Ív鐐t&֍UV1SiM@B$,@։L$t&k9w)&s1[^]Í&9ÍvɌƐU 0]Ít&U j0]ÐU(0]ÐUED$@$1tÍv'UED$@$1tBÉ'UWVS }1Mv<$D$ t&@t$$蒔uԃ [^_] $C$$@t$$rUWVS 1t&<$D$t.@t$$u [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$9E r݉4$t$$D$&$p4$E b$맍vUE]utoU1u ]u]ÍvE $$ZƋE $4$D$E D$wE tC$1s롸$ tE$$E $$҉CthtdE$oD$ED$$E $LD$E D$C$@\$$@1$C$$U]]u$4\$D$$@o4$؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&"@eU@$Ít&'UWVS,EEE E6EEE}&$EF$]]x;D$E$EED$D$EE$|$FD$]$EEEED$@$lED$ ED$E܉D$E$EE,[^_]'UWVSD$2@$Q@@$7u [^_]ÐD$ D$D$Q@$EtЉ‹@ tljB9s&<$H<$D$tt$<$(4$UDNjB B9r[^_]ÐUU]Љ%   Ív'UE]fÍvUU]Љ%   Ív'UE]fÍvU1UwXR@]Ív'UWVS @}t;̊@1f t$D$<$huv @[^_]f 1[^_]ÍUWVS @} tA@1t&D$E$ut)C<$D$uuʃ 1[^_] @[^_] UEuE $hUÐ"@Í&UE$/U Ð&UWVS,@t)t# t$@uE$ڀ@ty$D$á@$>@@@E@@@@@@@@e[^_]ÍvUEeD$Q@$T$AD$Z@E$hRNjE$<$D$D${K<$J<$KC)čt$|$ 4$\$D$rN<$J4$D$@1Et_f$4$z|$@$U@UD$@$_uU@e1&UUuu}}]uLU $wÉ$9r>t$\$<$&$]u}]Í&"@1f$1"@'fUSE$D$$@ÉD$$L@[]ÐUEt;8t6 #@1҃wXR@T$ D$D$@@$=Ív#@1҃wXR@T$D$@@$=ÐU1UuA @hR@ @@@@mR@@tR@ @R@]ÐUED$hR@$1҅uA @hR@ @@@@mR@@tR@ @R@ÐU]CUU S]G) ʃ)1[]Ðt&"@獴&UU S]G) ʃ) 1[]Ðt&"@獴&UU SG,Ћ] ʃ)[]Í"@䍴&UVSUMu t@@B@Bt\1ۅt."@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@@]uu%@@1[]Í&$ti@B$>@D$@@1[]ÐUED$ D$$1Ít&'UED$ D$$1Ít&'UD$D$$`@ND$ D$$@2`@t&>@=@uD@ U=D@]]uu}} G~&"@&]u}]Ív tՅt4`@d@Ch@Cl@C p@C1t`@Gd@Gh@G l@Gp@1rfKUS]=D@t=G( t#M `@ `@[]Í&[]Ív[뼉'US]=D@t=GH\$$@u`@t$Ѓ1[]Ð1[]v빍"@ U$nÍUEwE]5Ot&]Í&'UU ~ÍD$D$ D$D$E$k"1ÐU"@]ÍU"@]ÍUWVS1ۃ }9~t3 @\$$u"@ [^_]f @\$$ׂ$-Auȉ4$ 1[^_]Í&UWVS1ۃ}9~t3 @\$$gu"@[^_]f} tr} t} ft""@[^_]ËF [^_]Ë]F 9t!tD$@\$ D$R@$5^ 1[^_]Ít&]F9tD$@\$ D$R@$5^1[^_]ËE cF[^_]ÍUWVS } @1 f9>tl @\$$@u$Ƹt> @t$$ @>@F@FF t&F [^_]u"@fU @tÍ @@$@$@$Ðt&UVS @t519pt# @\$$?u[^]Ít&[^]bf&'U(Eu]}t;$>D$4$NjED$r?t.]Ћu}]f"@ލ&Et$ D$D$E $?D$|$4$ ?څt떍t&U(Eu]}t;$K>D$4$NjED$>t.]Ћu}]f"@ލ&Et$ D$D$E $AD$|$4$\>څt떍t&UE]uu}} #tEt$|$$>t]u}]Í&]u]}]\=t&"@ÍUEt&D$ ED$D$E $P>Í"@Í&UE]u\tVD$ ED$D$E $x@t]u]Í$;u"@Ӎv"@ UE]t&UVS u ]00 D$Z@$hC0$x;ft^ErtDaDED$$!Ct}$5t$D$É$ [^]ÍBBDDtDErE+ufD$Z@$B@"@됍&15D$Z@$hBuLvEwfvEwE+D$_@$ Bv$+:"@UE D$RD$E$0ÐUS #@uH@tr#@BH@#@:#H@8@@U::#@D$ S@D$@$.?[]ÐD@E #@;] H@}AH@-tH@O@[]QAH@-#@ta7D$-UH@O@$|t#@-1&?[]ÍvD@t&y#@D$E$"x:t,H@#@8uD@#@[]ÍvH@8uhD@9ED@PE:H@O@8:@@D#@D$ S@D$@$6-?U #@H@O@bCD@U$N!ÍU]'!UWVS˃}U)‰E؉+EUE}҉Uu &uU}u+]؉ډ}U҉E~YEE܅~9u1ut&+M9]~9M~M⍴&EU9U[^_]ËEE뀍UWVS,EܡT@U؃D@ED$=$E+EEEdU1EEUt&4tvUD$T$E$uԋ$;EE t }t}ft&MԅɐuEF;Bt=E넍t&]xUҍv#@?,[^_]ÍF;BuF ;B u;v]E EQÅt4Bt]t]UQA 1닄tȋA#@?,[^_]Ã}uu t܃-D@Gt&U$UEb#@tyt#@E؃-D@8:D:t+U#@Q-A A #@?D@]܋D@#@QA #@UWVS,ɉEUM>$CS@M-e+5D@#@D@#@L@P@U}T@5L@P@Ut&كD@O@ˋ #@u 8b D@;M#@|U8-tIUvtvtE$w D@)uvPUPt5L@P@t u L@E-T@wMD@MT@9t<-EB£T@:-\$U$gUt WfcP@<:T@8uND@E#@#@ZAvMET@8t&,[^_]ÐT@O@u.tD@L@P@,[^_]ËE$D@)D@뾀+}effP@#@A5L@D@T@O@,[^_]ÍP@5L@T@O@,[^_]ãT@5L@P@0-T@:uD@#@?T@-<:X@t^D$E$tCMT$L$E $MUEtT@O@~8ut&1Ґ븀xf}5L@ D@T@O@bU)$oD@Ft&B1ңT@X@QP@<;T@8D@9ED@MT@O@#@W9:tN?T@#@8u@z:t?D@9ED@"UT@O@#@::u:]M#@T@O@UT@MD$X@L$E $MUE.w&US]U EM] ]E][]y'US]U EM] ]E][]IU]ÍU1]É'U"@]ÍU"@]ÍUE D$x6@D$E$1ÐUWVS,E u]EtE E}EtUUEEt1@BUԉEЋUUЉEK1M]MUMt] tEM MtMU 11't&EtU# tMU t֋U E܅tD$$t$E,t! ut,,[^_]f4$83uKE܋M !dt&K 9Uv"fr9Ev,[^_]Í&t$$0U1]É'U1]É'U]ÍU]ÍU]ÍUE$Y<É'U}׉$]ÉuD$4D$UG!$,D$D$$|,$+D$t$$G],G1G,w, O0tAG0G]G@u@G}1] US] D$Z@E$t[]v"@[]Ít&'Uuu]}} D$Z@4$K2t%$T*]u}]Ðt&4$(XtI$1jXD$4D$<$GAGG@@G"@농v'U(]]}} u$|$t]u}]Í&$D$SS@`1tԋG G\$ D$D$$-G0G$9)두UE@1]ÐU`@]ÐU1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG@\$$ ju"@ [^_]$ZS@SٍEt1~t01t&ȍ<$t&t ~t&uދE tFU 1f@\$$linU;uݡ@\$$li [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$hu$ @D$_D$gS@$nS@1D$ S3CC@\$$j[^]&'UWVSE}}Et[^_]1&;8t @\$$"huމ<$1ۍt&;>tV@\$$gu1D$ D$D$gS@$nS@RUFF[^_]Jf뿐UiD$PZ@$S@@ÐU"@]ÐUED$S@D$@$ @D$ gS @U]&U]&U]&U]&UVS `@utkE $D$T$3itOPHt0@D9wT$U \$$<1[^]Ðݍt&"@ߍ&"@ USÃ`@t.C$\$S`@$o[]D$$j`@뷐t&UWVS\ `@AE $D$T$1h@L]D$D$@$+$蕻vD$P$f@$D$S@+tpD$ D$D$$ FD$&\$$詽$U\[^_]Í| `DV4$ج"@뿍&"@맍&"@돍&US$ `@E $D$T$ftu@H@D$S@ D$E$~1ED$S@$^*CLE$SL1t0$[]Ð"@荴&"@"@뿍U `@uu}} ]tqE $D$T$etS;Cu44$ĮsDCHt$|$CH$1]u}]Ít&"@ލ&"@ UWVS, `@] E $D$T$>e;FC$NXNjC|$D$S@ D$ E$3xD$S@E$(D$ D$D$$BFD$&\$$˺$3E$(<$ 1,[^_]Í"@܍t&"@,[^_]Ð"@멍t&"@멍&USME uguKD$P$臱@Í@D$&D$$裻[]&"@[]Ív"@搐U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVS\1ɉ‰EE#E$xZËE$XStdfuC.C E\$$o[11vD$xE$VYtXC$eƋCt+rǍ&CC뗐t&$qR@$Ɖ떍F$]EE$/XuE#&tcu :F/<$ԠmED$E$Xt8_4$\$)$衮ƋGu/볍&|E$YE[^_]Í&$XE$}WD$E$X8$v@@E$8W\$D$E$EYaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐUMSYt ЍCA[]É'UE]@Ðt&UE]@Ðt&USM] Q~BA8\t[]"[]Ðt&UWVS|U‰EЉMEuR <U$&UH]9uSUCu< ~<%uBEEz*'E1$Q]B<E[t@ct;n]$fU$QutÉD$E$U]%t&D$U$;E5Mt UȈUEttE$UuUą}Et ]EEEЋe]-EE]EEv$hU@191E9kvэۍẼ9ff]̀|0X9$fۍt^1[vX]̀|09\A&ivÈ|0 9t&ED$ D$EЉ$6M&BEEvqEuE-}]Tt&]u]LEuEu=}u]Ѝvv]} t/}tU}tk}t&uYQuE]ЃCEЉECEЉE f뽃}]Ѓ]릉t&랍CECEKAÉD$E$Uv]EED$E؉$\$6]&+]vvf]Аt&]Ѝt evet&'U0v@(EUED$k@EED$E $v@Ðt&UE D$ED$@$Í'UE D$E$ÍUED$E D$E$Q Uk@(EUED$k@EED$E $l@WÐt&UED$E D$E$ UEU hUM ]t&US]$tC[]ÐU(EE w@EEEEED$E D$E$WÐt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$ȡҍUUE $T$ ÐU]]uu KSA9t BC]Ћu]Í CD$$Ǚt΋S뷍&U8uu]}u؋u]}]Í}}EEPw@$@ t‰EEE@ED$E D$E܉$D$<$tE;Er EtD$E$E␍t&UED$E D$E$!ÐU"@$V@D$ED$3ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$?؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$>؃$[]fUS@]U u$T$>؃[]Í\$D$ D$$ []Ít&US]$.\$$t@t$ 2[]Ðt&D$@$>ؐt&UVSD$Z@$V@ wD$ D$D$4$5 Ƅw@D$D$o:@4$$@D$ D$D$$D$Z@$V@[ )wD$ D$D$4$ Ƅw@ZD$D$ @4$6$@D$ D$D$@$D$Z@$V@ wD$ D$D$4$ Ƅw@D$D$ @4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$ @4$ @vD$o:@4$ @*D$ @4$ @U1]É'U]Ít&'UE@1] U]'T&US]U taҋCu@CC{%t't#9t$t&ӌ1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$śt$u\$ D$V@F$跫Ɖ]u}]Íu \$KS<$8C $8U|$T$$S\$ D$D$V@F$DƋC $8뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$V@C$Q Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$V@F$ʩ4$ 딍US$]u$[]Í&Ct$ELED$ D$D$V@C$JD$Ë@ D$E$.C $蓈$苈E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$31҄u뱍vC!C$뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$g$wt&tyvC!C$ކ:vK9Crt$ED$ $?sY&{Cft$ED$CC$sv'U]]u$IU $D$T$ D$^$$]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$2@$2@@EED$ D$D$W@G$"Ë@ <9}sE<D$@D$E$C $V$N,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$c_utRu4ttG!9u܍f]v֍ovɍt͉$vsG!9uIvvE<$ED$ D$D$W@G$跢Ë@<9}sE<D$C $ 1t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$菏 )čt$<$u9s@a<w%$$W@vЃ|+uf<$59rE1ۉ$$UT$D$F$蛑E$t$ D$ W@$D$qU$Ԁw t Nun1ۉ<$輀e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$-$rFU$T$萍$&TËFCFCF C FCFCFCFCF C F$C%C$$D$ D$$D$C%4$v'UD$W@$W@Ít&UWVS] D$Z@E$~C$# D$_@$N84$t$ D$D$<$uN@D$D$X@$q4$ $"@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$'1[^_]á@D$W@$"@e@D$W@$"@<@D$W@$s4$ "@ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$S@4$]$t$D$ D$D$$?$7&f&'U$~ÍU@tED$@$51Ð6@u"@É'UVS1ۃ@uu!&Ѓ@\$$j3uu[^]U(}}EU u1]]EUt\$t$ $T$ GEU\$t$ $T$E]u}]ÍUWVS,E ]EHX@E܋EuE$X@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$.~8$t 1҃[]f[]Ít&'UWVS$[|1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$RD$$FFF D$D$$7ata$\EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ"@EE؃<[^_]ÍvEE"@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$*`\$UT$M܉ $t^\$E$FU F$E] UMV~HU1fC D$CD$EE$]MC K9}MƋVT$D$U$]F D$$ 4$MUE ]u$tD$E$~$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-"@ [^_]Í<0C= 0sock_peek! conaddr is: %s Local socket fd %d bound. Connecting to %s|%s|:%d... Connecting to %s:%d... sock >= 0connected. Created socket %d. failed: %s. Accepted client at socket %d. binding to address %s using port %i. %s: unable to resolve bind address `%s'; disabling bind. %s: unable to resolve host address `%s' $tI*@*@|*@*@*@*@d*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@2*@*@2*@convert.cfile != NULL/index.htmlCannot back up %s as %s: %s ?#%%d; URL=%sScanning %s (from %s) Converting %s... nothing to do. Unable to delete `%s': %s wbSkipping %s at position %d. %d-%d Apparently %s has been removed. will convert url %s to local %s will convert url %s to complete Cannot convert links in %s: %s Something strange is going on. Please investigate.TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. Converted %d files in %s seconds. Saving cookies to %s. # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. TRUEFALSE %s %s %s %.0f %s %s Error writing to `%s': %s Error closing `%s': %s Done saving cookies. noneinsecurepermanentsession (ANY)%lfcookies.cocnt == countpos == result_sizedomainpathexpiresmax-agecdm: 1 2 3 5 6 7 8res != 0Discarded old cookie. .com.edu.net.org.gov.mil.intCannot open cookies file `%s': %s Deleted old cookie (to be replaced.) Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s Syntax error in Set-Cookie: %s at position %d. Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s @@!@&@+@0@5@?byteLength: %s (%s), %s (%s) remaining, %s remaining (unauthoritative) ftp.ccon != NULLcon->target != NULLanonymous-wget@Logging in as %s ... Error in server greeting. The server refuses login. Login incorrect. Logged in! ==> SYST ... done. ==> PWD ... old = '%s' new = '%s' ==> TYPE %c ... done. ==> CWD not needed. changing working directory *ntarget == '/' Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot parse PASV response. ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %s ... ==> RETR %s ... No such file `%s'. ==> LIST ... accept: %s ab%s (%s) - Control connection closed. Data transfer aborted. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%s] %s URL: %s [%s] -> "%s" [%d] Removing %s. unlink: %s .listingRemoved `%s'. Rejecting `%s'. ../f != NULLSkipping directory `%s'. %s: corrupt time-stamp. No matches on pattern `%s'. %s%s%s/%s!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0Error in server response, closing control connection. Write failed, closing control connection. Server error, can't determine system type. Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory Unknown type `%c', closing control connection. Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' Changed file name to VMS syntax: Cannot initiate PASV transfer. trying to connect to %s port %d couldn't connect to %s port %d: %s REST failed, starting from scratch. No such file or directory `%s'. Lying FTP server found, adjusting. %s has sprung into existence. %s: %s, closing control connection. %s (%s) - Data connection: %s; File `%s' already there; not retrieving. Removing file due to --delete-after in ftp_loop_internal(): Using `%s' as listing tmp file. Recursion depth %d exceeded max. depth %d. Remote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %s) -- retrieving. Symlinks not supported, skipping symlink `%s'. %s: unknown/unsupported file type. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). Wrote HTML-ized index to `%s' [%s]. Wrote HTML-ized index to `%s'. Composing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. [@[@[@tX@tX@tX@tX@tX@Z@tX@\[@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@'[@tX@tX@Pb@tX@tX@tX@tX@tX@tX@tX@_c@tX@tX@#c@b@tX@tX@tX@b@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@c@#d@tX@tX@tX@tX@tX@tX@tX@d@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@c@W`@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@tX@c@p@o@|s@|s@p@o@p@p@p@p@p@o@|s@|s@|s@o@p@|s@|s@p@|s@r@p@p@o@|s@o@p@p@p@p@p@p@p@p@|s@o@o@p@[r@p@p@p@p@p@p@p@p@p@p@p@p@|s@type=PASS--> PASS Turtle Power! --> %s SIZEPWDSYSTVMSUNIXWINDOWS_NTWINDOWS2000MACOSOS/400LIST -aRETRRESTCWDTYPEftp-basic.caddr != NULLport != NULLPASVaddr.family == AF_INETaddr->family == AF_INETbuflen >= 6 * 4%d,%d,%d,%d,%d,%dPORTUSER331 s/key 331 opiekey Detected newlines in %s "%s"; changing to %s "%s" @@: �Index of /%s on %s:%d�


%d %s %02d %02d:%02d  time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
rbtotalPLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; size: %s; month: %s; day: %d; year: %d (no tm); -> link to: %s Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' Timestamp: %ld Directory File, size %s bytes file name: '%s' .DIRFile Getting additional line second token: '%s' day: '%s' date parsed ,wrong VMS permissons! permissions: %s -> 0%o JanFebMarAprMayJunJulAugSepOctNovDecJANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDEC time: %02d:%02d:%02d (no yr); YYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d empty line read, leaving listing parser confusing VMS listing item, leaving listing parser nonsense in VMS listing, skipping this line YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d confusing VMS permissions, skipping line Unsupported listing type, trying Unix listing parser. !@@@@@@@@@@@@@@@@@@@@@@@@@1@@@@@@@@@@@@@)@@@@@@@@@@@@@@@@@@@@ @ @@@@@!@%@)@-@@@@@@@@@@@@@wrote `%s' to STORE );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[m@?host.cindex == al->faultyal->refcount == 1u->host != NULLDeleting unused 0x%0*lx. count > 0Resolving %s... IP = %x , , ...Caching %s =>pos >= al->faulty && pos < al->countReleasing 0x%0*lx (new refcount %d). Found %s in host_name_addresses_map (%p) html-parse.cch == '\'' || ch == 0x22ch == quote_charch == '-'to - (pool->contents + pool->tail) <= end - beg@@@@g@7@@@@@@@d@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@{@@@@@@@@@@@@@@@@@@Loaded %s (size %s). %s: Invalid URL %s: %s no-follow in %s: %d %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s appending "%s" to urlpos. http-equivrefreshcontentrobotsnofollowhrefrelstylesheetshortcut iconactionhtml-url.cfirst != -1appletareabasebgsoundbodyembedfigformiframeimginputlayerlinkmetaobjectoverlayscripttabletdcodebackgroundlowsrc%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: merged link "%s" doesn't parse. @@L@@@@@@@@@@@ @ @ @ @ @ @ @U9@@@@@@0123456789abcdefHTTP/1.0 http.cp - request_string == size%s:%sBasic HTTP, opaque="contlen != -1Skipping %s bytes of body: [EOF received] aborting (%s). %.*s] done. HEADPOSTRefererno-cachePragmabytes=%s-Wget/%sUser-Agent*/*AcceptProxy-AuthorizationHostKeep-AliveConnectionContent-TypeContent-LengthReusing fd %d. [POST data: %s] [writing POST file %s ... written == promised_sizedone] ProxyNo data received. Read error (%s) in headers. No headers, assuming HTTP/0.9%2d %s Content-DispositionfilenameBasicDigestWWW-AuthenticateNTLMAuthorization failed. Malformed status line(no description)LocationLast-Modifiedwget_cookie_jar != NULLSet-CookieContent-Rangeunspecified [following]Location: %s%s text/htmlapplication/xhtml+xml.htm.%d.htmlLength: ignored [%s] STDOUTSaving to: `%s' --%s-- %s %s --%s-- %s Cannot write to `%s' (%s). %s: %s ERROR %d: %s. %s URL:%s [%s] -> "%s" [%d] %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %T[%s][%s]:%drealmopaquenonceDisabling further reuse of socket %d. ---request begin--- %s---request end--- Failed writing HTTP request: %s. Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s"Found `%s' in basic_authed_hosts. Host `%s' has not issued a general basic challenge. application/x-www-form-urlencodedPOST data file `%s' missing: %s %s request sent, awaiting response... ---response begin--- %s---response end--- File `%s' already there; not retrieving. Registered socket %d for persistent reuse. Inserted `%s' into basic_authed_hosts The file is already fully retrieved; nothing to do. Reusing existing connection to %s:%d. Unknown authentication scheme. local_file == NULL || *local_file == NULLWarning: wildcards not supported in HTTP. Spider mode enabled. Check if remote file exists. Unable to establish SSL connection. ERROR: Redirection (%d) without location. Remote file does not exist -- broken link!!! Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists but recursion is disabled -- not retrieving. %s (%s) - `%s' saved [%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). @@l@l@y @@b @@@l@@@@@@@@@@@@@@@W@l@W@@@l@l@@@@@@@@@ @l@@@@l@@@@@@@@l@@@%@5@D@E@T@$@Y@a@H@g@D@n@@@%s: %s: Invalid boolean `%s'; use `on' or `off'. %s: %s: Invalid time period `%s' %s: %s: Invalid restriction `%s', use [unix|windows],[lowercase|uppercase],[nocontrol]. %s: %s: Invalid byte value `%s' %s: %s: Invalid progress type `%s'. 0 <= comind && comind < countof (commands)%s: Invalid --execute command `%s' %s: Syntax error in %s at line %d. %s: Unknown command `%s' in %s at line %d. /packages/wget/1.11//etc/wgetrc%s: WGETRC points to %s, which doesn't exist. %s: Warning: Both system and user wgetrc point to `%s'. )@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@@ @4@@ @l&@@!@l&@@ @l&@@!@l&@@!@D*@<@D!@.@@!@.@$@2!@l&@@d!@(@@!@l&@@!@l&@@!@l&@8@!@l&@&@ @D*@.@!@l&@4@!@l&@@@ @,9@J@(@T@ @l&@]@\!@(@7@ @4@h@!@t2@q@!@D*@|@!@D*@@!@.@@ @4@@ @4@@!@l&@@ @4@@ @l&@@!@.@@!@.@@8!@.@@!@.@@!!@l&@@D3@@!@l&@@P(@@0!@l&@(@(!@.@3@(!@.@@@4!@.@J@@ !@l&@@ @l&@@ @l&@@@!@4@@ @ ,@@!@p8@@!@l&@ @"!@l&@b8@!@.@8@!@.@+@!@.@4@!@p8@=@+@J@!@l&@^@H!@2@g@ @l&@{@P!@.@@P!@.@@L!@.@@ @l&@@!@2@@l!@l&@@T!@(@@ @ ,@@'@@!@.@@ @4@@ @l&@@!@l&@@/@@!@l&@@ @l&@@!@l&@/@!@p8@;@!@l&@G@!@l&@V@ @l&@A@ @l&@`@!@l&@:@)@o@!@l&@@ @ ,@|@1!@l&@#8@ !@.@@`.@@t'@ :@p!@(@@x!@(@@@l@%s: %s: Invalid number `%s'. %s: %s: Invalid value `%s'. infunixwindowslowercaseuppercasenocontrol%s: %s: Invalid header `%s'. init.cSetting %s (%s) to %s val != NULL%s: Cannot read %s (%s). %s: Error in %s at line %d. HOMEno_proxyWGETRC%s/.wgetrcacceptaddhostdiralwaysrestbackupconvertedbackupsbindaddressconnecttimeoutcontentdispositioncontinueconvertlinkscutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpuserglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsproxyhttpuserignorecaseignorelengthignoretagsincludedirectorieskeepsessioncookieslimitrateloadcookieslogfileloginmaxredirectmirrornoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppostdatapostfilepreferfamilypreservepermissionsprogressprotocoldirectoriesproxypasswdproxypasswordproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedsavecookiessaveheadersserverresponsespanhostsstrictcommentstimestampinguseproxyuseragentverbosewaitretryIPv4IPv6 ApBaEGIDINSlog.cbase == 8 || base == 160123456789ABCDEF%s: %s: %s wget-log %s received. %s: %s; disabling logging. %s received, redirecting output to `%s'. Usage: %s [OPTION]... [URL]... Copyright (C) 2008 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Currently maintained by Micah Cowan . GNU Wget %s, a non-interactive network retriever. Try `%s --help' for more options. Can't be verbose and quiet at the same time.Can't timestamp and not clobber old files at the same time.Cannot specify -r, -p or -N if -O is given.Cannot specify both -k and -O if multiple URLs are given.DEBUG output created by Wget %s on %s. Removing file due to --delete-after in main(): FINISHED --%s-- Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! Mandatory arguments to long options are mandatory for short options too. -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. --no-proxy explicitly turn off proxy. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. --ignore-case ignore case when matching files/directories. --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. --protocol-directories use protocol name in directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data. -E, --html-extension save HTML documents with `.html' extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --max-redirect maximum redirections allowed per page. --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-cookies don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --ftp-user=USER set ftp user to USER. --ftp-password=PASS set ftp password to PASS. --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. --no-passive-ftp disable the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dir). --preserve-permissions preserve remote file permissions. -r, --recursive specify recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML point to local files. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . GNU Wget %s main.copt->argtype != -1o <= countof (long_options)%s: illegal option -- `-n%c' %s: missing URL tyndurNo URLs found in %s. %dd %dh %dm %dsSIGHUPSIGUSR1WTF?!append-outputbackup-convertedbind-addresscacertificatecadirectorycertificatetypecheckcertificateconnect-timeoutconvert-linkscontent-dispositioncut-dirsdirectory-prefixdns-cachedns-timeoutdont-remove-listingdot-styleegd-fileegdfileexclude-directoriesexclude-domainsexecutefollow-ftpfollow-tagsforce-directoriesforce-htmlftp-passwordftp-userhelphost-directorieshtml-extensionhttp-keep-alivehttp-passwdhttp-passwordhttp-userignore-caseignore-lengthignore-tagsinclude-directoriesinput-filekeep-session-cookieslimit-rateload-cookiesmax-redirectnono-clobberno-parentoutput-documentoutput-filepage-requisitespassive-ftppost-datapost-fileprefer-familypreserve-permissionsprivatekeyprivatekeytypeprotocol-directoriesproxy__compatproxy-passwdproxy-passwordproxy-userrandom-filerandomfilerandom-waitread-timeoutrelativerestrict-file-namesretr-symlinksretry-connrefusedsave-cookiessave-headerssecureprotocolserver-responsespan-hostsstrict-commentsuser-agentversionStartup: Logging and input file: Download: Directories: HTTP options: FTP options: Recursive download: Recursive accept/reject: J@J@,K@ K@J@hJ@HJ@I@J@K@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@K@K@J@J@J@J@J@J@J@J@J@J@J@|K@J@J@J@J@J@VK@@@:@4@x@@@@:@$@X@@@@H@@@@@:@T@@@( @ @ @4!@!@!@ "@h"@"@"@4#@x#@#@$@\$@$@$@4%@t%@%@&@`&@@:@&@&@0'@t'@'@'@@:@H(@(@(@(@H)@)@)@*@X*@*@*@$+@p+@+@+@@,@,@,@$-@p-@@ ;@.@<.@x.@.@.@D/@/@@;@/@0@d0@0@1@P1@1@1@@-;@<2@2@2@43@3@3@ 4@p4@4@4@<5@5@@5@?.netrcmacdefaccountdefaultmachine%s: %s:%d: unknown token "%s" %s: %s:%d: warning: "%s" token appears before any machine name 9c@ c@c@c@sc@Uc@bardotTERMforceemacs%dm%s%ds%dh%s%dm%dd%s%dh%ddprogress.cpercentage <= 100%2d%% dlsz <= progress_sizeinsz <= dlsz %-11s %4.*f%s eta %s in p - bp->buffer <= bp->width binarymegagiga%3d%% %4.*f%c=%ss %6sK %*s[ skipping %sK ]dp->dots < opt.dots_in_lineK/sM/sG/sInvalid dot style specification `%s'; leaving unchanged. E@@@ @@@@ KMGB@@@X@= ףp#@Gz?A333333???Dequeuing %s at depth %d Queue count %d, maxcount %d. Already on the black list. The domain was not accepted. Decided to load it. Decided NOT to load it. Enqueuing %s at depth %d %s: %s. recur.corig_parsed != NULLnew_parsed != NULLurl_parsed != NULL--delete-after--spiderrecursive rejection criteriaDeciding whether to enqueue "%s". download_child_p: parent->url is: `%s' Not following non-HTTP schemes. It doesn't really look like a relative link. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Already downloaded "%s", reusing it from "%s". Redirection "%s" failed the test. Not descending further; at depth %d, max. %d. Removing file due to %s in recursive_retrieve(): Removing %s since it should be rejected. /robots.txtAllowingRejectingres.c!EOL (p)Ignoring malformed line %dwgetdisallowj == cntCannot open %s: %sLoading robots.txt; please ignore errors. %s path %s because of rule `%s'. Ignoring unknown field at line %dhttp_proxyftp_proxy%s.%dGiving up. Retrying. retr.cmynewloc != NULL%d redirections exceeded. secs >= 0bytes >= 00.0 %smaxsize >= bufsizeremain >= 0KB/sMB/sGB/ssleep_between_retrievals: avg=%f,sleep=%f Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. Removing file due to --delete-after in retrieve_from_file(): deferring a %.2f ms sleep (%s/%.2f). sleeping %.2f ms for %s bytes, adjust %.2f ms E@E@E@E@:50zDffffff?CBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Found no broken links. spider.cnum_elems > 0Found %d broken link. Found %d broken links. str && *stru1 && u2p2 - newstr == newlenscheme_str != NULL*password*p - result == size%2E%2Eq - TAIL (dest) == outlen0123456789ftp://%shttp://%s@/?#;*p == 0httphttp://ftp://No errorUnsupported schemeInvalid host nameBad port numberInvalid user nameIPv6 addresses not supportedInvalid IPv6 numeric addresserror_code >= 0 && error_code < countof (parse_errors)Removing %s because of directory danger! Unterminated IPv6 numeric address^L@gL@zL@L@L@LM@L@L@%.*f%c%.0f%.1f%.1g%.3fUnlinking %s (symlink). utime(%s): %s %Y-%m-%d %H:%M:%SFailed to unlink symlink `%s': %s >?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/KMGTPE@F Lfffff#@MbP?Mb@?mB7yAC1.11xmalloc.cptr != NULLstrdupreallocmalloccalloc%s: %s: Failed to allocate %ld bytes; memory exhausted. GET_ENVVtcpip:/dns/%stcpimapircUnbekannter RechnerDer gesuchte Name hat keine IP-AdresseEin DNS-Fehler ist aufgetretenZeitweiliger DNS-Fehler; erneut versuchenQ@Q@ R@,R@rootfile:/file:/apps/shtyndur-BenutzerWarnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c POSIXLY_CORRECTlrEURwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dr+tcpip:/tcp-listen/:%dw+tcpip:/%s:%d`n@l@Pn@l@8n@l@l@l@l@l@l@l@m@l@l@l@l@l@m@cl@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@Om@1p@Om@Om@=p@Om@Om@Om@Om@Om@Om@Om@o@%o@Om@Om@Om@Om@}q@Om@Om@Om@Om@m@q@bq@Om@Om@n@Om@%o@Om@Om@1p@q@to@q@to@to@q@Pr@Pr@Pr@Pr@Pr@Pr@Pr@0r@0r@to@to@to@to@to@to@to@q@q@q@q@q@q@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@q@q@q@q@q@q@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@to@q@%s: errno=%d console:/stdinconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createx@@@h@@@@@@@@X@@@@@@@@@@@0@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZŔ@@@@@@@@@@@@@@@@@@@@@@@Ŕ@Ŕ@@@@@Ŕ@@@Ŕ@m@ߘ@ߘ@ߘ@ߘ@ߘ@ߘ@ߘ@ߘ@ߘ@ߘ@@b@ߘ@o@o@ߘ@b@ߘ@ߘ@ߘ@ߘ@ߘ@m@m@ߘ@ߘ@ǖ@ߘ@m@ߘ@ߘ@m@Ӣ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@Ӣ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ҝ@ۡ@ҝ@k@ҝ@ҝ@y@__%02i%03i %i%4icmos:/unix_timecmos-Modul geladen? MärMaiOktDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 ٫@@@@@@@@@@@@@@@@@@@@@@@@@@@@ǫ@@@@@@@@_@@@@T@@@@@@>@*@@@@@@@@@@@@@@w@@o@X@@@w@@>@@@@@@@@@@@@@w@@4@@@xZ@@}Z@@@@@Z@@Z@Z@Z@Z@Z@}Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@[@[@[@"[@O@@*[@^@@?[@Q[@Q[@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d DEV_LISTDEV_REG SERV_GETPATHLOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK REGDRV tcpip%02x:%02x:%02x:%02x:%02x:%02x%d.%d.%d.%dtelldir: Nicht implementiert IO_ULINKlwIO_LINK zR| AB E<tAB E\v'AB E|w_AB E `@AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE @ @0@ @7@ @<@<@A@ @I@ @N@ @T@ @X@@ ^@ @ ]@ @ d@ @ h@ @ n@ @t@t@y@h@~@ @@ @@ @@ @@ @@ @@A@6@a@b@6@K@@@<@B<@6@@6@6@$@$@6@7@7@9@!7@@@c@17@k@?7@@8@8@S7@&@.@d.@A@4@7@J@\7@P@@m7@T@w7@]@7@D7@7@7@@7@7@7@X@7@@7@e7@@7@@7@xJ@8@F@8@@8@@@@@@(8@hF@-8@@>8@E@@@M8@@]8@3@i8@3@w8@U@8@^@8@i@8@v@8@I@8@ih@8@@@l@8@@8@@8@@@m@9@n9@@9@@9@O@(9@o@49@p@9@D9@ @8@8@P9@+@Z9@4@d9@=@r9@J@9@9@^@^@9@g@@|@9@Y|@9@@9@@9@@@q@@Q@9@9@:@@:@@@r@@@@R@:@L@7@@$:@@8:@@F:@@X:@/@e:@;@r:@:@SG@:@HV@A@A@:@`@:@T:@o@No@@t@#8@#8@:@U@@v@@@:@V|F@ :@w :@@@@>@{@`z@@s@p@lp@g@JL@OL@P L9@WL@ :/8Q@Q@ @JL@(@PQ@Q@0@Q@Q@8@ Q@Q@JL@Q@Q@O@O@@?@VS@VS@@?@S@9@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1j\@@-  @3@@K@@Q@>@){@@@<@.n @>`@-@J@o@@rP@0@9 p@!@"@&p#@)0&@+(@g1,@2P-@!}3-@ 84-@M93@6A 9@7C9@ C9@yHp?@P`G@;=SI@)SI@ YR@L[S@"^ U@cX@d0X@ 0f@X@7gX@jP[@kp[@0l[@Bva@dw b@  x0b@Lj@|pk@k@5k@ y`v@ڏPw@QAx@5}@Т@@(p@p@@j@P@@?0@0@0@yP@p@f@@S @]@@@c0@ @@/@A@@A @P@]@9p@n@'k@_j=__divdi3G__moddi3?%errnoQ- init_memory_managerfreeZmallocrealloccallocoqsortostrncmpostrncpydstrpbrkdstrrchr-{^strncasecmp strcasecmpomemmovedstrcatdstrchrndstrcmpdstrcpyostrdupostrlenostrspnostrstr(rQd__strtok_r strtokomemchr omemcpy!memset"9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoul&librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerE)timer_cancel8timer_callbackytimer_register+rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses#1msleepsleep*2nsyscall_psyscall_v!}3get_tick_count84agetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars9htonlhtons$ntohlQntohs~hstrerrorgetprotobynamegetservbyname3inet_ptoninet_atongethostbynameinet_ntop]inet_ntoaherrorh_errno(Agetpwuid2getpwnam7CrunlinkC7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killH=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatRPPlgetoptoptargoptindoptopt+opterr=optreset%=Sgetppidgetpid3Sgetopt_long_onlygetopt_longKYfgetpagesizeisattyforkpipegethostnameL[selecti"^chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstatcgettimeofdaydq;localeconv<0fgetuidgeteuidgetgidgetegidGgvwaitpid,waitXwait_child_addqinit_waitpidjutimekxstrerror~l Msendsendto/recverecvfrom getsocknameaccept|listenbindeconnect+ socket'BvZrpcsend_messagewnyieldR x,io_split_filenameio_get_absolute_pathZio_split_dirnamedLget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"nset_rpc_handler#yadd_intr_handlerQ5D vfscanf vscanfIscanffscanfvsscanf@ sscanfJya)vfprintffprintffprintf_putsn+fprintf_putc;ڏg]asprintf_putcvasprintfasprintfA}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#5 Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6Т_exit2abortGatexit{exiti 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf87srandsrandomrand random{ gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeFj0vprintfcprintfprintf_putsnprintf_putc8sprintf_putcQvsprintfsprintfa_assert;~]snprintf_putcvsnprintf!snprintfPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timerydinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namelio_seekWstring_to_ip)register_netcardmac_to_stringip_to_stringVcreate_shared_memoryopen_shared_memoryclose_shared_memory ysyscall_putsnq]mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6nwait_for_rpcv_and_wait_for_rpcccppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperdstrtol/list_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_create tree_searchtree_prevmtree_nexttree_destroyEtree_do_inittree_do_createytree_insert tree_removestrcspnoaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4p io_remove_linkio_create_linkn__udivdi3k__umoddi3fQ@@q@h"intXI5Lf7e~t](e 'eoy.Z%1H id2# 3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzxHv&I3%c-vl3d@@k@@q<b7IY+,93$i\@@int~]ohf"%,Xt0 %low`#`#  s llv  M nL dL rpLnnNddOrrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkwwkm1km0k$v\@@2u#v^v#v~c%uu&tXvv' w(v4&1LB8 WbmxLRptP @#@!@C$i@ @lint~]ohf"%,Xt0 %low`#`#  s llv  M nL dL rpLnnNddOrrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkwwkm1km0k?<v@ @u;vKv;vkc=uu>vv?w@v=&XHLQB8xWbmtxq Kt @ @'0 @ @;lH @ @ 7"@int@H @@Gh"intXf7Z~tyZ](Z>IS)J#])K#Lh##Mh# tNh#)OM#OMS)YM#])ZM#&[#\Z# #]h#^h#s3z3  s cO nz i3  0 ptr3  3&~ d s1 s2d nzkkxxjqoZ M s c3 nz i3 @ @/9 @ @[ptrminMmaj-zh1S @ @`J @P @mp @ @~p @ @O @ @h!h V @m @! @(@bZ"#h#sth maj  @ @$%m~$&>0@o@ '=zH ?3h @a pA zBhA majC minDM EM2 #FzE `N@Z@ZSc@h@P`Y@[@`@@p`zDh `@@L @$@zh &&p@@2 p^ '#z ptrminMz z(z.hS@@0`@@m( @qs.$$X7BMX`S@X@i`@@^&v @@' z>'# z^3p~ ~@@@@)R*b@*c@+}eM,3*f3@*]g:@*h:@*k:@*il:@*m:@-q.A/6@@h"intXf~t](OR!@@X num d# db 4]%  tmp& i'3`  3 Azmw@;@ h"intXf~t](O%3@;@s1#s2#n$d7ow@@@jh"intXf~t](O*@@@Vdst)src)n)dpd,Qs-R o  nw@@h"intXf~t]'@@=s1&is2&(Rc)3sc)3Q o  w@ @ h"intXf~t]+@ @p*ch*3>,Rc-eo Z} w@@Kh"intXf~t](O#Ay43@@xs12s22n3dus17Jus28h  o  o %3@@s1$s2$us1'us2(3 w@@inth"Xf~t](OA@@ :%::ddstB9srcCmtDd*}@   o    /w@@eh"intXf~t]8#@@Rs"~?"$o . Mw@@h"intXf~t]F+@@p*ch*3c,Qo Vw @^@h"intXf~t]_*3 @^@3s1)_s2)o mw`@@"h"intXf~t]f#`@@to"" $o  vw@@^h"intXf~t](O&@@6str%blen'd( o   w@@h"intXf~t](O$d@@str#s%R o w@@ h"intXf~t](O&zy%d@@s$*$Js1*u bit+o tbl,Lidx-3  o oNw@J@ h"intXf~t](O*@J@s))c+lsc+len,d o  MwP@"@ h"intXf~t]2P@@s11`13tok3c43.sc43A @ o   `@"@T s__a@w0@i@_ h"intXf~t](O )0@i@s&c'3n(d&p+R    AJwp@ @ inth"Xf~t](O Ap@ @E :q%::ddstBsrcC2tDd*}0@   o   w@@M h"intXf~t](O#A"%OyV<@@  :C c0:3 :d t=d c?z?! dstAh! o5n6@a#@ h"intXf~t](Oy#d@@!s"!E"d!len$d"  o @/ @@&"Cn.OR"s.Cr"X.O" st0IKi1O"y;O# t5O YY ]@@&#strR#/3]#3# c @'@#str]30@9@$1s1s2l@@\ @3$ɸ_$end$˽]t̽_Xͽ^neg3$83$out@  C ` @ @% end e @ @3%KendLEV @#@_%D%(D&XD3/&FV&negG3E'outB!@3#@3#@e'sU1@#@a#@'1(X3yup#@.&@ h"intXI5Lf7e~t](e 'eb0Zzo y , "-# s .#  /kp#@$@'jZ'#jZd(Zj(il3(DqZ)rZupe$@ %@\)dA)s dAF4%@%@)4E)s E GdiHZ) HZ*MS9%@.&@/*^i:Z6@4@  1@  2 "@0&@'@&h"intXf7Z~t](Z''(##)o#*zo  &'#(O#  a0&@&@[*2 `O*I)b2ic3* O&@'@*y NO*I)P2iQ33+,O'@'@Q+ +}++Oid-O+52+I)<2i=3+#@$O@(@w,@h"intXf7Z~t](Z 'Zb0|Ooz 3 pid4O# 5O# 6o# Z7z# B8 '$ '(*# #)o# $*Ao tpids|sO u3 vVr(@J(@+pidp|pO q;bP(@(@,pida|aO a3S(@(@:,gpidQ|QO RO C(@)@f,pidA|AOlenAoZB; {A)@)@, )@i*@,{pid|, ; -o(-Z;G-Os-M{ Kg\r-}A H!1p*@*@-pid0| 0;0oZ0; " 2!3;*@+@-#pid|-$ ;.$o<.$Z;\.%;|.% .%" O.&o3 +@y+@.pid|. ;/o!/Z;A/3a/ /&O+@+@/ppid|/ ;/o0Z;40OT0 ߉r0'L+@w,@0J|0JO0Ko1ZKzS1 MNzs1(3O@):*.@0[- ,@J-@Lh"intXf~6 8at]oK +,@,@1D #,@,@1? "1 $V1y E .O,@J-@&2 sec-OR2 /Vr2  V P-@q-@h"intXf~t]o P-@\-@2  `-@q-@2Q V -@-@h"intXf7Z~6 8lt]o !a-@-@2eax"O3edx"OR|8 -@3@ch"intXf7Z~t](Z 'Z3pid4O#5O#6o#Z7z# B8 o   ''(##)o#  *y(V")#*#y +1  -@-@13 3]3! ͙ V  -@-@}3 33! p C-@p.@3"B3iD3+4! E p.@.@I4d"u4i34! 4  .@.@4"5! &5 e/@/@95de5#do5h5 r 3/@0@5_"6=6. 3u6! 6/@0@f  ( 30@71@6 636O #3@1@1@7str"=7sep$]70 .o{7"/B 31@1@7 V \2@3@7!pidZ|7ZO8"#Zo"Z[z # ]zud# ^ouh# _oul _o18$i`3up! a  63@3@D8U=|p8P3@3@ AU83@3@>C8P"KL8 # -l@ % Y3 M 3@9@h"intXI5Lf7e~t](e 'ey "3oF,  &Z A' (#  6 !6# "<# #3# $3# %<#  6 T )  *6# +<# .3# 06# w 4 56# 6<# 73#W> L  \ .Z %1~ id2# 36# pid4# .5# 7# 8z# >9z# :A# 4] 4 @q?3XR@  )3@4@8z (9 .S4@4@9$f -SK9 3 4@F4@j9Q 29 8SP4@]4@9~1 7S9`4@v4@:,: <4@4@K:";w:i=3:  -4@Q5@:-";( ;;i 3}; B 3`5@5@;y3;srcdstD 4 f35@5@;eipe 5@7@<"?<i3_<h ɸn6<fѾ<;Ғ p6<  @ @!ipZ@ @  Z "# 7@^8@<Gy3=$srcG2=$dst6j=#=DNres6= M% T&Ap p6`8@8@=iporesr6 >!bufq@'% T8@9@3>$strS_>(8@8@V)*8@8@X)"+"6+ "65+,  %(@,  %0@,  %8@"B{+, k@,: .% @"+, 0@- &3#@. 8. Y3A M 9@9@h"intXf~t] (O )Oy # %# 'd# )o# +#  -# /#o" >   uid=d 9@o9@>2 >  . p9@9@>t "-t?9@9@4(z # @-2 M 9@9@h"intXf~t]yo+ '39@9@9? +'k3M 9@i?@h"intXI5Lf7e~t] 'ey { #A H    3 p # # 3#0Q ; oG 39@9:@e?sQ s?n3?  3@:@:@?Q s)@n3_@ &3:@:@@Q %n%3@ <>3:@;@A^=3/AQ =qAg=sAi?3B-os;@?<@@B nslBidpZ@@e 3@<@e<@BQ s 3p<@<@BQ sX 3<@=@Ci43 3=@=@2Ccsig3^C#cColdrC i   =@G>@Dn3,Ds yD H3P>@>@DnG3Ds [E*g>@>@.E {>@?@ZE<nz3E k3 ?@i?@Ew pidjznj3EG! +w`@! ,@![-D@M" Y39p GM p?@RG@B0!0&:oh"intXI5hf7~t](U" '*,Oy.v%1uid2# 3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  *   ]  ' ' (# # )#   *'8 @(8#fd)O# +O# ,O# dupOp?@?@EkfdOO?@?@)FfdOO;"O?@)@@UFfdOFiOF O0@@:A@FfdO GcmdOGGiOH@@@@sap%argO_H@@A@ap%argOrH|PO@A@A@H@O8H\Hi]OH:B@KB@ I p~8PB@B@9I7fd}OeI!iOIuB@\C@IfdOIbufJ";#J"CJ# 8{J#8JretJ $`C@ D@JZfdO Kbuf,K";LK"lK# 8K#8KretKD@D@ Lfd~O5L"~UL"~OL# 8LfD@D@M fdeODMHe#e# g8dMJo"HD@aE@MfdGOM"HGM"#GN# I8VN#JQtN8pE@|E@N%fdO& ':"OE@$G@N +N OCO(leyOfdOO# %8O)af 8OhF@F@|f8P*f8;P+:,-{:O0G@RG@zP +99(0 @ (3O@.68.b78. 88. YOL"M `G@I@oh"intXI5Sf7l~t](l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % C:`G@I@P @:P A"Q BarQ oliE?QD?H@  ? 8 V4?#@1:D@2:#@0:@@3:#@#M I@I@h"intXf~t] 'Oyo1dI@I@Q'dI@I@#R$M I@R@Wj"Yj#a|#6g#vall|# puoint|h"Xf~t] ( gcd| a| b| c| pI@J@OR|{RA|RF|RR|B|i|Sj|,SK|?Sg|ulj|uppos|jSg}Su.|J@0M@SS9jS4SidxʃT|T |VUNu`ud!Ui|U|V[||2V%p|0M@R@RVn|~VnV9njV4oVidxo[W o|WoliqXr|^Xr|Xs| !o|R@R@X"m|"m"9mj"4n #idxn!b|R@R@Y"`|"`"9`j"4a #idxatT@w|P@Cx|L@$u%!&'7{ $u%'|R~|X@'$u4%"'C}$$uX%'gH$u|%)'.l$u%'*l($('|(*|(.|(1|b@&4M R@tS@`h"intXf~t](O 'Oy;'3R@R@?YG03S@S@kY#/3_8oS@$S@YZA30S@DS@Y @ 3NJ3PS@tS@YK bufIK lenIdQo  Y3&kM S@U@h"intXI5Lf7e~6 8wt](e 'e{0~1y d!#"#)*Z#+o.Z%1 id2 #3# pid4#.5 # 7#8#>9#:A#4<#A=#!  AO>] 4  t93S@U@Z 737GZ7gZ8Z8Zrd:wr;err<c=3Zf>Zret?3$[AZu`BZudDluhiS3M[   Z 'yM U@ X@h"intXI5Lf7e~t](e 'e (e )ef(eW)e*e-+e,3-e.e{0sy:4`a#lb#c#d# e#Pf#g#i#]k# l#$ m#(En#,o#0o.Z%1p id2#3p# pid4#.5# 7#8z#>9z#:A#4]4|  43 U@'U@[ +3 3  C30U@7U@[ B3 B 3@U@JU@[N + ޾ ?3PU@ZU@\ +  $ `U@jU@G\  3pU@U@s\  ̾5R3U@QV@\DfQD\QJ\posSs]   s3`V@V@] 3F]Jf]fD] :y3V@fW@]  +x]xJK^z3^ {D^W@fW@dir ^ | 3pW@ X@^ +_JT_3_fD_W@ X@buf}#(@ Y3()xM X@'X@v h"intXf~t]{0]1|y d!f#"q#"3X@'X@_ tv! tz!d m)M 0X@:X@ 0".P$.# %.#&.# ).# <*.#L+.#,.#-.#...# m/.#${04#(14#)24#*34#+44#,^54#->4#.A4#/4o j0X@:X@_j!%`@%#*M @X@wX@2!h"intXf~t] (O )Oy#d@X@GX@`)dPX@WX@J`/o`X@gX@v`5opX@wX@`q*M X@F[@!h"intXf7Z~t](Z 'Z''(##)o# *o y  )  pid*|#+ #,3#M >BCCpidA|iC3DC  nvpidm|io3pCR|X@~Y@`&pid|`&a93aCaX@X@#0.a7I@Y@tY@VPaaj 3|Y@Y@bX&/TY@BZ@;bpidS|gbVCoutf7Z@Y@Y@V#h.b7PZ@[@bqpid}|b}O#}o)cZ~zIcCic K#.c7!#.c7"M9 [@F[@c#0@ $ Y3l,wM P[@d[@"h"intXf~t]{0]ya!Z"d#i#d#q*3P[@d[@c +)H)  o  av  Y3-M p[@[@=#h"intXf~t]oyd *rp[@[@d)3+ @d ?  -M [@a@{#h"intXI5Lf6^7p~6 8t](pU" 'py "3#p-v/#W2#   o :-   _ F< ,  &eA'b (<#$ ,]-#@.G#m/e#D)B(C#(D#)E#(F3# Q%hR# S#T#_w# `.e%1id20#3#pid4#.50# 7#8#>9#:A#4<#A=#!   AO>;M& zres {# |#%] 4P*id+w#W,#v.#/#0#D1#H#2#L  h`_3H__ _3 V*U3HUU U3;GG6:3 ![@[@intXf7e~t]orpc"a@a@ipid!Zi #ZP m2>a@b@iDpid0Zi D0Z&j 0ZFjlen1Zfj Z1zj 33P z:Th ZT D0. V b@,b@*&h"intXf~t]o b@,b@j(10b@j@a&h"intXf~t](Ooyo''(##)d#*  & g   J/ Z1&n2#3#5&# o6p3pcwd}v33ppcwd}v(3i)3SFvDlenEdnEEGv oi0b@gd@jhk3hp&kh3Ekwjugposkdkluhnmulnvkwdk !!!!"#nc@c@(!!!!"#c@d@[!!!!"$d@gd@!!!!"M%%}pd@e@l&lv'pl(d@e@'}l'dm@3pi33v):d39p#;di<3=v7_3]pH]}^ib3cv%} e@h@mZ&Fmv*pud3'#dm'}m+6e@e@r!C ,Nm"Y"d-|@!X,m,n",,n,Jn-!, ~n,)n,4n+@g@g@!!R"^,jn"t.g@{h@!!! ,o,-o/}h@j@@o&lo'+}o*3pul'#do'vo-@P+!Rh"^,jo"t.i@cj@-!!!,2p,Fp3-V j@lk@0(h"intXf7Z~t] 'Z (Zo>'oj@j@Yp pid(op8ok@k@p pid7o 9opFVo k@Ak@pm TO uidTz xT (Uo pidWoq kPk@\k@qUz`k@lk@Bq {nqg4qV pk@k@(h"intXf~t]oapk@k@q4V k@k@)h"intXf7Z~t]o!k@k@q O@ 45,k@Sv@})0!0&:oh"intXI5hf6z7~6 8t]( 'y.%1jid2# 3j#pid4# .5# 7# 8# >9# :]# 4<# A=p#! : ]O>]4v%  O &   :'#posO#  :J= K=#posLO# ?Obuf=j#=Ow=>#>X>Oeof>&@OiAOcBOCO O?ptr#Op ?1EK o  } Ok@k@q#rs ret OR $Ok@k@$r##s%gOk@k@Pr #fsh  l@+l@|rS#r c:rs!O0l@t@s"fmt@s"ap%Wu#wZv#zv#w##bw$retOu%XOu&lenOx%#Ou&cOy%(jup'z$bufP(h)),o@)o@)cl@*+X Oz,eofOD{-( ,ptr9{.H:///0s@s@10s@s@120s@s@12 t@t@1%-xlpuendu3_Ou@3OuDptrjuH45C-////u/j/_/T*6{16"|7uL- C,ptrBK|.@C///0ot@yt@ 10&n@8n@120t@t@212t@t@1%-`mptrjju3kOu*,iKO|ptrLju8:9:8:;<pOt@u@| =fo==fmto=apo%3#qp<O u@Cu@|I=fmt=ap%< OPu@ju@ }=fmt>ap%retOP< |Opu@u@7}=f{==fmt{>ap}%ret~OP<-Ou@u@c}@ ,=fmt,=ap,%3#.p<:Ou@v@} 9=fmt9>ap;%ret<OP^v@,v@} #] c]:}s_ ,f`=~PO0v@Sv@~6 #OE~sQ fR=,cSOp~?6=]\8P,`v@Bw@,0!0&:oh"intXI5hf7~t]( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O :  O  O  :2   v# F#arg#j##fp$## k)4O`v@v@~fp3#!3ap3%x5 tZ6h*<Ov@v@~fp;#!;ap=%?>OPw/Ov@w@~%arg.%.'n.O]  (O w@Bw@}arg'%c':c9,Pw@x@|-h"intXf~t](O0!|&o3 o 3 o 3 2   # F# argo#  &W H'W# (d# )d#-3Pw@w@arg,c,* >3w@{x@`H=!=€ap=qx? `@T?A3We3x@x@ Hd!dapfq?g3P:(,x@z}@!.h"intXI5Lf7e~t](e 'ey.Z%18id2#38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3 x@x@LrYox@x@x3y@ y@@ d3y@^y@Ё,c3@y@Vy@cs>u{>8`y@y@28^pos3c3o3y@>z@Ђc3@ z@6z@cs>u{3@z@z@2 ne^strY|3z@ {@7strY/{@z}@D~;0p1~~#2z>V>V0)@$@b%@ &@ Y3 g<,}@<@/h"intXI5Lf7e~t]o(e 'ey.Z%1?id2#3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#5Z#6#Z7# B8a 7id8#9#p:#;Z# X<?Iid@#A#pB#CZ# ZDI# AX ]EOyidP#QcUidV#W KM  z& zres {K# |#%N@ V2%#13E@%}@}@̈́c8}@}@3}@}@%@3)_3}@}@Q +^3}@~@}_@H? 3C# P_ ?out8}@ CR3~@~@{@Q&M3~@@@LHL?#LG3 @N@ӆ@FHF?P@K@src+Jph@#Ї) @@Z  A  X3P@Ȁ@7@@#v3Ѐ@1@u@ 1yp!3@@ā@"@"#ZXhsЁ@Z@v@g npos w N3`@ڂ@"d@MNMsM3$@@܊@ @v@Z4Tpt@#{83@҄@M:%str7@7W%3@%@yc$3@$&ch&zu{30@@Čc3@&E!@@\ ""̍"p"@<#E $\'  #()'  *4#,R@@*i3e+EF3@B@x @E,cGzڏ=]?P@@u \?&\3\@\|,i^3,c^3!K @V@ؐ " +J"J$- L?up.msgR +SE*iW3f# ~#@/ +P_ z 0`@|@l3@I@ kDkd Hm _nyo,srcq,dstxÒ/(  A 1!P@<@M "/"O"ro#+V-j-@-'.Z@-/@2 82 Y3 ?7,@@h@63h"intXI5Lf~t](Zoy''(##)o# * e@@@Ó d3 msggd  hzVi,A, 3JE@Ď@0M3Ў@@:sDLus 1 @h@f 03@@Z@i43D5u >(@ Y3 ^@,p@e@3h"intXf~t]0!q&{o3 d {3 d 3 { 2  # F# argd#]z(yP 0 <3:;OV{   # ]#}'|buf| |O2Vp@ԏ@Д 1VY1O:j1Z3Vrem4OOL@@.KVbufKKOKO.pMuXN.u`tOVNPOjQOup 3@ǐ@mxmŖc{w3А@j@%xmQqn3H i3ޗ3  3p@@!;" 3d#-@@w!!,$ap,f%%.ud"a/3% 03ul"03ך"03,"13"23&i33#R3@e@, !xmX!!$apft&tY"3P" {" O" !O""Oa"F#O|'t$O"m%3"&ȥ([?@)h &ret23) &ret=3P) '") &len3٦&pad3) e&ret3*U@@&ret3) &ret3a*6@a@&ret3*ף@٣@+ret3P)0 &ret3,@(@&ret34,@@&ret3*ܗ@@E&retX3ު)H -bufl %m]) &ret~3. }/0Q1]) +buf "v3)0  &len3*@@+ret13P*ҝ@@!&retH3*k@@?&ret 3)` Y&ret#3*@@w&ret?3T*(@M@&retC3*M@y@&retE3)x &ret-3ڮ) &ret3/,(@U@&ret)3n*כ@@ &ret^3ί) : ":) T "V$*؞@@r &retS3 &retY3)( &c{H &ret3,]@j@+retc3P2{ 3 45{6 B3C0 ,p@@7h"intXf~t]o* ( 'Onp@}@g| " K@@  JO n` L + 23@@ rnd33# A]@@  3@Dx,@@7h"intXI5Lf7e~t](e 'e{0sytm$".!#3#U!$3# %3#!&3#  '3# !(3#d )3#9z#:A#4@]4 )  "! 7  z  1!  ! ! ! ,! ! Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec ! ! P! '!  <  ! Sun Mon Tue! Wed" Thu# Fri$ Sat% & ' !( AM) PM* + e!,A |@@* {V{v  3|!3ݲ6!}&]@  D!`@ǧ@s!__!bu|!oЧ@@' s!n @ @S6  @@b b htm  @*@s!ԋ 0@7@׳s!݅j!z@@@str/u zgJ ۴tmbi.c.#z9nzb_ ¶l H i .3.. D@@tC"Eut G {  3& tm"@!%L]@R &L]@r, 3\@b,eEQ,@I@90!0&:oh"intXf~t]yO :O O : 2  # F# arg#S<O@Ƭ@c!;ap;%[=l+COЬ@@з!BapD%?EOPx,O@0@arg++(n+O^len-O%O0@I@arg$c$:F,P@@V:0!0&:oLRggn:int {gng : 2  A# Fp# argn#   H!# " #:~&gP@p@߸Karg%Kc%:!-gp@@ H,7!,bap,%x.l!/`?0g<g@@H;!;ap=%?>gPG!,@/@:oh"intXI5Sf7l~t](l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K !'@/@ !% %8 \%:c !&:  %  8 VznH&",0@(@;h"intXf~t](O0!|&o3 o 3 o 3 2   # F# argo# " "W H#W# $d# %d#")30@@arg(ںc( "C3@@R!HBW~#Bd!BԻapBqxD dEX?F3"U3@(@'HTW#Td!TapVq?W3PIb",0@0@<oh"intXI5Sf7l~6 8~t](l 'l{0y.aA"/H%1`id2#3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %"&#'##(s# )#*#`+# %  T"-"$!!+#' l -%1"*:P@)!0@K@Sn"CP@@+B'@D˼M w2@@Dn"P@@?+O'AdirQ!a@@Q)e2@@S">:@ɯ@@=!==:{"0Я@0@@/!׽5 JV 0@E@%=h"intXf7Z~t]o"!0@E@+ O ONK#P@k@=h"intXI5Lf7e~t](e 'eo 3 pid4Z# 5Z# 6z# Z7# B8y #HJE "KE# L3#@ #Mz#D #NU#H U? Ad"3P@@W#res3 ?#3@ڰ@dev#z"@M@Sxؒ %S,v&zLpos3w#3P@@xgv&3uppos3M#@2@xv&33supret3% %v#C@@w@FQ"BQ#l@Ĵ@r;cmdk#k3pidm ]#pzuh%#q;#rul"z@#zSMJx f"Ydir "zi#h J Y h w-#Xд@y@W3"YmsgZ#1@>@"0"2msg3 #N@@k@DpidMM$$p@ֶ@?h"intXI5Lf7e~6 8wt](e 'ey.Z%1Cid2#3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#Jl#K3# O$Ld VM  $.p@ֶ@p @- -l -3 $/dM$@@?h"intXI5Lf7e~6 8wt]$ -.Z#mac/l#o  y $.Z@R@ ip-K $/la$1AjA)$t`@@{$sZmacsl $uh Hz{T j$Y@e@macXl Zuxx$Mp@@ipLZ Nu|N$V @@n@h"intXf7Z~t]"%%zo %O@Ӹ@ #O idO8$z@@K idO Dow $@@ idOO8%V @<@@h"intXf~t]otd*%3 @<@nOsni PQ%V @@@5Ah"intXf7Z~tyZ]%$h"%%o&%'#?%(z#%) %! # O  O ptr" @@@.  hD%1@@#0O 0O ptr2 2 p`%7@˹@:#6O6O 6O ptr8%G3й@@f3F#FOHOMv%U@@T#TO#Q%V @,@Bh"intXf~t]o%@@%  @,@kQ &0@@GBh"intXI5Lf~t](Z&)3 'Zo 6&$ & ' % ) *# +z# len,o# {&/& num0o# f&1&#5 E&4z ppb5z# %6o# &7o# (&8o# &QoldP&Po&PonewRAQ&>b?5&Y0@@)YppbzUooleno&o*i3QMn&3@@Hppbztoi3Rv&3&@j@+ppbzo)%+v&3 i3Qarg 3I&b3b``alenao 1&co  d3newe!"""!#$&3bshm3 #opi3 b&3 z %%3p@н@\9%9bshm3p9% & #%1@ "a"V"K"B&h 'lH#w#(@ @k"""& #) "& ##'f'''#?&н@@* Ţ%9shm30retȇC+ Y3S '6 @@C0'4AAc3Aint@'9Adc8A' AcAX'*Ac)Ax'HAcGAH'MAcLAd @.@Vv8'%A0@>@c$A@@o@; h'/Ap@@ec.A%@@<7H@Ͼ@hZ('>Aо@@ c=A'CA@/@ cBA 0@D@*P@d@V3P'RAp@@ cQA {@@Sv 1 H@@S 'WA@ǿ@ cVAp'\Aп@@ c[AD`'aA@@c c`AnT'H@@5Dh"intXf~t]'#]@@str"("X"3?$]'%3Gv&s'3 o  Y3T(R(@1@Dh"intXf~t](O''(##)d#(])##$o# *q 8(N@@ 3MM  "(Vd@1@7 3U> '@@@ 3  3Rz(n35 'o@@^ 3  3)ݿF(o@@H3  3? ou)& '( 'o@@ 3'o4(B@)@R 3A~ (0@@' 3  3 oC(@@' 'h@@n 3g gom ,(6@1@137'+@',3@ (-@ dV(R(@@@Eh"intXf~6 8at](OD)B(C#(D#)E#(F3# | QhR# So#To#_V# ` )*z; (*; I)* (8V (8; I)8 res9V /$ (n3 (m;keymV )m resoz(ps)qV ]R h /$ b)! (; I)(P hI) tmp ) hI) tmp A)1 (1; )1z")z@@3@]](;keyV ret (A8u]R`h;/$( I) 3)3]@@@`ju N)z@@3m(;_)zz(old2 @@Q/$!@@/$X)z@R@C(;o)zz(old )@+@/$!J@R@"/$"(]`@i@SE#(\;")Ep@@#(C;# Do#Do)Q;@@# Po#Po(R;$)@@y(;I)"%)up&tmp<  !K@l@ n.'K@l@9D]  `]04H !`/.x9DTP0"]hgsz !@@T.'@@9DP~]hs!. 9D ]@@'@@. P@$@*]'@$@hsx P9@Z@$F]'9@Z@hs!]j@@''j@@(E;@k@^ (D;)Dz(newF)(G*(HVu\W @@F A@H, ]RXh X@@X 'X@@8+Al@@u]R'l@@h,]p`-.)nzp@@(m;%)mzEI)oe*)puh;):)(F(r y@@oy p    ,]X)w@J@eIh"intXf~t](O&zy)%d@J@s$H$hs1* bit+o tbl,Lidx-3  o oY)M P@@Ih"intXI5Lf7e~t](e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K )&3P@@ %%3f)2dir-P  V d Y3Z*M @@Jh"intXI5Lf7e~6 8wt](e 'e{0~y.ZA"/A%1Yid2#3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> )!)"S#+*## _  DIR&l%""&"#'##(l# )#*#`+# _2 T"-#*t@@nsdirsss~ )i@@dirhs)]~@&@dir\s)C'0@@'dirBs)D->*J\)P' w 22*53@@_dir4s**s@@") _[*@@Kh"intXI5Lf7e~t](eo 'ey.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z*[#*\#j*^z#"_#  a*`dc*d#j*fz#"g#  a*h *3@T@*23+?ul+?S*@J* a*z#z/H)  V  a  ;*33`@@Cs*1o*1+2]43}*5J*6+G?y+H?S*@*@*@@@a*mz#nzHo)rM  a  Y3\$i@@-Mint~]ohf"%,Xt0 low`#`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0k(+_@@ n^Ld^l8`A7-PLWbmx)kDbt`@@0@@%^$i@@Mint~]ohf"%,Xt0 low`#`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0k2+S@@uRAvRwThVA7-LWbtPm"xa0dw$@(@@@% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I4: ;I 1UX Y1 U414141  % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I1UX Y11 U4141 41  % 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > : ; I.? : ; ' @: ; I: ; I4: ; I 4: ; I 4: ; I  ' I I I&I!I$ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I 4: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > : ; I$ > .: ; ' @.? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I $ >  : ; (  : ;  : ; I8  I  : ;  : ; I8 .? : ; ' I : ; I4 &I.? : ; ' I@: ; I.1@1.? : ;' I@: ;I4: ;I: ; I 4: ; I: ; I 4: ; I U4: ; I U 4: ; I !4: ; I "I#!I$: ; I%&&&I'.? : ; ' @(1X Y )1*1X Y +!I/ ,4: ;I -4: ; I?  .4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.? : ; ' I  : ; I .1@ 1 .? : ; ' I@ : ; I1X Y 1&I4: ; I % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I$ > .? : ; ' I@%  : ;  : ; I8  : ; I8  I&I$ > $ >  : ; I .: ; ' I  : ; I 4: ; I .: ; ' @: ; I4: ; I4: ; I4: ; I4: ; I 1UX Y 1 U41.: ; ' I@: ; I&I.: ;' I@: ;I: ;I4: ;I4: ;I4: ;I : ;!.? : ;' I@": ;I #: ;I $I%!I/ &$ > '4: ; I(4: ; I? < % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I : ; I4: ; I4: ; I4: ; I  U% $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ >  : ; I : ;  : ; I8 .? : ; ' I@ : ; I  I%  : ;  : ; I8  I$ > .? : ; ' I@4: ; I % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ > : ; I : ;  : ; I8 .? : ; ' I@: ; I  I &I &I 4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8 I !I $ >  : ;  (  I : ;  : ; I8 .? : ;' I : ;I&.: ; ' I : ; I.1@1 .? : ;' I@: ;I : ;I 1X Y1&I: ;I4: ;I4: ;I 1UX Y!.: ; ' I@": ; I#4: ;I $4: ;I%!I/ &.? : ; ' I@': ; I (4: ; I)4: ; I*1UX Y +4: ; I, : ; -4: ; I .4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I '  : ; : ;I8  : ;I8 &I.: ; ' I : ; I: ; I4: ; I4: ; I.: ; '   .: ;' I@: ;I4: ;I4: ;I : ;I .: ;' @ : ;I!.: ; ' I@": ; I#: ; I$4: ; I %4: ; I &4: ; I'4: ; I( : ;) : ;* U+4: ;I,4: ;I- U.1UX Y/10 1412 34: ;I 44: ;I51UX Y641741 8I9!I/ :$ > ;!I<.? : ;' I@=: ;I >?4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > $ > .? : ; ' : ; I.1@1 .? : ; ' @ : ; I 1UX Y 1 .? : ; ' I@4: ; I.? : ; ' I@4: ; I % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I@ : ; I 4: ; I 4: ; II!I/ .? : ; ' @: ; I : ; I .? : ; ' I@% $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I  : ;  : ; I8  I  : ;  .: ; ' I  : ; I 4: ; I 1: ; I4: ; I41.: ; ' .? : ; ' I@: ; I: ; I1UX Y  U41.1@1.? : ;' I@: ;I4: ;I4: ;I1UX Y 1X Y!1X Y".? : ; ' @#: ; I $.: ; ' @%4: ; I &4: ; I' (4: ;I)4: ;I*4: ;I +1X Y ,1UX Y-.? : ;' I@% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h\@M#~K/giLNXtgfuw~K= Q<0ML A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@"gi~fhg[Lt=u. J==u=  g~uu9<ׄZ> K/r.M$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h @>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJc4 ../includesort.cstddef.h@ 8j*@ڻ+@8/Yy. Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.h@@)Xg[ye_?  strpbrk.c@&,K?z4< rindex.c@*xG=v,02K ../../includestrcasecmp.cstddef.hbsdtypes.h@3=L=]d$Z3zi=e"[91eu;K8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V 9 strcat.c@"?; index.c@*G ../../includestrspn.cstddef.hbsdtypes.h@$ v. v< <me=;Mw0,>:>G?G t)?,>x d9 ../../includestrstr.cstddef.h@)N /ug#vH>)zi \ strtok.cP@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h0@(JgKwp@8 ../../includebcopy.cstddef.hp@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h0&@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h(@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=lsC ../../include/arch/i386msleep.cstdint.h,@*<xK-!ĠK-Ksg&zX3 pv.cP-@=xi=eN ../../../include/arch/i386get_tick_count.cstdint.h-@ >{ ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h-@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf  ../../../include/arch/i386../../../include../../include/sys../../include/netinet../../includenet.cstdint.hstddef.htypes.hsocket.hin.hnetdb.hio_struct.hstdio.herrno.h3@(<>ʯʯA7yy5ZV>1b v< .SA7k~Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.hp?@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~U[ ../../include../../../includegetopt_long.cgetopt.hstddef.hI@my.DW=f<-=wJV>qt?7Chw,Z$]8XsWZg%8g]f䰪&L:,qL:,zP ../../../includemisc.cstddef.htypes.herrno.hR@&"V0",0#U/#U/g  ../../../include/arch/i386../../../include../../include/sys../../includeselect.cstdint.hstddef.htypes.htypes.htime.hselect.hio_struct.hstdio.hS@8x[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]D ../../include/systime.ctypes.htime.hX@!<=gwW9 ../../includelocale.clocale.h0X@ qX.]9 ../../../includeuser.ctypes.h@X@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.hX@i+>i u>>j b~f~MvoAf<t..k=*/-/kgixplUtx8@OO=s091+x p hC ../../../include/arch/i386rpc.cstdint.ha@!X@Kxx< [3 sleep.c b@=xM ../../includelost_path.ccollections.hstddef.h0b@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hj@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.cpk@=gP ../../../include/arch/i386add_intr_handler.cstdint.hk@ = ../../../include../../../include/arch/i386../../includescanf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hk@$Tj=jr~JD<X~o~t~fJ~t }Y .%S\=;u=YtgfA\fA\&zX\>:v>YzfA\iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h@@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hp@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io ../../../include/arch/i386../../../include../../include/sys../../includetime.cstdint.hstddef.htypes.htypes.htime.hio_struct.hstdio.h@Bz< \T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.hP@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h0@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h0@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h0@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.hP@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'\ ../../include/arch/i386../includenetwork.cstdint.hnetwork.h@-==t{o>i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h@?Dx ?Dx =3 puts.c @>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h0@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c @XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.h@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwl ../../include/arch/i386../../includetree.cstdint.hstddef.hcollections.h@@f<f<1+?ffp<=;=:XF<:tzf<o<F<:t[xfJ_tw+1K X@-=-=ntmf@-K-=|.<|.< |.sX-/o/f X|.<|.< |.sX-/u/f|X>gt=ug=>CuZJ*@of>@,L;/KN;>Xuu.g @-=-=nto [>f@,L;/KM<q.= L;/KN<.>X!~. X@-=-=n!\@-=-=@-=-=..@,L;/KN;>X-umt>d@,L;/KMh<.=aL;/KN<.>XX X@-=-=n!\@-=-=,@,L;/KN;>X-u@,L;/KM==Xuu~. X@-=-=n!\@-=-=} }<hjK0u1?+YZnu[g-=}. X@-gn}@-gJu~K=w~:ֻH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x  ../../../include/arch/i386../../../include../../includeaccess.cstdint.hstddef.htypes.hio_struct.hstdio.hdirent.herrno.hP@%t? JvN73x<  ../../../include/arch/i386../../../include../../include/sys../../includeposix_dir.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hio.h@gsgrgcg;?+g,02zt4Zd/Yvcgust>T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4\@AB E| h@AB E|  @AB  @AB FI @AE E0@?AB Fp@VAB F@3AB D| d@AB F| @KAB DD| @@QAB B| @>AB B| 4@)AB D| d@~AB Fd@tAB F| @AB F| @<AB AD|  @.AB | L @>AB A| |`@-AB A| @JAB FI| @AD |  @AD F| @@AB II| tP@AB BDt@"AB | 0@9AB A| p@AB F| $@AB F| X@9AB X @AG FX@hAB BX @AB X0@ AB X@@AB FX` @ AB X @ AB X @oAB FX#@#AB X@#@!AB |  p#@vAB FIF$@AB  %@AB AFF%@>AB |  0&@dAB F &@oAB F '@AB E| (@:AB DP(@1AB (@1AB (@0AB )@AB  )@IAB Fp*@AB A*@AB ON +@YAB X+@YAB X +@AB IFF| ,@AB ,@JAB AC,@jAB AF| P P-@ AB P `-@AB |  -@ AB |  -@&AB  -@'AB  -@AB F p.@gAB AG .@AB  /@AB MF /@_AB L 0@GAB FF @1@AB L 1@AB  2@AB F 3@AB F| 4 3@&AB 4 4@ AB 4 4@&AB 4 P4@ AB 4 `4@AD 4 4@ZAB F4 4@qAB F4 `5@9AB 4 5@AB 4 5@AB F 4 7@AB IFF4 `8@?AB D4 8@vAB |  9@OAD  p9@dAB |  9@ AB |  9@IAB D @:@IAB D :@IAB D :@AB E ;@_AB D @<@%AB  p<@%AB  <@aAB   =@AB MFF =@WAB D P>@qAB D >@AB  >@"AB  ?@IAG | p?@AG ?@AG ?@yAB C0@@ AB C@A@AB FB@KAB PB@RAB AFB@AB O`C@AB OD@tAB LFD@IAB D@AB LpE@ AB E@AB E0G@"AB | l`G@;AB D| I@AB I@ AB | I@AB CJ@AB AG0M@YAB FR@'AB AR@'AB A| R@ AG S@AD S@AG 0S@AG PS@$AB | S@AB F| L U@AD L0U@AD L@U@ AG LPU@ AG L`U@ AG LpU@AB  LU@AB FHEL`V@EAB DLV@AB FI LpW@AB IFF| tX@AB | 0X@ AG | @X@AD PX@AD `X@AD pX@AD | @X@AB C@Y@#AB @Y@AB E@PZ@AB F@ [@&AB | P[@AG | p[@0AB | <[@ AB <[@ AB <[@ AB <[@ AB <[@AB E<\@[AB A<\@iAB F<P^@AB D < _@AB LFF<_@IAB F< a@AB D| a@AD a@DAB E|  b@ AB | 0b@7AB Cpd@AB F e@AB Fh@AB F| j@ AB k@AB  k@!AB DPk@ AB `k@ AB | $pk@AB | Pk@AB | |k@'AG D|k@ AB |k@ AB |l@+AB A|0l@AB F|t@;AG | u@#AB |Pu@AB |pu@!AB |u@;AG |u@!AB |v@AB |0v@#AB D| `v@;AB v@!AB v@JAB IF w@"AB | XPw@iAB FFXw@AB FIXx@!AB | x@$AB x@AB y@ AB y@NAB D`y@AB BFy@NAB D@z@\AB Dz@kAB D{@jAB H| }@AD }@AB }@AB }@ AB }@AB D~@+AB ~@-AB  @.AB P@AB FKP@xAB DЀ@aAB D@@AB FFЁ@AB D`@zAB D@#AB  @fAB IFF@RAB FF@EAB D0@UAB FF@UAB F@RAB DP@AB II @6AB C`@AB @AB IP@AB F| @@bAB E@AB Ў@GAB  @HAB B|  Hp@dAB FLGH@AB FH@'AB HА@AB FHp@EAB AH@0AB FH@uAB C| 4 p@ AB 4 @ AB 4 @RAB I4 @ AB |  @AB F @'AB  Ч@AB  @AB  @ AG  @ AG  0@AD  @@AB AG @AB E| !@6AB !Ь@AB !@@AB FF!0@AB | 0"P@ AB D0"p@OAB G0"@!AB | "@?AB |  "0@dAB FGG"@[AB H"@(AB | 0#0@AB 0#P@0AB 0#@ AB 0#@0AB 0#@ AB 0#Я@`AB FF| #0@AB | $P@QAB A$@*AB $@mAB F$P@mAB BC$@rAB FI$@@7AB D$@DAB F$д@AB D$@AB PF$@@+AB | @%p@fAB D| p%@rAB Ep%`@AB Dp%@uAB Dp%p@IAB | %@AB %@AB %@AB | P& @AB | |&@@AAB LF|&@AB |&@AB |&й@AB |&@AB | '@ AB ' @ AB | T'0@lAB CT'@VAB CT'@jAB FT'p@`AB FT'н@HAB L| ( @AD (0@AD (@@/AB (p@AB (@AB (@AB (о@.AG (@/AB (0@AB (P@AB (p@4AB (@AD (п@AB (@AB | l)@AB F| )@AG )@!AB )@@yAB HF)@AB  )@AB FFF)@lAB FF)@)AB D)0@AB MF)@OAB D)@!AB | *@@AB F*@@QAB AC*@RAB G*@RAB G*`@ AB *p@BAB D*@3AB D*@AB AG*@AB F*p@AB F|  ,@AD F| @,P@]AB D| p,@"AB p,@#AB p,@AB p,0@AB IHp,@AB p,@ AB | -@dAB F-`@+AB JI| p-@'AB E| -@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdout/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstructword_type../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4__divdi3DWunioncomplex long doubleUDItypecomplex floatGNU C 4.2.2complex double__moddi3/home/tyndur/tyndur/src/lib/stdlibcerrno.cusagediffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockpagesl_pageCountmajSizefirstsort.c/home/tyndur/tyndur/src/libqsortbase_tmpcomparatorstrncmp.c/home/tyndur/tyndur/src/lib/stringstrncmpstrncpy.cstrncpystrpbrk.cstrpbrkscanpstrrchr.csavestrrchrstrcasecmpstrncasecmpu_charstrcasecmp.cmemmovememmove.cdst0src0donestrcat.cstrcatappendstrchrstrchr.cstrcmp.cstrcmpstrcpystrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrspn.cu_longcharsetstrspnstrstr.cfindstrstrstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrmemcpy.cmemset.cu_intendptrpositivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeouttimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_lenmsleep.cuint64_tmsecmsleepdo_nothing/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cget_tick_count.cget_tick_countgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexntohlnet.cntohsp_aliasesgetprotobynameip_strs_protoh_addrtypehtonlNO_RECOVERYinet_ntophostenthtonss_nameservicesprotocolnetshortproto_aliases_tcpNO_DATAserventTRY_AGAINhostshortinet_ntoahostlongservice_aliases_imaph_aliasesp_protosocklen_ts_addrnetlongservice_aliases_ircgethostbynamep_nameinet_ptonin_addr_tprotocolsh_nameh_errnoip_qstderrherrorAF_INETinet_atonHOST_NOT_FOUND/home/tyndur/tyndur/src/modules/lib/posixprotoentservice_aliases_https_aliaseshstrerrorh_addr_lists_portgetservbynamegid_tpasswdpw_namepwd.cpw_gecosuid_tpw_uidpw_gidpwdentpw_dirgetpwnampw_shellgetpwuidunlinkunlink.cSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementfdopenlseekoff_tpreadmode_tfd_list_elementF_GETFDnewfdfile_flagsorigin__builtin_va_listold_posio_resposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdoptindoptargoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptgetpidgetpid.cgetppidilloptcharoption `%s%.*s' doesn't allow an argumentilloptstringrecargcharcyclelenncycleillegal option -- %cswapunrecognized option `%s%s'cstartpanonopt_startgetopt_longgetopt_internaloption `%s%.*s' is ambiguousgetopt_long_onlyoptionhas_argcurrent_argv_lenshort_tooambighas_equalcurrent_dashparse_long_optionspanonopt_endcurrent_argvexact_matchnnonoptspermute_argsoption `%s%s' requires an argumentrecargstringgetopt_long.cgnuoptcharinvalid option -- %cposixly_correctsecond_partial_matchdash_prefixoption requires an argument -- %cnoargmisc.cgetpagesizeisattygethostnamepipeforktv_secselect.cselecttime_torig_rdbitswritefdstimeout_tickreadfdserrfdsnumber_fdsorig_wrtimevaltv_usecsuseconds_tfd_setumaskmkfifostat_bufblksize_tst_ctimest_nlinkfchmodinode_numnlink_tlost_statmknodst_blksizest_gidino_tst_atimedev_tst_inofstatstat.cst_mtimestatuslstatst_blocksst_devst_uidst_rdevblkcnt_tmkdirst_modegettimeofdaymon_groupingp_cs_precedesp_sign_posnlocaleconvint_curr_symbolmon_thousands_seppositive_signcurrency_symbolmon_decimal_pointn_sep_by_spacenegative_signint_frac_digitslconvlocale.cp_sep_by_spacen_sign_posnn_cs_precedesuser.cgeteuidgetuidgetegidgetgidrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidactimeutimbufmodtimeutimeutime.cerror_messageerror_codestrerror.cacceptget_socketout_pathlocal_addresstree_tout_ip_stringconnrecvfromSOCK_STREAMrecvuint16_ttree_item_offsetsocket.clisten_filegetsocknamebindsin_addrto_lenlistentinfosin_familysendsin_portsa_familylostio_internal_filefree_buffersort_key_offsetbacklogcreate_socketconnectinet_addrsendtosockaddrfrom_lenlocal_address_lensa_family_tkey_maskSOCK_DGRAMsockaddr_inclientsocksocketsclientsocketdomainsa_dataSOCK_RAWrootsend_messagemetadatayieldtextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlerfscanf_getcvscanfsscanf_tellinput_errorjtellinputjscanfmatchedfirst_digitconvert_numbervfscanffscanf_ungetcassign_number/home/tyndur/tyndur/src/modules/lib/stdlibcassignnegationmatching_errorjgetcsscanf_getcscanf.cparse_percentjscanf_getcjungetcjscanf_read_numbertptrscansetvsscanfsscanf_ungetcsscanf_statejscanf_telljscanf_ungetcfscanf_tellfscanf_statevfprintfjprintf_argsretvalputsn_fctfprintf.cfprintf_handlerfprintf_argsfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcasprintf.cbytes_writtenasprintf_putcasnprintf_handlervasprintfasprintf_argsbuflenputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetssetlinebufclearerrfputcio_write_request_tblockcountfputssetbuffopenfflushnewpathfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valueldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexrnd_seedsrandomsrandrand.caFebaFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_handlervsprintfexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_putcsnprintf.cdirectory_closeio_direntry_type_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_tcur_bytemac_to_stringip_to_stringregister_netcarddevice_numbernet_devicenetwork.cip_bytesstring_to_ipdriveropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicalmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.cisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigitoverflowstrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertold_parentget_keyadjust_balancetree.crotate_leftdo_searchtreenew_keyold_lefttree_destroytree_insertpitemrotate_rightrebalancetree_searchtree_removepsubstto_tree_itemtree_prevtree_nextlink_from_parentcurrent_keyto_nodetree_do_createtree_do_initstopstrcspnstrcspn.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink__udivdi3__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuut""t7Vt7HVWHLtWLtVWt>tdtd,OPRPRPRJiQmwQQQ$Q3[V/WWRetpemRmtpRtptpXytlytLtlRtlHtlHtLyWWWyVVuthth`thuyPPPyRYRyV[Vuut((tt" tt"t=:tJt(fRQRQRQ&ORQ.\VW&OVWtpN&t@Ot@T&tLOwtLwt`tdotdZpt\pR!t\!&ROt\W_tH!ROtHPVnP&PPPtDtDOtDtDPPOUPPRRPPttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0Pttukku,,/R/u ,,uk ku 1FWFkSkqWqSWttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt>u  -P1:P  /V/1u 1<V<>u .S1;Stt)u)Q 'S &Ptt~uRuR\\~uRu R\\~u XSX\u\~SYV\mV2W2BupBZWZ\up\~Wttuuu VVWupWupWupttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuunSnu nSUiPttu#S#)W)-u-VSV~W~S P -up-3P36u 6up&V-VAcP~P-ulAulttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVttuttZu))Zu%<SVAZSV`atactcu`uSVSVtt utt!utt u Ptt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt&u&R01t13t3=u0<<<P@AtACtCfu@^^fRpqtqsts}up|||PttuRttuWuWuVVttqu33VuV``qu^W^`u `oWoqu ]V`nVttuuttuttu//uhu`hu`hupupWFWWhVjlPtt~u  ~u**Du Dff~u   MWMQuQ~W  JVJQuQ~VGSf~SttuStt6uPu P 6uttOu  OuPQtQStSuPooutt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttu !t!#t#)uttuPuX#R#u`WQW[SQ44WuWrudrS.7uh79V9uhrQRtt`uP`u\R`uXQLWLbVbWVWVWWVVWV`VKKgugu`LLbu bu u vvu u `LLuvuvu`u%uh`uh6S/SvSS=ul`ulDup`up`atactcu`zPzul`zRzuh`zQzud`xuxuuRuRu`u 00?u ?`uu$u$11u MuRu>]PPPPPxSSSCfS{SS,.PS!RMRRRttutt utt uttu !t!(t(4u@AtAHtHTu`atactcuttuu 33u VuoSou;@PP+V.}VV,W.~WWSSS*S.|SSttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttutt uttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttutt0utt uttu !t!#t#)u01t13t39u@AtACtCu@qqu@UUVuV}SStt;uPS ;S@AtACtCu@yyu@W`yWWWqsPBVPBKPttzuQuQiizu?uxizuxtt!u u !Wu !WVu!V01t13t3yu0lldudy0JJS*u *SSSdu dyS(W*<WWdW*upWdupttuuPu Pu PttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt'u'Q01t13t3;u@AtACtCKuPQtQStS{uPbbwQw{QPbbqSqwu wySy{u tt% uPuPSuPSuPPBuPB_S_uPSuP>S>uPSPSPSuuPuS*uP*NSNuP S uPSuPSeuPeSuPSuPSuP0S02uP2>S>buPbSuPSuPS% uPRuVGuGVuuVu?u?VuVeueV u VCuCSVSbubVu% VQ% uuuu>>CuCSSbub% VVu u  u % uyyuuVVuuuu*u*PPu++u u RReueu>>bubuu% uWWV(W*LWLW V RWReVeWVV>W>CVCSWSbVb% WPRP_cSnpPPSRSPDSDQPQpS*RPqPt|PSSCSPSP  SPRPRuSuaSatutSu S RuReSe% uW(W W]eWWQ)QQ9RQQ>CQSXQZbQPPPPPPPReP>~SSSS S&SNSCJS0 1 t1 8 t8 k up q tq s ts u t t u t t u t t + u0 1 t1 3 t3 Q u` a ta c tc | u` j j | Rl | Q t t u  S u Ptt;u@AtACtCaupqtqstsupupVu VputtuPttiu  5S5>u>iS  :V:>u >iVpqtqsts+upVu+Vp+u p+uS+S01t13t3Qutt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt uttu !t!#t#ruceQttuttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttru""rQ$:S=rSttuttuttuttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#Auttu%%uu u\uXulVulVulVhQSQSQSttQu P Q#S#6Q6HSHQQR4V46R6QVP%?PJQP`atactcu`qqPuPu`qqwRwu Ru twQwRPRPRPRttuPu P uRu Ru QRPRP R  P R !t!#t#)u01t13t3ruttuttuPulRSW<S<kWkRSWSRWSR W *S*WVV>QQ<>S>Q~QQQQPBSP\P~PPPQiQ$&S&~QQQQQPiP3;PHjPw~PPRR&QRR=R!kQQiQQQikRkQQPiPPxPPPRikR<RhkRQiQQQQQ*,S,QPiPP9APNpP}Ptt+u+u+u uhVQVQuhVQ+uh"V",P,]V]rPrVV(V2SQAhSQSQPPPP01t13t3A u0KKA u0KKA u ? V* < V[ V V A VaP S* ; S? C S[ r P S S P  S  P[ ul ul  ul[ up up  up W  R  V / R/ = W? R VR [ R W W  W  P - P? H PT [ PttuunSnu nSUiPtt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_PFFu|NP(NP(*3*@&(&(*@&(*@*A$p\\,8KT`~)03X_r02 (:(:@O/25;/hp8X8L!T!T$0U$9;57HO`d"*8 *8"8^8EZ^VXHNQmIoqs9?dfBb(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3>% Xto*v|u(Sb>CSb>C % bexXetoXeto3 L u*vCSxjX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp%WZa%WZa%+.8loqtu<i<iik$ik$7?57?5BZ  * @ ` * @ ` 0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'<@<-`@`Ɇ 5,_@,_?`@`F`@`M`@`R `@ `p+ X@ ] f u+r1}__Ne-0<+$!XpE 4@@<@`@,_@`@`@`@ `@ @     `@`@(,_@;`@H@^@ m$`@ t@@ `@ `@_@`@@P@! @4@@x`@0*`@F7@GQ@ _@ {@(`@ @ @ ,`@ ȋ@ ċ@ 0`@ Ћ@ ̋@ `#@$@D*݋@ 6܋@ G)@"eԋ@ mw@ @ <`@ 4`@ 8`@ @ @ ,@d-@F\0@p1@-L2@:3@qT^\:@o@ {t:@h;@1;@';@e4?@L?@L?@(@@D$F@JpF@K@-,L@HNS@I[T@gfpT@yU@(V@(Po@0u@v@@ @ȁ@j@@0ĕ@n%4@ 7 @0C@0OZ$@ob@ o@`@  ry@78@A@в@@d@B@@! @ l@,98@rJ@YWb$@ s(@ @L@@ @@`@@~h@h@ t@@8<@' @;5<H@=F@cU@fb\@ hP@ x @@nX@ @L@c4@T@t@l@@-\@I@b@:u@@@ D@ H@  @|@_@( @@@  T@  L@   8%@% l&@1 t'@0B '@LU '@`e P(@7v (@H (@" )@P D*@i +@m @ ,@H h,@S @ ,@ `.@p .@3# /@w@ |0@S 2@^a t2@^k 2@o} D3@ 4@ 4@Q 5@s |6@ l@ p8@ ,9@g  ;@$ @  @  @ , @ = ܹ@ Z Ĺ@ _ x<@Im @  w <@ @ H@ @ ?@d @ L@ |A@k C@  `F@ |F@{, F@`7 @<@A @ O `@ [ @ h @` o @ v @ tT@K @    >@@  d_@ _@ @  @  @ " @ 4 @@0 D @ X g@g dh@z p@ @  (j@ P@@ (p@B lp@ p@ @ s@ t@D u@b`@@w@ @t@M@O@ 8@X@@@@ !H@N-@n;@IMN@[c@q@ ~@H P@@@P@Q@@ @  @@ P@ X@ T@  @0 )@4@yB\@7J`@  V`j @3ss}@ @ @ @ @ @ @  @@   *4AKT]fox@ @ @ @ '@'@29 )@IB@ Yb,@mr@ p.@gXR@@ @@ @ @ @ @ @  @ (@ +0@ @8@ TZ @ ajs@  {@@ >@<@a`@ D@  @ @ B@KPB@RH@ I@"J@5T@ ;0M@YKL@ VP@ cX@ ovU@@ `@0 @ PZ@ @@  `@ \@[ &.:0b@7L]ok@'k@ k@ l@+0l@0v@#v@@  P@@ @ %@ -4@ @Jp@EU\@ e]@`p@$ s]@]@\@  !@@y2@ <@ G@ QX@@Qg@q{ss@0y@N@Fx3@4@y*@`@-@ P@Q-@(@0) b@ /@=@-N2@^X@f`@n\@w@ p@` u@#P@"@!p*@@8 T@ ,@~`X@Ь@@ p@O@ P[@'@/*@>@3H@U4@&b[@ g_@Io|5@v{0@U@O@@p<@%@Ep[@0ܸ@E@Nt@6PX@`5@9 +@YD@(@0d@9R@'E@3T@(]@Xch@tP@`@ ?@@7@PU@ @hk@p@Ip@fN@.@@@E0U@@l"@ @@&pX@.p@6~@+A`y@F@R`@+a@=rpd@@V@G@0&@dA@$4@Zu@;R@ I@ @@ e@@=pu@!$P@*l@}<y@ Al.@S @ fp@mй@v#@}@@ @2&@o@"x@$@g0G@"@ [@&z@ke@?@!(@::ĸ@ UP@]@1ih@\sH<@.п@@X@@#н@HЀ@ap@B$@-0@?}@ @@DS@@j@`,@j#@ %@?-@[7@ ?a@C[@ LH@4a@y@T@ @#@! `@  @ @ p@4@r@M,@@@  a@S@0@p"@ ̈@ @u @@/ @- @y< `@M ,@b P@xi |,@<w @ $@ 0@ @ lA@ @1@ @W @_ D@t 9@I \@!@~!@'![@ #!~@--!8@=:!@@!@ T!0@`!|@@m!@v! U@|!P@ !-@ !e@!@/!@5!;@_!h`@r!L@!@ ! "@ "<@|"@"0S@"\}@&$"@9,"@A"@ U">@a"\@ih"(@~~"8@"@U"@"(U@!">@c"<@)"@R"@)" @"{@j#,@#@A@;!##@ )#@30#@H9#,!@AA#@*S#@j#@t#X@7# @ # @D#0@#@)#D@I#d@?#@U# @#`V@E#Ļ@#v@!# ?@I#@$x@$ @ $@-$P@0>$@<E$k@V$ _@[$8@e$l@m$)@$ 4@&$$8@I$@6$@U@ $ $>@$0@G$@$X@$8@$@5%`@%`@z%@##%T@ 8%0@lE%@sS%4@^%5@h%D@ o%0@9v%\@%@'%|_@`%@ %Y@#%@>%@%a@D%3@%`U@ %@%<@&0@ &@@ &pW@&}@&@%&}@*2&T@2?&P-@ I& @X M&|~@X&@@Zb&@Rg&@p&@)~&=@W&D@&+@&P@&-@&0@ &0@&p~@ &@&@K&}@'@ '@@Q'9@ '/@_#'@L3'T@BK'@a'@tl'3@&r'[@ y'-@''@'<@'!@ '@z@\'p@V' f@'pk@'@ '(@1(+@(@@70(0@d>(@M(@2^(E@f(@"m(@<@%x($@4(P^@(̶@1(pE@ (XE@q(S@(u@!(@r(@(@(@o ("@ (8@ )=@)@S)@U )@J')5@1)<@C)@!O)@0\) @oe)X@r)%@>)@_) @6)@)`G@;)f@)@@)Ч@)@)@)@G)x@ *XG@ *L&@*@I@#*Ё@)*`@8*p@ >*"@ U* @ g*@@+}*Ď@ *}@*@@*@4*-@&*x@*P4@ *`8@?*I@*@*@*@ +t@E +@H"+@R,+@4+@fB+@ O+@]+@?m+X@|+@+о@.+@J@+ @+}@ +]@+@@A+y@N+R@'+@9+8@v+ @>,@ ,4@,@@', 9@O0,p?@4,T@ C, k@!R, @`,/@g,<@o,5@},@U,p9@d,@,f@!,P@m,@ ,4@q,@R,PS@$,@,@!-x@! -@f-@m0-"@ D-` @ K-Ў@GR-@Z-P@i-#@ r-@-+@Y-@-Pu@-@ -Lg@n-@ -@-\@-@u-:@I.@%.Pw@i#.@ 3.p#@vH.}@ Z.@E`.t@k.@@U.@.@.@b.#@ .p@d.@.`C@.@'.`4@.(@.`@.@@.0X@  /@j/Y@&/@R0/@9/V@>/@F/$@pQ/@0p/@fw/P@]~/@/Я@`/@/Pk@ /@/#@/T@/4@ /`@/@/t@;/@!0@#0P@0H@$0S@,30P(@1I0Ѝ@\09@Ig0\@cq00 @z0F@0@ 0 @H00@0H@50(@0@f@_0@:@I0 @.07@1@1@!1D@M11#@#610@>1v@JL1@E[1 ~@dj1 w@"w11@1h@1@A@1@1|@1`-@1@@b1|#@1%@1'@1@1@2и@ 2@&2E@+2@A<2@O2@W2e@g2^@v2@ 2@D2@.2"@ 2@d2@R2@<2@ 2)@&2@3 3@ %3w@/3H@;3@G30@@ M3T@8Z3x@e3@{3|@3 &@3@@!3pU@3,@J3 3`@3B@3LU@3?@y4@4j@ !4|@C-4>@"E4@M4`v@;V4`k@ b4@cl4@>t4,<@p4P>@q4д@4 @,4 @4@@4:@4[@4А@4@,4p@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startcmpt.cmonth_to_days.2995strptime_internalmonth_nameab_month_nameweekday_nameab_weekday_nameconnect.ctransport_maptransport_map_modified_tickpoll_internallast_fd.3319last_info.3318last_tick.3320last_fd.3291last_info.3290last_tick.3292last_fd.3264last_info.3263last_tick.3265sockaddr_sizesockaddr_set_datacalled.2952should_bind.2953connect_with_timeout_callbackip.2954convert.cdownloaded_files_hashv1.3196v2.3197v4.3199v3.3198dl_file_url_mapconverted_filesdissociate_urls_from_filedissociate_urls_from_file_mapperwrite_backup_filelocal_quote_stringreplace_attrreplace_attr_refresh_hackcookies.ccookie_expired_pcookies_nownumeric_address_pcount_chargoodness_comparatordelete_cookiecookie_newequality_comparatorfind_matching_cookiestore_cookiepath_matchescookie_matches_urlparse_set_cookieknown_toplevel_domains.2826ftp.cfreefileinfodelelementftp_expected_bytesprint_lengthgetftpftp_loop_internalftp_get_listingftp_retrieve_globdepth.3643ftp_retrieve_dirsftp-basic.cftp_requestskey_head.3069ftp-ls.cmonths.3386clean_lineftp_parse_unix_lsmonths.3054months.3274ftp-opie.cextractenglish.2710Wphash.chash_stringhash_string_nocasecmp_pointerstring_cmp_nocasecmp_stringprime_sizeprimes.2537host.caddress_list_deletehost_name_addresses_mapaddress_list_from_ipv4_addresseshtml-parse.cconvert_and_copyname_allowedhtml-url.cinteresting_tagsinteresting_attributescollect_tags_mapperknown_tagsadditional_attributestag_url_attributesfind_attrappend_urltag_handle_metatag_handle_linktag_handle_formtag_handle_basetag_find_urlshttp.cdump_hashrelease_headerrequest_freepconnwget_cookie_jartime_formats.4654invalidate_persistentpconn_activeprint_response_linerequest_sendresp_header_locateresp_header_getresp_header_copyrequest_set_headerrequest_set_user_headerbasic_authentication_encoderesponse_head_terminatorresp_header_strdupdigest_authentication_encodenonce.4716opaque.4715realm.4714options.4720skip_short_bodygethttphfmt.4043chunk.3436basic_authed_hostscookies_loaded_pinit.csimple_atofcmd_booleancmd_spec_verbosecmd_spec_recursivecmd_spec_mirrorcmd_spec_htmlifycmd_spec_dirstructcmd_timecmd_spec_timeoutcmd_numbercmd_spec_prefer_familychoices.3664cmd_number_infcommand_by_namecommandsparse_linecmd_spec_useragentcmd_stringcmd_spec_restrict_file_namesparse_bytes_helpercmd_bytes_sumcmd_bytescmd_spec_progresscmd_spec_headercmd_directory_vectorcmd_vectorsetval_internalrun_wgetrcenable_tilde_expansioncmd_filecmd_directorylog.cget_log_fpinhibit_logginglogfpsave_context_predirect_requestredirect_request_signal_nameringfree_log_linelog_linesescnonprint_internalringpos.2882log_line_currenttrailing_linecheck_redirect_outputneeds_flushingflush_log_psaved_appendlog_vprintf_internalmain.cprint_usageprint_versionprint_helphelp.3131short_optionsoption_datalong_optionsoptmapp.3069buffer.3068redirect_output_signalbuf.3144gen-md5.cgnu-md5.cfillbufnetrc.cshift_leftmaybe_add_to_listprocessed_netrc.2494progress.coutput_redirectedcurrent_implreceived_sigwinchimplementationscurrent_impl_lockedbar_set_paramseta_to_human_shortlast.3233buf.3232create_imageshort_units.3115display_imagebar_finishbar_updatescreen_widthbar_createdot_set_paramsprint_row_statsnames.2868dot_finishdot_updatedot_createptimer.crecur.curl_dequeuedownload_child_purl_enqueueres.cfree_specsregistered_specsadd_pathretr.cgetproxyrewritten_storage.3607first_retrieval.3543rate_names.3399res.3398line_terminatordlbuf.3292limit_datasafe-ctype.csnprintf.cspider.cnonexisting_urls_seturl.curl_unescapesupported_schemesinit_sepsseps.3109unescape_single_chargetchar_from_escaped_stringurlchr_tableparse_errorsfull_path_lengthfull_path_writeurl_escape_1url_escape_allow_passthroughsync_pathappend_charappend_stringappend_uri_pathelfilechr_tableutils.cdir_matches_pringpos.3665ring.3664tbl.3728base64_char_to_value.3778powers.3514buf.3515buf.3891mergesort_internalrnd_seededinitialized.3473cached_sep.3471cached_grouping.3472outbuf.3488in_acclistunique_name_1fmttimeoutput.2903version.cxmalloc.cmemfatallibgcc2.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountsort.cstrncmp.cstrncpy.cstrpbrk.cstrrchr.cstrcasecmp.cmemmove.cstrcat.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrspn.cstrstr.cstrtok.clast.930memchr.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idmsleep.cdo_nothingpv.cget_tick_count.cenvvars.cenvvar_listgetenvvarnet.cerrors.1392protocolsservicesh_addr_list.1450ip.1449aliases.1448hostent.1447buf.1416proto_aliases_tcpservice_aliases_httpservice_aliases_imapservice_aliases_ircpwd.cpwdentunlink.csignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetopt.cplace.1334getpid.cgetopt_long.cpermute_argsparse_long_optionsplacegetopt_internalnonopt_endnonopt_startdash_prefixmisc.cselect.cstat.clost_statinode_numtime.clocale.clconv.782user.cwait.cwait_listrpc_child_exitutime.cstrerror.cerror_message.1085socket.csocketscreate_socketrpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cscanf.csscanf_getcsscanf_tellfscanf_tellsscanf_ungetcjscanffscanf_getcfscanf_ungetcfprintf.casprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexrand.crnd_seedmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.cdirectory.cseek.cnetwork.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodetree.cadjust_balancerebalancestrcspn.caccess.cposix_dir.clost_link.cparse_pos_paramsputcharftp_process_typeconvert_all_linkssubdir_pdownloaded_filestrcpyasctimeinit_dev_listunsetenvrpc_send_responseyieldretrieve_treehash_table_clearrpc_get_envvarswaitpidtmpfile__divdi3version_stringppb_from_argvvscanfstrtok_rlist_sizerpc_get_responsenumber_to_stringgen_md5_inithash_table_containsgetgidprintfstdoutvsprintfrandomutimelibrpc_rpc_handlerrpc_get_stringurl_errorfd_read_hunkftp_responserecvconnectrun_commandungetclist_pushaddress_list_address_atsigemptysetaddress_list_set_faultystrerroris_valid_ipv6_addressdebug_logprintfmemrchrgeteuidinet_ptonrpc_get_intfile_mergememmoveftp_systgetopt_longtree_do_createsnprintftouchio_split_dirname__strtok_rtree_destroylog_initaprintfmatch_tailmknodatolget_parent_pidip_to_stringlio_seekcookie_handle_set_cookiegetenvchecking_strdupfchmodlist_poperrnostrtoldgetegidisblanksetlinebufgetstree_insertio_create_linkchecking_malloc0io_split_filenameppb_get_argc_sch_istabletimer_cancellogflushgetprotobynamevsscanfgetpagesizegetpidconcat_stringsqsortio_get_absolute_pathhash_table_iter_nextfscanffgetshas_html_suffix_pgetcregister_downloadv_and_wait_for_rpcmemcpymem_freeaccept_connectionsetvbufwait_for_rpcxstrdup_lowertimer_callbackseekdirperrorvec_appendcreatfd_transport_contextinit_waitpidputsprogress_schedule_redirectdup2rpc_send_string_responseaddress_list_set_connectedislowerurl_set_dirftp_indexlog_cleanuptolowergetuidrewinddirinit_execvfeoftree_do_initbind_localmallocremovelist_is_emptyfree_keys_and_valuesisattyres_cleanupres_parse_from_filesleepoptarg_assertvsnprintfstrtollrpcrecvfromfile_non_directory_paddress_list_get_boundsftp_pasvgen_md5_updatestrtoul__dso_handleitoaexec_nameispunctstring_to_ipfree_urlposmkalldirsopterrsocketselectreaddirfd_readftp_retrjvprintfisspaceprint_decimalhash_table_getregister_netcardregister_delete_filefflushregister_htmllist_get_element_atregister_intr_handlerdirectory_openftp_restcookie_jar_loadputenvurl_has_scheme__umoddi3lseeksigaddsetspider_cleanupstrncasecmp__udivdi3sendsetbufferretrieve_urlabortdownloaded_html_setprintf_putchash_pointergmtime_rchmodsprintf_putcget_tick_countprogress_interactive_pisxdigitprintwhatalarmsearch_netrcfile_exists_pread_file_freemessage_handlerrandom_floatstrtolpipeftp_loopstrnlencreate_shared_memorystring_set_containsescnonprintacceptfd_register_transportfd_closechecking_reallocrenamemd5_read_ctxlog_closelog_request_redirect_outputaccdirstrrchrinit_memory_managerstdio_initfork_to_backgroundlog_set_flushh_errnocallocnumdigitfd_peekinit_dev_registermake_string_hash_tableselect_fdis_robots_txt_urlstrtodfd_read_bodylist_insertlist_destroywritefree_vecfd_errstratoffstatsufmatchfprintfkillinit_service_registerretrieve_from_filectimerun_with_timeoutdirectory_createstrcatadd_intr_handlerbinduri_mergeftp_pwdinit_sync_messagesntohlhome_dirvprintfmkfifo__deregister_frame_infoescnonprint_urichdiropen_shared_memoryurl_freehost_cleanupchecking_free__dtor_end__fseeksave_cookiesgen_md5_context_sizeppb_is_validaccept_domainurl_escapesetoptvaloptindmemchrftp_portjprintf_putcfree_netrcstdinwaitstring_set_addfnmatch_nocasesend_messageinit_envvarsumaskextract_paramlog_set_save_contextmktime_startlstatferrorstrstrptimer_resethttp_cleanupsyscall_poptptimer_newread_filerandftp_listbase64_encodesignalreadconvert_cleanupprint_broken_linksregister_redirectionstrcollisupperptimer_destroyread_whole_linestrncmpfpurgefd_read_linestrncpyunlinksetenvnonexisting_urlnumber_to_static_stringmem_allocate_physicalstrcasecmphtonlsendtogetenv_indexskey_responsecookie_jar_savenetrc_listputsnreallocprogress_finishset_rpc_handlerdl_url_file_maprpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcscheme_disablecleanup_html_urllogputsstrtoksigfillseturl_full_pathlistenurl_set_filefdopenlogprintfforksscanfinit_executeisalphaclose_shared_memoryhttp_loopoutput_streamftp_parse_lssigactionfopen_exclfreadstrdupinet_atonhash_table_removelist_createis_directorystrtoullgettimeofdayinit_messagingurl_parsefopen__bss_startgetoptset_progress_implementationretr_ratelocaltimeres_retrieve_filememsetfnmatchscheme_default_portmaincleanup_sch_tolowerftell__dtor_start__srandtotal_downloaded_bytesftp_last_resplineinit_service_get_nameres_match_pathclearerrfclose__mon_ydaygetenv_name_by_indexgetcharntohsinet_ntoagetppiddetermine_screen_widthtimeopendirstable_sortaddress_list_containstree_nextisgraphrandom_numberintr_handlerunique_createhas_wildcards_pare_urls_equalftp_typeisalnum_sch_toupperisprintptimer_readmd5_process_bytesmem_dma_allocateputcgetopt_long_onlychecking_mallocherrorstrcmpulltoaprint_addressprintf_putsngetpwuiddupgen_md5_finishcreate_processsyscall_putsngetcwdftp_cwdgethostbynamesuffixgetpwnamsepstringprogress_handle_sigwinchcmdline_get_argcresponsesgetservbynamefgetcgethostnamehuman_readablesprintfasprintfwith_thousand_sepscmdline_copy_argvtotal_download_timestrtofatexitstrcspnhash_table_putoptresetmake_nocase_string_hash_tablerpc_get_dwordhash_table_get_pairscanfstderrprogress_createsrandomdatetime_strftp_sizemac_to_stringsigismemberbase64_decodeasprintf_putcdirectory_closelibrpc_c_rpc_handlerptimer_resolutionfputchttp_atotmhash_table_for_eachtimegmxsleepaddress_list_releaseoptoptdivmodcalc_ratepreadlocaltime_rhstrerrorconnect_to_host__ctor_start__strftimelocaleconvppb_copy_argvwait_child_addtree_prevtime_strstatisdigiturl_schemeretryable_socket_connect_errorfwriteaccessurl_stringdirectory_read_edatadestroy_processhash_table_new_endurl_file_namehtons__ctor_end__mem_free_physicalvfscanfstrptimerewindfreopenres_get_specscookie_jar_newrpc_send_int_responseres_register_specsinitializeres_parsefd_writecookie_headerrpc_response_handlerexitsyscall_timerstrdupdelimrotate_backupsvalid_progress_implementation_psigdelsetsetbufinet_ntopmem_allocateget_urls_htmlstring_set_freeatoiiscntrlfprintf_putsnurl_uses_proxyptimer_measurefprintf_putcgetenv_countmake_directoryfileno__moddi3merge_vecssyscall_v_exitsocket_ip_addressregister_message_handlertimer_registergmtimestrspnaddress_list_connected_pstrlenopentest_socket_openhash_table_iteratetoupperprogress_updatemd5_finish_ctxhash_table_count__init_execstrchroutput_stream_regulario_remove_linkfputsstring_set_to_arraydirectory_seekhtml_quote_stringclosedir_Jv_RegisterClassesmap_html_tagsvasprintflookup_hostlist_removefcntlmd5_init_ctxacceptablerewrite_shorthand_urlremove_linkconnect_to_iphash_table_destroymkdirmsleep__register_frame_infoschemes_are_similar_ppwritemd5_process_blockclosesleep_between_retrievalsget_pidunique_name_signal_default_handlertelldirvfprintfget_cmdlineftp_loginstrpbrkcookie_jar_deleteraiseinit_process_exitfile_sizefreetree_searchsigprocmaskgetsocknamejprintf_putsnget_urls_filetree_removepackages/wget/1.11/etc/0000755000175200017520000000000011517102173014373 5ustar tyndurtyndurpackages/wget/1.11/etc/wgetrc0000644000175200017520000001020011517102173015602 0ustar tyndurtyndur### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /usr/local/etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /usr/local/etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # By default Wget uses "passive FTP" transfer where the client # initiates the data connection to the server rather than the other # way around. That is required on systems behind NAT where the client # computer cannot be easily reached from the Internet. However, some # firewalls software explicitly supports active FTP and in fact has # problems supporting passive transfer. If you are in such # environment, use "passive_ftp = off" to revert to active FTP. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http and ftp. # They will override the value in the environment. #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off packages/wget/1.11/share/0000755000175200017520000000000011517102174014723 5ustar tyndurtyndurpackages/wget/1.11/share/man/0000755000175200017520000000000011517102174015476 5ustar tyndurtyndurpackages/wget/1.11/share/man/man1/0000755000175200017520000000000011517102174016332 5ustar tyndurtyndurpackages/wget/1.11/share/man/man1/wget.10000644000175200017520000023177211517102174017376 0ustar tyndurtyndur.\" Automatically generated by Pod::Man v1.37, Pod::Parser v1.32 .\" .\" Standard preamble: .\" ======================================================================== .de Sh \" Subsection heading .br .if t .Sp .ne 5 .PP \fB\\$1\fR .PP .. .de Sp \" Vertical space (when we can't use .PP) .if t .sp .5v .if n .sp .. .de Vb \" Begin verbatim text .ft CW .nf .ne \\$1 .. .de Ve \" End verbatim text .ft R .fi .. .\" Set up some character translations and predefined strings. \*(-- will .\" give an unbreakable dash, \*(PI will give pi, \*(L" will give a left .\" double quote, and \*(R" will give a right double quote. \*(C+ will .\" give a nicer C++. Capital omega is used to do unbreakable dashes and .\" therefore won't be available. \*(C` and \*(C' expand to `' in nroff, .\" nothing in troff, for use with C<>. .tr \(*W- .ds C+ C\v'-.1v'\h'-1p'\s-2+\h'-1p'+\s0\v'.1v'\h'-1p' .ie n \{\ . ds -- \(*W- . ds PI pi . if (\n(.H=4u)&(1m=24u) .ds -- \(*W\h'-12u'\(*W\h'-12u'-\" diablo 10 pitch . if (\n(.H=4u)&(1m=20u) .ds -- \(*W\h'-12u'\(*W\h'-8u'-\" diablo 12 pitch . ds L" "" . ds R" "" . ds C` "" . ds C' "" 'br\} .el\{\ . ds -- \|\(em\| . ds PI \(*p . ds L" `` . ds R" '' 'br\} .\" .\" If the F register is turned on, we'll generate index entries on stderr for .\" titles (.TH), headers (.SH), subsections (.Sh), items (.Ip), and index .\" entries marked with X<> in POD. Of course, you'll have to process the .\" output yourself in some meaningful fashion. .if \nF \{\ . de IX . tm Index:\\$1\t\\n%\t"\\$2" .. . nr % 0 . rr F .\} .\" .\" For nroff, turn off justification. Always turn off hyphenation; it makes .\" way too many mistakes in technical documents. .hy 0 .if n .na .\" .\" Accent mark definitions (@(#)ms.acc 1.5 88/02/08 SMI; from UCB 4.2). .\" Fear. Run. Save yourself. No user-serviceable parts. . \" fudge factors for nroff and troff .if n \{\ . ds #H 0 . ds #V .8m . ds #F .3m . ds #[ \f1 . ds #] \fP .\} .if t \{\ . ds #H ((1u-(\\\\n(.fu%2u))*.13m) . ds #V .6m . ds #F 0 . ds #[ \& . ds #] \& .\} . \" simple accents for nroff and troff .if n \{\ . ds ' \& . ds ` \& . ds ^ \& . ds , \& . ds ~ ~ . ds / .\} .if t \{\ . ds ' \\k:\h'-(\\n(.wu*8/10-\*(#H)'\'\h"|\\n:u" . ds ` \\k:\h'-(\\n(.wu*8/10-\*(#H)'\`\h'|\\n:u' . ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'^\h'|\\n:u' . ds , \\k:\h'-(\\n(.wu*8/10)',\h'|\\n:u' . ds ~ \\k:\h'-(\\n(.wu-\*(#H-.1m)'~\h'|\\n:u' . ds / \\k:\h'-(\\n(.wu*8/10-\*(#H)'\z\(sl\h'|\\n:u' .\} . \" troff and (daisy-wheel) nroff accents .ds : \\k:\h'-(\\n(.wu*8/10-\*(#H+.1m+\*(#F)'\v'-\*(#V'\z.\h'.2m+\*(#F'.\h'|\\n:u'\v'\*(#V' .ds 8 \h'\*(#H'\(*b\h'-\*(#H' .ds o \\k:\h'-(\\n(.wu+\w'\(de'u-\*(#H)/2u'\v'-.3n'\*(#[\z\(de\v'.3n'\h'|\\n:u'\*(#] .ds d- \h'\*(#H'\(pd\h'-\w'~'u'\v'-.25m'\f2\(hy\fP\v'.25m'\h'-\*(#H' .ds D- D\\k:\h'-\w'D'u'\v'-.11m'\z\(hy\v'.11m'\h'|\\n:u' .ds th \*(#[\v'.3m'\s+1I\s-1\v'-.3m'\h'-(\w'I'u*2/3)'\s-1o\s+1\*(#] .ds Th \*(#[\s+2I\s-2\h'-\w'I'u*3/5'\v'-.3m'o\v'.3m'\*(#] .ds ae a\h'-(\w'a'u*4/10)'e .ds Ae A\h'-(\w'A'u*4/10)'E . \" corrections for vroff .if v .ds ~ \\k:\h'-(\\n(.wu*9/10-\*(#H)'\s-2\u~\d\s+2\h'|\\n:u' .if v .ds ^ \\k:\h'-(\\n(.wu*10/11-\*(#H)'\v'-.4m'^\v'.4m'\h'|\\n:u' . \" for low resolution devices (crt and lpr) .if \n(.H>23 .if \n(.V>19 \ \{\ . ds : e . ds 8 ss . ds o a . ds d- d\h'-1'\(ga . ds D- D\h'-1'\(hy . ds th \o'bp' . ds Th \o'LP' . ds ae ae . ds Ae AE .\} .rm #[ #] #H #V #F C .\" ======================================================================== .\" .IX Title "WGET 1" .TH WGET 1 "2008-01-26" "GNU Wget 1.11" "GNU Wget" .SH "NAME" Wget \- The non\-interactive network downloader. .SH "SYNOPSIS" .IX Header "SYNOPSIS" wget [\fIoption\fR]... [\fI\s-1URL\s0\fR]... .SH "DESCRIPTION" .IX Header "DESCRIPTION" \&\s-1GNU\s0 Wget is a free utility for non-interactive download of files from the Web. It supports \s-1HTTP\s0, \s-1HTTPS\s0, and \s-1FTP\s0 protocols, as well as retrieval through \s-1HTTP\s0 proxies. .PP Wget is non\-interactive, meaning that it can work in the background, while the user is not logged on. This allows you to start a retrieval and disconnect from the system, letting Wget finish the work. By contrast, most of the Web browsers require constant user's presence, which can be a great hindrance when transferring a lot of data. .PP Wget can follow links in \s-1HTML\s0 and \s-1XHTML\s0 pages and create local versions of remote web sites, fully recreating the directory structure of the original site. This is sometimes referred to as \*(L"recursive downloading.\*(R" While doing that, Wget respects the Robot Exclusion Standard (\fI/robots.txt\fR). Wget can be instructed to convert the links in downloaded \s-1HTML\s0 files to the local files for offline viewing. .PP Wget has been designed for robustness over slow or unstable network connections; if a download fails due to a network problem, it will keep retrying until the whole file has been retrieved. If the server supports regetting, it will instruct the server to continue the download from where it left off. .SH "OPTIONS" .IX Header "OPTIONS" .Sh "Option Syntax" .IX Subsection "Option Syntax" Since Wget uses \s-1GNU\s0 getopt to process command-line arguments, every option has a long form along with the short one. Long options are more convenient to remember, but take time to type. You may freely mix different option styles, or specify options after the command-line arguments. Thus you may write: .PP .Vb 1 \& wget \-r \-\-tries=10 http://fly.srk.fer.hr/ \-o log .Ve .PP The space between the option accepting an argument and the argument may be omitted. Instead of \fB\-o log\fR you can write \fB\-olog\fR. .PP You may put several options that do not require arguments together, like: .PP .Vb 1 \& wget \-drc .Ve .PP This is a complete equivalent of: .PP .Vb 1 \& wget \-d \-r \-c .Ve .PP Since the options can be specified after the arguments, you may terminate them with \fB\-\-\fR. So the following will try to download \&\s-1URL\s0 \fB\-x\fR, reporting failure to \fIlog\fR: .PP .Vb 1 \& wget \-o log \-\- \-x .Ve .PP The options that accept comma-separated lists all respect the convention that specifying an empty list clears its value. This can be useful to clear the \fI.wgetrc\fR settings. For instance, if your \fI.wgetrc\fR sets \f(CW\*(C`exclude_directories\*(C'\fR to \fI/cgi\-bin\fR, the following example will first reset it, and then set it to exclude \fI/~nobody\fR and \fI/~somebody\fR. You can also clear the lists in \fI.wgetrc\fR. .PP .Vb 1 \& wget \-X " \-X /~nobody,/~somebody .Ve .PP Most options that do not accept arguments are \fIboolean\fR options, so named because their state can be captured with a yes-or-no (\*(L"boolean\*(R") variable. For example, \fB\-\-follow\-ftp\fR tells Wget to follow \s-1FTP\s0 links from \s-1HTML\s0 files and, on the other hand, \&\fB\-\-no\-glob\fR tells it not to perform file globbing on \s-1FTP\s0 URLs. A boolean option is either \fIaffirmative\fR or \fInegative\fR (beginning with \fB\-\-no\fR). All such options share several properties. .PP Unless stated otherwise, it is assumed that the default behavior is the opposite of what the option accomplishes. For example, the documented existence of \fB\-\-follow\-ftp\fR assumes that the default is to \fInot\fR follow \s-1FTP\s0 links from \s-1HTML\s0 pages. .PP Affirmative options can be negated by prepending the \fB\-\-no\-\fR to the option name; negative options can be negated by omitting the \&\fB\-\-no\-\fR prefix. This might seem superfluous\-\-\-if the default for an affirmative option is to not do something, then why provide a way to explicitly turn it off? But the startup file may in fact change the default. For instance, using \f(CW\*(C`follow_ftp = off\*(C'\fR in \&\fI.wgetrc\fR makes Wget \fInot\fR follow \s-1FTP\s0 links by default, and using \fB\-\-no\-follow\-ftp\fR is the only way to restore the factory default from the command line. .Sh "Basic Startup Options" .IX Subsection "Basic Startup Options" .IP "\fB\-V\fR" 4 .IX Item "-V" .PD 0 .IP "\fB\-\-version\fR" 4 .IX Item "--version" .PD Display the version of Wget. .IP "\fB\-h\fR" 4 .IX Item "-h" .PD 0 .IP "\fB\-\-help\fR" 4 .IX Item "--help" .PD Print a help message describing all of Wget's command-line options. .IP "\fB\-b\fR" 4 .IX Item "-b" .PD 0 .IP "\fB\-\-background\fR" 4 .IX Item "--background" .PD Go to background immediately after startup. If no output file is specified via the \fB\-o\fR, output is redirected to \fIwget-log\fR. .IP "\fB\-e\fR \fIcommand\fR" 4 .IX Item "-e command" .PD 0 .IP "\fB\-\-execute\fR \fIcommand\fR" 4 .IX Item "--execute command" .PD Execute \fIcommand\fR as if it were a part of \fI.wgetrc\fR. A command thus invoked will be executed \&\fIafter\fR the commands in \fI.wgetrc\fR, thus taking precedence over them. If you need to specify more than one wgetrc command, use multiple instances of \fB\-e\fR. .Sh "Logging and Input File Options" .IX Subsection "Logging and Input File Options" .IP "\fB\-o\fR \fIlogfile\fR" 4 .IX Item "-o logfile" .PD 0 .IP "\fB\-\-output\-file=\fR\fIlogfile\fR" 4 .IX Item "--output-file=logfile" .PD Log all messages to \fIlogfile\fR. The messages are normally reported to standard error. .IP "\fB\-a\fR \fIlogfile\fR" 4 .IX Item "-a logfile" .PD 0 .IP "\fB\-\-append\-output=\fR\fIlogfile\fR" 4 .IX Item "--append-output=logfile" .PD Append to \fIlogfile\fR. This is the same as \fB\-o\fR, only it appends to \fIlogfile\fR instead of overwriting the old log file. If \&\fIlogfile\fR does not exist, a new file is created. .IP "\fB\-d\fR" 4 .IX Item "-d" .PD 0 .IP "\fB\-\-debug\fR" 4 .IX Item "--debug" .PD Turn on debug output, meaning various information important to the developers of Wget if it does not work properly. Your system administrator may have chosen to compile Wget without debug support, in which case \fB\-d\fR will not work. Please note that compiling with debug support is always safe\-\-\-Wget compiled with the debug support will \&\fInot\fR print any debug info unless requested with \fB\-d\fR. .IP "\fB\-q\fR" 4 .IX Item "-q" .PD 0 .IP "\fB\-\-quiet\fR" 4 .IX Item "--quiet" .PD Turn off Wget's output. .IP "\fB\-v\fR" 4 .IX Item "-v" .PD 0 .IP "\fB\-\-verbose\fR" 4 .IX Item "--verbose" .PD Turn on verbose output, with all the available data. The default output is verbose. .IP "\fB\-nv\fR" 4 .IX Item "-nv" .PD 0 .IP "\fB\-\-no\-verbose\fR" 4 .IX Item "--no-verbose" .PD Turn off verbose without being completely quiet (use \fB\-q\fR for that), which means that error messages and basic information still get printed. .IP "\fB\-i\fR \fIfile\fR" 4 .IX Item "-i file" .PD 0 .IP "\fB\-\-input\-file=\fR\fIfile\fR" 4 .IX Item "--input-file=file" .PD Read URLs from \fIfile\fR. If \fB\-\fR is specified as \&\fIfile\fR, URLs are read from the standard input. (Use \&\fB./\-\fR to read from a file literally named \fB\-\fR.) .Sp If this function is used, no URLs need be present on the command line. If there are URLs both on the command line and in an input file, those on the command lines will be the first ones to be retrieved. The \fIfile\fR need not be an \s-1HTML\s0 document (but no harm if it is)\-\-\-it is enough if the URLs are just listed sequentially. .Sp However, if you specify \fB\-\-force\-html\fR, the document will be regarded as \fBhtml\fR. In that case you may have problems with relative links, which you can solve either by adding \f(CW\*(C`\*(C'\fR to the documents or by specifying \&\fB\-\-base=\fR\fIurl\fR on the command line. .IP "\fB\-F\fR" 4 .IX Item "-F" .PD 0 .IP "\fB\-\-force\-html\fR" 4 .IX Item "--force-html" .PD When input is read from a file, force it to be treated as an \s-1HTML\s0 file. This enables you to retrieve relative links from existing \&\s-1HTML\s0 files on your local disk, by adding \f(CW\*(C`\*(C'\fR to \s-1HTML\s0, or using the \fB\-\-base\fR command-line option. .IP "\fB\-B\fR \fI\s-1URL\s0\fR" 4 .IX Item "-B URL" .PD 0 .IP "\fB\-\-base=\fR\fI\s-1URL\s0\fR" 4 .IX Item "--base=URL" .PD Prepends \fI\s-1URL\s0\fR to relative links read from the file specified with the \fB\-i\fR option. .Sh "Download Options" .IX Subsection "Download Options" .IP "\fB\-\-bind\-address=\fR\fI\s-1ADDRESS\s0\fR" 4 .IX Item "--bind-address=ADDRESS" When making client \s-1TCP/IP\s0 connections, bind to \fI\s-1ADDRESS\s0\fR on the local machine. \fI\s-1ADDRESS\s0\fR may be specified as a hostname or \s-1IP\s0 address. This option can be useful if your machine is bound to multiple IPs. .IP "\fB\-t\fR \fInumber\fR" 4 .IX Item "-t number" .PD 0 .IP "\fB\-\-tries=\fR\fInumber\fR" 4 .IX Item "--tries=number" .PD Set number of retries to \fInumber\fR. Specify 0 or \fBinf\fR for infinite retrying. The default is to retry 20 times, with the exception of fatal errors like \*(L"connection refused\*(R" or \*(L"not found\*(R" (404), which are not retried. .IP "\fB\-O\fR \fIfile\fR" 4 .IX Item "-O file" .PD 0 .IP "\fB\-\-output\-document=\fR\fIfile\fR" 4 .IX Item "--output-document=file" .PD The documents will not be written to the appropriate files, but all will be concatenated together and written to \fIfile\fR. If \fB\-\fR is used as \fIfile\fR, documents will be printed to standard output, disabling link conversion. (Use \fB./\-\fR to print to a file literally named \fB\-\fR.) .Sp Use of \fB\-O\fR is \fInot\fR intended to mean simply "use the name \&\fIfile\fR instead of the one in the \s-1URL\s0;" rather, it is analogous to shell redirection: \&\fBwget \-O file http://foo\fR is intended to work like \&\fBwget \-O \- http://foo > file\fR; \fIfile\fR will be truncated immediately, and \fIall\fR downloaded content will be written there. .Sp Note that a combination with \fB\-k\fR is only permitted when downloading a single document, and combination with any of \fB\-r\fR, \&\fB\-p\fR, or \fB\-N\fR is not allowed. .IP "\fB\-nc\fR" 4 .IX Item "-nc" .PD 0 .IP "\fB\-\-no\-clobber\fR" 4 .IX Item "--no-clobber" .PD If a file is downloaded more than once in the same directory, Wget's behavior depends on a few options, including \fB\-nc\fR. In certain cases, the local file will be \fIclobbered\fR, or overwritten, upon repeated download. In other cases it will be preserved. .Sp When running Wget without \fB\-N\fR, \fB\-nc\fR, \fB\-r\fR, or \fBp\fR, downloading the same file in the same directory will result in the original copy of \fIfile\fR being preserved and the second copy being named \fIfile\fR\fB.1\fR. If that file is downloaded yet again, the third copy will be named \fIfile\fR\fB.2\fR, and so on. When \&\fB\-nc\fR is specified, this behavior is suppressed, and Wget will refuse to download newer copies of \fIfile\fR. Therefore, "\f(CW\*(C`no\-clobber\*(C'\fR" is actually a misnomer in this mode\-\-\-it's not clobbering that's prevented (as the numeric suffixes were already preventing clobbering), but rather the multiple version saving that's prevented. .Sp When running Wget with \fB\-r\fR or \fB\-p\fR, but without \fB\-N\fR or \fB\-nc\fR, re-downloading a file will result in the new copy simply overwriting the old. Adding \fB\-nc\fR will prevent this behavior, instead causing the original version to be preserved and any newer copies on the server to be ignored. .Sp When running Wget with \fB\-N\fR, with or without \fB\-r\fR or \&\fB\-p\fR, the decision as to whether or not to download a newer copy of a file depends on the local and remote timestamp and size of the file. \fB\-nc\fR may not be specified at the same time as \fB\-N\fR. .Sp Note that when \fB\-nc\fR is specified, files with the suffixes \&\fB.html\fR or \fB.htm\fR will be loaded from the local disk and parsed as if they had been retrieved from the Web. .IP "\fB\-c\fR" 4 .IX Item "-c" .PD 0 .IP "\fB\-\-continue\fR" 4 .IX Item "--continue" .PD Continue getting a partially-downloaded file. This is useful when you want to finish up a download started by a previous instance of Wget, or by another program. For instance: .Sp .Vb 1 \& wget \-c ftp://sunsite.doc.ic.ac.uk/ls\-lR.Z .Ve .Sp If there is a file named \fIls\-lR.Z\fR in the current directory, Wget will assume that it is the first portion of the remote file, and will ask the server to continue the retrieval from an offset equal to the length of the local file. .Sp Note that you don't need to specify this option if you just want the current invocation of Wget to retry downloading a file should the connection be lost midway through. This is the default behavior. \&\fB\-c\fR only affects resumption of downloads started \fIprior\fR to this invocation of Wget, and whose local files are still sitting around. .Sp Without \fB\-c\fR, the previous example would just download the remote file to \fIls\-lR.Z.1\fR, leaving the truncated \fIls\-lR.Z\fR file alone. .Sp Beginning with Wget 1.7, if you use \fB\-c\fR on a non-empty file, and it turns out that the server does not support continued downloading, Wget will refuse to start the download from scratch, which would effectively ruin existing contents. If you really want the download to start from scratch, remove the file. .Sp Also beginning with Wget 1.7, if you use \fB\-c\fR on a file which is of equal size as the one on the server, Wget will refuse to download the file and print an explanatory message. The same happens when the file is smaller on the server than locally (presumably because it was changed on the server since your last download attempt)\-\-\-because \*(L"continuing\*(R" is not meaningful, no download occurs. .Sp On the other side of the coin, while using \fB\-c\fR, any file that's bigger on the server than locally will be considered an incomplete download and only \f(CW\*(C`(length(remote) \- length(local))\*(C'\fR bytes will be downloaded and tacked onto the end of the local file. This behavior can be desirable in certain cases\-\-\-for instance, you can use \fBwget \-c\fR to download just the new portion that's been appended to a data collection or log file. .Sp However, if the file is bigger on the server because it's been \&\fIchanged\fR, as opposed to just \fIappended\fR to, you'll end up with a garbled file. Wget has no way of verifying that the local file is really a valid prefix of the remote file. You need to be especially careful of this when using \fB\-c\fR in conjunction with \fB\-r\fR, since every file will be considered as an \*(L"incomplete download\*(R" candidate. .Sp Another instance where you'll get a garbled file if you try to use \&\fB\-c\fR is if you have a lame \s-1HTTP\s0 proxy that inserts a \&\*(L"transfer interrupted\*(R" string into the local file. In the future a \&\*(L"rollback\*(R" option may be added to deal with this case. .Sp Note that \fB\-c\fR only works with \s-1FTP\s0 servers and with \s-1HTTP\s0 servers that support the \f(CW\*(C`Range\*(C'\fR header. .IP "\fB\-\-progress=\fR\fItype\fR" 4 .IX Item "--progress=type" Select the type of the progress indicator you wish to use. Legal indicators are \*(L"dot\*(R" and \*(L"bar\*(R". .Sp The \*(L"bar\*(R" indicator is used by default. It draws an \s-1ASCII\s0 progress bar graphics (a.k.a \*(L"thermometer\*(R" display) indicating the status of retrieval. If the output is not a \s-1TTY\s0, the \*(L"dot\*(R" bar will be used by default. .Sp Use \fB\-\-progress=dot\fR to switch to the \*(L"dot\*(R" display. It traces the retrieval by printing dots on the screen, each dot representing a fixed amount of downloaded data. .Sp When using the dotted retrieval, you may also set the \fIstyle\fR by specifying the type as \fBdot:\fR\fIstyle\fR. Different styles assign different meaning to one dot. With the \f(CW\*(C`default\*(C'\fR style each dot represents 1K, there are ten dots in a cluster and 50 dots in a line. The \f(CW\*(C`binary\*(C'\fR style has a more \*(L"computer\*(R"\-like orientation\-\-\-8K dots, 16\-dots clusters and 48 dots per line (which makes for 384K lines). The \f(CW\*(C`mega\*(C'\fR style is suitable for downloading very large files\-\-\-each dot represents 64K retrieved, there are eight dots in a cluster, and 48 dots on each line (so each line contains 3M). .Sp Note that you can set the default style using the \f(CW\*(C`progress\*(C'\fR command in \fI.wgetrc\fR. That setting may be overridden from the command line. The exception is that, when the output is not a \s-1TTY\s0, the \&\*(L"dot\*(R" progress will be favored over \*(L"bar\*(R". To force the bar output, use \fB\-\-progress=bar:force\fR. .IP "\fB\-N\fR" 4 .IX Item "-N" .PD 0 .IP "\fB\-\-timestamping\fR" 4 .IX Item "--timestamping" .PD Turn on time\-stamping. .IP "\fB\-S\fR" 4 .IX Item "-S" .PD 0 .IP "\fB\-\-server\-response\fR" 4 .IX Item "--server-response" .PD Print the headers sent by \s-1HTTP\s0 servers and responses sent by \&\s-1FTP\s0 servers. .IP "\fB\-\-spider\fR" 4 .IX Item "--spider" When invoked with this option, Wget will behave as a Web \fIspider\fR, which means that it will not download the pages, just check that they are there. For example, you can use Wget to check your bookmarks: .Sp .Vb 1 \& wget \-\-spider \-\-force\-html \-i bookmarks.html .Ve .Sp This feature needs much more work for Wget to get close to the functionality of real web spiders. .IP "\fB\-T seconds\fR" 4 .IX Item "-T seconds" .PD 0 .IP "\fB\-\-timeout=\fR\fIseconds\fR" 4 .IX Item "--timeout=seconds" .PD Set the network timeout to \fIseconds\fR seconds. This is equivalent to specifying \fB\-\-dns\-timeout\fR, \fB\-\-connect\-timeout\fR, and \&\fB\-\-read\-timeout\fR, all at the same time. .Sp When interacting with the network, Wget can check for timeout and abort the operation if it takes too long. This prevents anomalies like hanging reads and infinite connects. The only timeout enabled by default is a 900\-second read timeout. Setting a timeout to 0 disables it altogether. Unless you know what you are doing, it is best not to change the default timeout settings. .Sp All timeout-related options accept decimal values, as well as subsecond values. For example, \fB0.1\fR seconds is a legal (though unwise) choice of timeout. Subsecond timeouts are useful for checking server response times or for testing network latency. .IP "\fB\-\-dns\-timeout=\fR\fIseconds\fR" 4 .IX Item "--dns-timeout=seconds" Set the \s-1DNS\s0 lookup timeout to \fIseconds\fR seconds. \s-1DNS\s0 lookups that don't complete within the specified time will fail. By default, there is no timeout on \s-1DNS\s0 lookups, other than that implemented by system libraries. .IP "\fB\-\-connect\-timeout=\fR\fIseconds\fR" 4 .IX Item "--connect-timeout=seconds" Set the connect timeout to \fIseconds\fR seconds. \s-1TCP\s0 connections that take longer to establish will be aborted. By default, there is no connect timeout, other than that implemented by system libraries. .IP "\fB\-\-read\-timeout=\fR\fIseconds\fR" 4 .IX Item "--read-timeout=seconds" Set the read (and write) timeout to \fIseconds\fR seconds. The \&\*(L"time\*(R" of this timeout refers to \fIidle time\fR: if, at any point in the download, no data is received for more than the specified number of seconds, reading fails and the download is restarted. This option does not directly affect the duration of the entire download. .Sp Of course, the remote server may choose to terminate the connection sooner than this option requires. The default read timeout is 900 seconds. .IP "\fB\-\-limit\-rate=\fR\fIamount\fR" 4 .IX Item "--limit-rate=amount" Limit the download speed to \fIamount\fR bytes per second. Amount may be expressed in bytes, kilobytes with the \fBk\fR suffix, or megabytes with the \fBm\fR suffix. For example, \fB\-\-limit\-rate=20k\fR will limit the retrieval rate to 20KB/s. This is useful when, for whatever reason, you don't want Wget to consume the entire available bandwidth. .Sp This option allows the use of decimal numbers, usually in conjunction with power suffixes; for example, \fB\-\-limit\-rate=2.5k\fR is a legal value. .Sp Note that Wget implements the limiting by sleeping the appropriate amount of time after a network read that took less time than specified by the rate. Eventually this strategy causes the \s-1TCP\s0 transfer to slow down to approximately the specified rate. However, it may take some time for this balance to be achieved, so don't be surprised if limiting the rate doesn't work well with very small files. .IP "\fB\-w\fR \fIseconds\fR" 4 .IX Item "-w seconds" .PD 0 .IP "\fB\-\-wait=\fR\fIseconds\fR" 4 .IX Item "--wait=seconds" .PD Wait the specified number of seconds between the retrievals. Use of this option is recommended, as it lightens the server load by making the requests less frequent. Instead of in seconds, the time can be specified in minutes using the \f(CW\*(C`m\*(C'\fR suffix, in hours using \f(CW\*(C`h\*(C'\fR suffix, or in days using \f(CW\*(C`d\*(C'\fR suffix. .Sp Specifying a large value for this option is useful if the network or the destination host is down, so that Wget can wait long enough to reasonably expect the network error to be fixed before the retry. The waiting interval specified by this function is influenced by \&\f(CW\*(C`\-\-random\-wait\*(C'\fR, which see. .IP "\fB\-\-waitretry=\fR\fIseconds\fR" 4 .IX Item "--waitretry=seconds" If you don't want Wget to wait between \fIevery\fR retrieval, but only between retries of failed downloads, you can use this option. Wget will use \fIlinear backoff\fR, waiting 1 second after the first failure on a given file, then waiting 2 seconds after the second failure on that file, up to the maximum number of \fIseconds\fR you specify. Therefore, a value of 10 will actually make Wget wait up to (1 + 2 + ... + 10) = 55 seconds per file. .Sp Note that this option is turned on by default in the global \&\fIwgetrc\fR file. .IP "\fB\-\-random\-wait\fR" 4 .IX Item "--random-wait" Some web sites may perform log analysis to identify retrieval programs such as Wget by looking for statistically significant similarities in the time between requests. This option causes the time between requests to vary between 0.5 and 1.5 * \fIwait\fR seconds, where \fIwait\fR was specified using the \fB\-\-wait\fR option, in order to mask Wget's presence from such analysis. .Sp A 2001 article in a publication devoted to development on a popular consumer platform provided code to perform this analysis on the fly. Its author suggested blocking at the class C address level to ensure automated retrieval programs were blocked despite changing DHCP-supplied addresses. .Sp The \fB\-\-random\-wait\fR option was inspired by this ill-advised recommendation to block many unrelated users from a web site due to the actions of one. .IP "\fB\-\-no\-proxy\fR" 4 .IX Item "--no-proxy" Don't use proxies, even if the appropriate \f(CW*_proxy\fR environment variable is defined. .IP "\fB\-Q\fR \fIquota\fR" 4 .IX Item "-Q quota" .PD 0 .IP "\fB\-\-quota=\fR\fIquota\fR" 4 .IX Item "--quota=quota" .PD Specify download quota for automatic retrievals. The value can be specified in bytes (default), kilobytes (with \fBk\fR suffix), or megabytes (with \fBm\fR suffix). .Sp Note that quota will never affect downloading a single file. So if you specify \fBwget \-Q10k ftp://wuarchive.wustl.edu/ls\-lR.gz\fR, all of the \&\fIls\-lR.gz\fR will be downloaded. The same goes even when several URLs are specified on the command\-line. However, quota is respected when retrieving either recursively, or from an input file. Thus you may safely type \fBwget \-Q2m \-i sites\fR\-\-\-download will be aborted when the quota is exceeded. .Sp Setting quota to 0 or to \fBinf\fR unlimits the download quota. .IP "\fB\-\-no\-dns\-cache\fR" 4 .IX Item "--no-dns-cache" Turn off caching of \s-1DNS\s0 lookups. Normally, Wget remembers the \s-1IP\s0 addresses it looked up from \s-1DNS\s0 so it doesn't have to repeatedly contact the \s-1DNS\s0 server for the same (typically small) set of hosts it retrieves from. This cache exists in memory only; a new Wget run will contact \s-1DNS\s0 again. .Sp However, it has been reported that in some situations it is not desirable to cache host names, even for the duration of a short-running application like Wget. With this option Wget issues a new \s-1DNS\s0 lookup (more precisely, a new call to \f(CW\*(C`gethostbyname\*(C'\fR or \&\f(CW\*(C`getaddrinfo\*(C'\fR) each time it makes a new connection. Please note that this option will \fInot\fR affect caching that might be performed by the resolving library or by an external caching layer, such as \s-1NSCD\s0. .Sp If you don't understand exactly what this option does, you probably won't need it. .IP "\fB\-\-restrict\-file\-names=\fR\fImode\fR" 4 .IX Item "--restrict-file-names=mode" Change which characters found in remote URLs may show up in local file names generated from those URLs. Characters that are \fIrestricted\fR by this option are escaped, i.e. replaced with \fB%HH\fR, where \&\fB\s-1HH\s0\fR is the hexadecimal number that corresponds to the restricted character. .Sp By default, Wget escapes the characters that are not valid as part of file names on your operating system, as well as control characters that are typically unprintable. This option is useful for changing these defaults, either because you are downloading to a non-native partition, or because you want to disable escaping of the control characters. .Sp When mode is set to \*(L"unix\*(R", Wget escapes the character \fB/\fR and the control characters in the ranges 0\-\-31 and 128\-\-159. This is the default on Unix-like \s-1OS\s0'es. .Sp When mode is set to \*(L"windows\*(R", Wget escapes the characters \fB\e\fR, \&\fB|\fR, \fB/\fR, \fB:\fR, \fB?\fR, \fB"\fR, \fB*\fR, \fB<\fR, \&\fB>\fR, and the control characters in the ranges 0\-\-31 and 128\-\-159. In addition to this, Wget in Windows mode uses \fB+\fR instead of \&\fB:\fR to separate host and port in local file names, and uses \&\fB@\fR instead of \fB?\fR to separate the query portion of the file name from the rest. Therefore, a \s-1URL\s0 that would be saved as \&\fBwww.xemacs.org:4300/search.pl?input=blah\fR in Unix mode would be saved as \fBwww.xemacs.org+4300/search.pl@input=blah\fR in Windows mode. This mode is the default on Windows. .Sp If you append \fB,nocontrol\fR to the mode, as in \&\fBunix,nocontrol\fR, escaping of the control characters is also switched off. You can use \fB\-\-restrict\-file\-names=nocontrol\fR to turn off escaping of control characters without affecting the choice of the \s-1OS\s0 to use as file name restriction mode. .IP "\fB\-4\fR" 4 .IX Item "-4" .PD 0 .IP "\fB\-\-inet4\-only\fR" 4 .IX Item "--inet4-only" .IP "\fB\-6\fR" 4 .IX Item "-6" .IP "\fB\-\-inet6\-only\fR" 4 .IX Item "--inet6-only" .PD Force connecting to IPv4 or IPv6 addresses. With \fB\-\-inet4\-only\fR or \fB\-4\fR, Wget will only connect to IPv4 hosts, ignoring \s-1AAAA\s0 records in \s-1DNS\s0, and refusing to connect to IPv6 addresses specified in URLs. Conversely, with \fB\-\-inet6\-only\fR or \fB\-6\fR, Wget will only connect to IPv6 hosts and ignore A records and IPv4 addresses. .Sp Neither options should be needed normally. By default, an IPv6\-aware Wget will use the address family specified by the host's \s-1DNS\s0 record. If the \s-1DNS\s0 responds with both IPv4 and IPv6 addresses, Wget will try them in sequence until it finds one it can connect to. (Also see \&\f(CW\*(C`\-\-prefer\-family\*(C'\fR option described below.) .Sp These options can be used to deliberately force the use of IPv4 or IPv6 address families on dual family systems, usually to aid debugging or to deal with broken network configuration. Only one of \&\fB\-\-inet6\-only\fR and \fB\-\-inet4\-only\fR may be specified at the same time. Neither option is available in Wget compiled without IPv6 support. .IP "\fB\-\-prefer\-family=IPv4/IPv6/none\fR" 4 .IX Item "--prefer-family=IPv4/IPv6/none" When given a choice of several addresses, connect to the addresses with specified address family first. IPv4 addresses are preferred by default. .Sp This avoids spurious errors and connect attempts when accessing hosts that resolve to both IPv6 and IPv4 addresses from IPv4 networks. For example, \fBwww.kame.net\fR resolves to \&\fB2001:200:0:8002:203:47ff:fea5:3085\fR and to \&\fB203.178.141.194\fR. When the preferred family is \f(CW\*(C`IPv4\*(C'\fR, the IPv4 address is used first; when the preferred family is \f(CW\*(C`IPv6\*(C'\fR, the IPv6 address is used first; if the specified value is \f(CW\*(C`none\*(C'\fR, the address order returned by \s-1DNS\s0 is used without change. .Sp Unlike \fB\-4\fR and \fB\-6\fR, this option doesn't inhibit access to any address family, it only changes the \fIorder\fR in which the addresses are accessed. Also note that the reordering performed by this option is \fIstable\fR\-\-\-it doesn't affect order of addresses of the same family. That is, the relative order of all IPv4 addresses and of all IPv6 addresses remains intact in all cases. .IP "\fB\-\-retry\-connrefused\fR" 4 .IX Item "--retry-connrefused" Consider \*(L"connection refused\*(R" a transient error and try again. Normally Wget gives up on a \s-1URL\s0 when it is unable to connect to the site because failure to connect is taken as a sign that the server is not running at all and that retries would not help. This option is for mirroring unreliable sites whose servers tend to disappear for short periods of time. .IP "\fB\-\-user=\fR\fIuser\fR" 4 .IX Item "--user=user" .PD 0 .IP "\fB\-\-password=\fR\fIpassword\fR" 4 .IX Item "--password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR for both \&\s-1FTP\s0 and \s-1HTTP\s0 file retrieval. These parameters can be overridden using the \fB\-\-ftp\-user\fR and \fB\-\-ftp\-password\fR options for \&\s-1FTP\s0 connections and the \fB\-\-http\-user\fR and \fB\-\-http\-password\fR options for \s-1HTTP\s0 connections. .Sh "Directory Options" .IX Subsection "Directory Options" .IP "\fB\-nd\fR" 4 .IX Item "-nd" .PD 0 .IP "\fB\-\-no\-directories\fR" 4 .IX Item "--no-directories" .PD Do not create a hierarchy of directories when retrieving recursively. With this option turned on, all files will get saved to the current directory, without clobbering (if a name shows up more than once, the filenames will get extensions \fB.n\fR). .IP "\fB\-x\fR" 4 .IX Item "-x" .PD 0 .IP "\fB\-\-force\-directories\fR" 4 .IX Item "--force-directories" .PD The opposite of \fB\-nd\fR\-\-\-create a hierarchy of directories, even if one would not have been created otherwise. E.g. \fBwget \-x http://fly.srk.fer.hr/robots.txt\fR will save the downloaded file to \&\fIfly.srk.fer.hr/robots.txt\fR. .IP "\fB\-nH\fR" 4 .IX Item "-nH" .PD 0 .IP "\fB\-\-no\-host\-directories\fR" 4 .IX Item "--no-host-directories" .PD Disable generation of host-prefixed directories. By default, invoking Wget with \fB\-r http://fly.srk.fer.hr/\fR will create a structure of directories beginning with \fIfly.srk.fer.hr/\fR. This option disables such behavior. .IP "\fB\-\-protocol\-directories\fR" 4 .IX Item "--protocol-directories" Use the protocol name as a directory component of local file names. For example, with this option, \fBwget \-r http://\fR\fIhost\fR will save to \&\fBhttp/\fR\fIhost\fR\fB/...\fR rather than just to \fIhost\fR\fB/...\fR. .IP "\fB\-\-cut\-dirs=\fR\fInumber\fR" 4 .IX Item "--cut-dirs=number" Ignore \fInumber\fR directory components. This is useful for getting a fine-grained control over the directory where recursive retrieval will be saved. .Sp Take, for example, the directory at \&\fBftp://ftp.xemacs.org/pub/xemacs/\fR. If you retrieve it with \&\fB\-r\fR, it will be saved locally under \&\fIftp.xemacs.org/pub/xemacs/\fR. While the \fB\-nH\fR option can remove the \fIftp.xemacs.org/\fR part, you are still stuck with \&\fIpub/xemacs\fR. This is where \fB\-\-cut\-dirs\fR comes in handy; it makes Wget not \*(L"see\*(R" \fInumber\fR remote directory components. Here are several examples of how \fB\-\-cut\-dirs\fR option works. .Sp .Vb 4 \& No options \-> ftp.xemacs.org/pub/xemacs/ \& \-nH \-> pub/xemacs/ \& \-nH \-\-cut\-dirs=1 \-> xemacs/ \& \-nH \-\-cut\-dirs=2 \-> . .Ve .Sp .Vb 2 \& \-\-cut\-dirs=1 \-> ftp.xemacs.org/xemacs/ \& ... .Ve .Sp If you just want to get rid of the directory structure, this option is similar to a combination of \fB\-nd\fR and \fB\-P\fR. However, unlike \&\fB\-nd\fR, \fB\-\-cut\-dirs\fR does not lose with subdirectories\-\-\-for instance, with \fB\-nH \-\-cut\-dirs=1\fR, a \fIbeta/\fR subdirectory will be placed to \fIxemacs/beta\fR, as one would expect. .IP "\fB\-P\fR \fIprefix\fR" 4 .IX Item "-P prefix" .PD 0 .IP "\fB\-\-directory\-prefix=\fR\fIprefix\fR" 4 .IX Item "--directory-prefix=prefix" .PD Set directory prefix to \fIprefix\fR. The \fIdirectory prefix\fR is the directory where all other files and subdirectories will be saved to, i.e. the top of the retrieval tree. The default is \fB.\fR (the current directory). .Sh "\s-1HTTP\s0 Options" .IX Subsection "HTTP Options" .IP "\fB\-E\fR" 4 .IX Item "-E" .PD 0 .IP "\fB\-\-html\-extension\fR" 4 .IX Item "--html-extension" .PD If a file of type \fBapplication/xhtml+xml\fR or \fBtext/html\fR is downloaded and the \s-1URL\s0 does not end with the regexp \&\fB\e.[Hh][Tt][Mm][Ll]?\fR, this option will cause the suffix \fB.html\fR to be appended to the local filename. This is useful, for instance, when you're mirroring a remote site that uses \fB.asp\fR pages, but you want the mirrored pages to be viewable on your stock Apache server. Another good use for this is when you're downloading CGI-generated materials. A \s-1URL\s0 like \fBhttp://site.com/article.cgi?25\fR will be saved as \&\fIarticle.cgi?25.html\fR. .Sp Note that filenames changed in this way will be re-downloaded every time you re-mirror a site, because Wget can't tell that the local \&\fI\fIX\fI.html\fR file corresponds to remote \s-1URL\s0 \fIX\fR (since it doesn't yet know that the \s-1URL\s0 produces output of type \&\fBtext/html\fR or \fBapplication/xhtml+xml\fR. To prevent this re\-downloading, you must use \fB\-k\fR and \fB\-K\fR so that the original version of the file will be saved as \fI\fIX\fI.orig\fR. .IP "\fB\-\-http\-user=\fR\fIuser\fR" 4 .IX Item "--http-user=user" .PD 0 .IP "\fB\-\-http\-password=\fR\fIpassword\fR" 4 .IX Item "--http-password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR on an \&\s-1HTTP\s0 server. According to the type of the challenge, Wget will encode them using either the \f(CW\*(C`basic\*(C'\fR (insecure), the \f(CW\*(C`digest\*(C'\fR, or the Windows \f(CW\*(C`NTLM\*(C'\fR authentication scheme. .Sp Another way to specify username and password is in the \s-1URL\s0 itself. Either method reveals your password to anyone who bothers to run \f(CW\*(C`ps\*(C'\fR. To prevent the passwords from being seen, store them in \fI.wgetrc\fR or \fI.netrc\fR, and make sure to protect those files from other users with \f(CW\*(C`chmod\*(C'\fR. If the passwords are really important, do not leave them lying in those files either\-\-\-edit the files and delete them after Wget has started the download. .IP "\fB\-\-no\-cache\fR" 4 .IX Item "--no-cache" Disable server-side cache. In this case, Wget will send the remote server an appropriate directive (\fBPragma: no-cache\fR) to get the file from the remote service, rather than returning the cached version. This is especially useful for retrieving and flushing out-of-date documents on proxy servers. .Sp Caching is allowed by default. .IP "\fB\-\-no\-cookies\fR" 4 .IX Item "--no-cookies" Disable the use of cookies. Cookies are a mechanism for maintaining server-side state. The server sends the client a cookie using the \&\f(CW\*(C`Set\-Cookie\*(C'\fR header, and the client responds with the same cookie upon further requests. Since cookies allow the server owners to keep track of visitors and for sites to exchange this information, some consider them a breach of privacy. The default is to use cookies; however, \fIstoring\fR cookies is not on by default. .IP "\fB\-\-load\-cookies\fR \fIfile\fR" 4 .IX Item "--load-cookies file" Load cookies from \fIfile\fR before the first \s-1HTTP\s0 retrieval. \&\fIfile\fR is a textual file in the format originally used by Netscape's \&\fIcookies.txt\fR file. .Sp You will typically use this option when mirroring sites that require that you be logged in to access some or all of their content. The login process typically works by the web server issuing an \s-1HTTP\s0 cookie upon receiving and verifying your credentials. The cookie is then resent by the browser when accessing that part of the site, and so proves your identity. .Sp Mirroring such a site requires Wget to send the same cookies your browser sends when communicating with the site. This is achieved by \&\fB\-\-load\-cookies\fR\-\-\-simply point Wget to the location of the \&\fIcookies.txt\fR file, and it will send the same cookies your browser would send in the same situation. Different browsers keep textual cookie files in different locations: .RS 4 .IP "@asis" 4 .IX Item "@asis" The cookies are in \fI~/.netscape/cookies.txt\fR. .IP "@asis" 4 .IX Item "@asis" Mozilla's cookie file is also named \fIcookies.txt\fR, located somewhere under \fI~/.mozilla\fR, in the directory of your profile. The full path usually ends up looking somewhat like \&\fI~/.mozilla/default/\fIsome-weird-string\fI/cookies.txt\fR. .IP "@asis" 4 .IX Item "@asis" You can produce a cookie file Wget can use by using the File menu, Import and Export, Export Cookies. This has been tested with Internet Explorer 5; it is not guaranteed to work with earlier versions. .IP "@asis" 4 .IX Item "@asis" If you are using a different browser to create your cookies, \&\fB\-\-load\-cookies\fR will only work if you can locate or produce a cookie file in the Netscape format that Wget expects. .RE .RS 4 .Sp If you cannot use \fB\-\-load\-cookies\fR, there might still be an alternative. If your browser supports a \*(L"cookie manager\*(R", you can use it to view the cookies used when accessing the site you're mirroring. Write down the name and value of the cookie, and manually instruct Wget to send those cookies, bypassing the \*(L"official\*(R" cookie support: .Sp .Vb 1 \& wget \-\-no\-cookies \-\-header "Cookie: =" .Ve .RE .IP "\fB\-\-save\-cookies\fR \fIfile\fR" 4 .IX Item "--save-cookies file" Save cookies to \fIfile\fR before exiting. This will not save cookies that have expired or that have no expiry time (so\-called \*(L"session cookies\*(R"), but also see \fB\-\-keep\-session\-cookies\fR. .IP "\fB\-\-keep\-session\-cookies\fR" 4 .IX Item "--keep-session-cookies" When specified, causes \fB\-\-save\-cookies\fR to also save session cookies. Session cookies are normally not saved because they are meant to be kept in memory and forgotten when you exit the browser. Saving them is useful on sites that require you to log in or to visit the home page before you can access some pages. With this option, multiple Wget runs are considered a single browser session as far as the site is concerned. .Sp Since the cookie file format does not normally carry session cookies, Wget marks them with an expiry timestamp of 0. Wget's \&\fB\-\-load\-cookies\fR recognizes those as session cookies, but it might confuse other browsers. Also note that cookies so loaded will be treated as other session cookies, which means that if you want \&\fB\-\-save\-cookies\fR to preserve them again, you must use \&\fB\-\-keep\-session\-cookies\fR again. .IP "\fB\-\-ignore\-length\fR" 4 .IX Item "--ignore-length" Unfortunately, some \s-1HTTP\s0 servers (\s-1CGI\s0 programs, to be more precise) send out bogus \f(CW\*(C`Content\-Length\*(C'\fR headers, which makes Wget go wild, as it thinks not all the document was retrieved. You can spot this syndrome if Wget retries getting the same document again and again, each time claiming that the (otherwise normal) connection has closed on the very same byte. .Sp With this option, Wget will ignore the \f(CW\*(C`Content\-Length\*(C'\fR header\-\-\-as if it never existed. .IP "\fB\-\-header=\fR\fIheader-line\fR" 4 .IX Item "--header=header-line" Send \fIheader-line\fR along with the rest of the headers in each \&\s-1HTTP\s0 request. The supplied header is sent as\-is, which means it must contain name and value separated by colon, and must not contain newlines. .Sp You may define more than one additional header by specifying \&\fB\-\-header\fR more than once. .Sp .Vb 3 \& wget \-\-header='Accept\-Charset: iso\-8859\-2' \e \& \-\-header='Accept\-Language: hr' \e \& http://fly.srk.fer.hr/ .Ve .Sp Specification of an empty string as the header value will clear all previous user-defined headers. .Sp As of Wget 1.10, this option can be used to override headers otherwise generated automatically. This example instructs Wget to connect to localhost, but to specify \fBfoo.bar\fR in the \f(CW\*(C`Host\*(C'\fR header: .Sp .Vb 1 \& wget \-\-header="Host: foo.bar" http://localhost/ .Ve .Sp In versions of Wget prior to 1.10 such use of \fB\-\-header\fR caused sending of duplicate headers. .IP "\fB\-\-max\-redirect=\fR\fInumber\fR" 4 .IX Item "--max-redirect=number" Specifies the maximum number of redirections to follow for a resource. The default is 20, which is usually far more than necessary. However, on those occasions where you want to allow more (or fewer), this is the option to use. .IP "\fB\-\-proxy\-user=\fR\fIuser\fR" 4 .IX Item "--proxy-user=user" .PD 0 .IP "\fB\-\-proxy\-password=\fR\fIpassword\fR" 4 .IX Item "--proxy-password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR for authentication on a proxy server. Wget will encode them using the \&\f(CW\*(C`basic\*(C'\fR authentication scheme. .Sp Security considerations similar to those with \fB\-\-http\-password\fR pertain here as well. .IP "\fB\-\-referer=\fR\fIurl\fR" 4 .IX Item "--referer=url" Include `Referer: \fIurl\fR' header in \s-1HTTP\s0 request. Useful for retrieving documents with server-side processing that assume they are always being retrieved by interactive web browsers and only come out properly when Referer is set to one of the pages that point to them. .IP "\fB\-\-save\-headers\fR" 4 .IX Item "--save-headers" Save the headers sent by the \s-1HTTP\s0 server to the file, preceding the actual contents, with an empty line as the separator. .IP "\fB\-U\fR \fIagent-string\fR" 4 .IX Item "-U agent-string" .PD 0 .IP "\fB\-\-user\-agent=\fR\fIagent-string\fR" 4 .IX Item "--user-agent=agent-string" .PD Identify as \fIagent-string\fR to the \s-1HTTP\s0 server. .Sp The \s-1HTTP\s0 protocol allows the clients to identify themselves using a \&\f(CW\*(C`User\-Agent\*(C'\fR header field. This enables distinguishing the \&\s-1WWW\s0 software, usually for statistical purposes or for tracing of protocol violations. Wget normally identifies as \&\fBWget/\fR\fIversion\fR, \fIversion\fR being the current version number of Wget. .Sp However, some sites have been known to impose the policy of tailoring the output according to the \f(CW\*(C`User\-Agent\*(C'\fR\-supplied information. While this is not such a bad idea in theory, it has been abused by servers denying information to clients other than (historically) Netscape or, more frequently, Microsoft Internet Explorer. This option allows you to change the \f(CW\*(C`User\-Agent\*(C'\fR line issued by Wget. Use of this option is discouraged, unless you really know what you are doing. .Sp Specifying empty user agent with \fB\-\-user\-agent=""\fR instructs Wget not to send the \f(CW\*(C`User\-Agent\*(C'\fR header in \s-1HTTP\s0 requests. .IP "\fB\-\-post\-data=\fR\fIstring\fR" 4 .IX Item "--post-data=string" .PD 0 .IP "\fB\-\-post\-file=\fR\fIfile\fR" 4 .IX Item "--post-file=file" .PD Use \s-1POST\s0 as the method for all \s-1HTTP\s0 requests and send the specified data in the request body. \f(CW\*(C`\-\-post\-data\*(C'\fR sends \fIstring\fR as data, whereas \f(CW\*(C`\-\-post\-file\*(C'\fR sends the contents of \fIfile\fR. Other than that, they work in exactly the same way. .Sp Please be aware that Wget needs to know the size of the \s-1POST\s0 data in advance. Therefore the argument to \f(CW\*(C`\-\-post\-file\*(C'\fR must be a regular file; specifying a \s-1FIFO\s0 or something like \fI/dev/stdin\fR won't work. It's not quite clear how to work around this limitation inherent in \&\s-1HTTP/1\s0.0. Although \s-1HTTP/1\s0.1 introduces \fIchunked\fR transfer that doesn't require knowing the request length in advance, a client can't use chunked unless it knows it's talking to an \s-1HTTP/1\s0.1 server. And it can't know that until it receives a response, which in turn requires the request to have been completed \*(-- a chicken-and-egg problem. .Sp Note: if Wget is redirected after the \s-1POST\s0 request is completed, it will not send the \s-1POST\s0 data to the redirected \s-1URL\s0. This is because URLs that process \s-1POST\s0 often respond with a redirection to a regular page, which does not desire or accept \s-1POST\s0. It is not completely clear that this behavior is optimal; if it doesn't work out, it might be changed in the future. .Sp This example shows how to log to a server using \s-1POST\s0 and then proceed to download the desired pages, presumably only accessible to authorized users: .Sp .Vb 4 \& # Log in to the server. This can be done only once. \& wget \-\-save\-cookies cookies.txt \e \& \-\-post\-data 'user=foo&password=bar' \e \& http://server.com/auth.php .Ve .Sp .Vb 3 \& # Now grab the page or pages we care about. \& wget \-\-load\-cookies cookies.txt \e \& \-p http://server.com/interesting/article.php .Ve .Sp If the server is using session cookies to track user authentication, the above will not work because \fB\-\-save\-cookies\fR will not save them (and neither will browsers) and the \fIcookies.txt\fR file will be empty. In that case use \fB\-\-keep\-session\-cookies\fR along with \&\fB\-\-save\-cookies\fR to force saving of session cookies. .IP "\fB\-\-content\-disposition\fR" 4 .IX Item "--content-disposition" If this is set to on, experimental (not fully\-functional) support for \&\f(CW\*(C`Content\-Disposition\*(C'\fR headers is enabled. This can currently result in extra round-trips to the server for a \f(CW\*(C`HEAD\*(C'\fR request, and is known to suffer from a few bugs, which is why it is not currently enabled by default. .Sp This option is useful for some file-downloading \s-1CGI\s0 programs that use \&\f(CW\*(C`Content\-Disposition\*(C'\fR headers to describe what the name of a downloaded file should be. .Sh "\s-1HTTPS\s0 (\s-1SSL/TLS\s0) Options" .IX Subsection "HTTPS (SSL/TLS) Options" To support encrypted \s-1HTTP\s0 (\s-1HTTPS\s0) downloads, Wget must be compiled with an external \s-1SSL\s0 library, currently OpenSSL. If Wget is compiled without \s-1SSL\s0 support, none of these options are available. .IP "\fB\-\-secure\-protocol=\fR\fIprotocol\fR" 4 .IX Item "--secure-protocol=protocol" Choose the secure protocol to be used. Legal values are \fBauto\fR, \&\fBSSLv2\fR, \fBSSLv3\fR, and \fBTLSv1\fR. If \fBauto\fR is used, the \s-1SSL\s0 library is given the liberty of choosing the appropriate protocol automatically, which is achieved by sending an SSLv2 greeting and announcing support for SSLv3 and TLSv1. This is the default. .Sp Specifying \fBSSLv2\fR, \fBSSLv3\fR, or \fBTLSv1\fR forces the use of the corresponding protocol. This is useful when talking to old and buggy \s-1SSL\s0 server implementations that make it hard for OpenSSL to choose the correct protocol version. Fortunately, such servers are quite rare. .IP "\fB\-\-no\-check\-certificate\fR" 4 .IX Item "--no-check-certificate" Don't check the server certificate against the available certificate authorities. Also don't require the \s-1URL\s0 host name to match the common name presented by the certificate. .Sp As of Wget 1.10, the default is to verify the server's certificate against the recognized certificate authorities, breaking the \s-1SSL\s0 handshake and aborting the download if the verification fails. Although this provides more secure downloads, it does break interoperability with some sites that worked with previous Wget versions, particularly those using self\-signed, expired, or otherwise invalid certificates. This option forces an \*(L"insecure\*(R" mode of operation that turns the certificate verification errors into warnings and allows you to proceed. .Sp If you encounter \*(L"certificate verification\*(R" errors or ones saying that \*(L"common name doesn't match requested host name\*(R", you can use this option to bypass the verification and proceed with the download. \&\fIOnly use this option if you are otherwise convinced of the site's authenticity, or if you really don't care about the validity of its certificate.\fR It is almost always a bad idea not to check the certificates when transmitting confidential or important data. .IP "\fB\-\-certificate=\fR\fIfile\fR" 4 .IX Item "--certificate=file" Use the client certificate stored in \fIfile\fR. This is needed for servers that are configured to require certificates from the clients that connect to them. Normally a certificate is not required and this switch is optional. .IP "\fB\-\-certificate\-type=\fR\fItype\fR" 4 .IX Item "--certificate-type=type" Specify the type of the client certificate. Legal values are \&\fB\s-1PEM\s0\fR (assumed by default) and \fB\s-1DER\s0\fR, also known as \&\fB\s-1ASN1\s0\fR. .IP "\fB\-\-private\-key=\fR\fIfile\fR" 4 .IX Item "--private-key=file" Read the private key from \fIfile\fR. This allows you to provide the private key in a file separate from the certificate. .IP "\fB\-\-private\-key\-type=\fR\fItype\fR" 4 .IX Item "--private-key-type=type" Specify the type of the private key. Accepted values are \fB\s-1PEM\s0\fR (the default) and \fB\s-1DER\s0\fR. .IP "\fB\-\-ca\-certificate=\fR\fIfile\fR" 4 .IX Item "--ca-certificate=file" Use \fIfile\fR as the file with the bundle of certificate authorities (\*(L"\s-1CA\s0\*(R") to verify the peers. The certificates must be in \s-1PEM\s0 format. .Sp Without this option Wget looks for \s-1CA\s0 certificates at the system-specified locations, chosen at OpenSSL installation time. .IP "\fB\-\-ca\-directory=\fR\fIdirectory\fR" 4 .IX Item "--ca-directory=directory" Specifies directory containing \s-1CA\s0 certificates in \s-1PEM\s0 format. Each file contains one \s-1CA\s0 certificate, and the file name is based on a hash value derived from the certificate. This is achieved by processing a certificate directory with the \f(CW\*(C`c_rehash\*(C'\fR utility supplied with OpenSSL. Using \fB\-\-ca\-directory\fR is more efficient than \&\fB\-\-ca\-certificate\fR when many certificates are installed because it allows Wget to fetch certificates on demand. .Sp Without this option Wget looks for \s-1CA\s0 certificates at the system-specified locations, chosen at OpenSSL installation time. .IP "\fB\-\-random\-file=\fR\fIfile\fR" 4 .IX Item "--random-file=file" Use \fIfile\fR as the source of random data for seeding the pseudo-random number generator on systems without \fI/dev/random\fR. .Sp On such systems the \s-1SSL\s0 library needs an external source of randomness to initialize. Randomness may be provided by \s-1EGD\s0 (see \&\fB\-\-egd\-file\fR below) or read from an external source specified by the user. If this option is not specified, Wget looks for random data in \f(CW$RANDFILE\fR or, if that is unset, in \fI$HOME/.rnd\fR. If none of those are available, it is likely that \s-1SSL\s0 encryption will not be usable. .Sp If you're getting the \*(L"Could not seed OpenSSL \s-1PRNG\s0; disabling \s-1SSL\s0.\*(R" error, you should provide random data using some of the methods described above. .IP "\fB\-\-egd\-file=\fR\fIfile\fR" 4 .IX Item "--egd-file=file" Use \fIfile\fR as the \s-1EGD\s0 socket. \s-1EGD\s0 stands for \fIEntropy Gathering Daemon\fR, a user-space program that collects data from various unpredictable system sources and makes it available to other programs that might need it. Encryption software, such as the \s-1SSL\s0 library, needs sources of non-repeating randomness to seed the random number generator used to produce cryptographically strong keys. .Sp OpenSSL allows the user to specify his own source of entropy using the \&\f(CW\*(C`RAND_FILE\*(C'\fR environment variable. If this variable is unset, or if the specified file does not produce enough randomness, OpenSSL will read random data from \s-1EGD\s0 socket specified using this option. .Sp If this option is not specified (and the equivalent startup command is not used), \s-1EGD\s0 is never contacted. \s-1EGD\s0 is not needed on modern Unix systems that support \fI/dev/random\fR. .Sh "\s-1FTP\s0 Options" .IX Subsection "FTP Options" .IP "\fB\-\-ftp\-user=\fR\fIuser\fR" 4 .IX Item "--ftp-user=user" .PD 0 .IP "\fB\-\-ftp\-password=\fR\fIpassword\fR" 4 .IX Item "--ftp-password=password" .PD Specify the username \fIuser\fR and password \fIpassword\fR on an \&\s-1FTP\s0 server. Without this, or the corresponding startup option, the password defaults to \fB\-wget@\fR, normally used for anonymous \&\s-1FTP\s0. .Sp Another way to specify username and password is in the \s-1URL\s0 itself. Either method reveals your password to anyone who bothers to run \f(CW\*(C`ps\*(C'\fR. To prevent the passwords from being seen, store them in \fI.wgetrc\fR or \fI.netrc\fR, and make sure to protect those files from other users with \f(CW\*(C`chmod\*(C'\fR. If the passwords are really important, do not leave them lying in those files either\-\-\-edit the files and delete them after Wget has started the download. .IP "\fB\-\-no\-remove\-listing\fR" 4 .IX Item "--no-remove-listing" Don't remove the temporary \fI.listing\fR files generated by \s-1FTP\s0 retrievals. Normally, these files contain the raw directory listings received from \s-1FTP\s0 servers. Not removing them can be useful for debugging purposes, or when you want to be able to easily check on the contents of remote server directories (e.g. to verify that a mirror you're running is complete). .Sp Note that even though Wget writes to a known filename for this file, this is not a security hole in the scenario of a user making \&\fI.listing\fR a symbolic link to \fI/etc/passwd\fR or something and asking \f(CW\*(C`root\*(C'\fR to run Wget in his or her directory. Depending on the options used, either Wget will refuse to write to \fI.listing\fR, making the globbing/recursion/time\-stamping operation fail, or the symbolic link will be deleted and replaced with the actual \&\fI.listing\fR file, or the listing will be written to a \&\fI.listing.\fInumber\fI\fR file. .Sp Even though this situation isn't a problem, though, \f(CW\*(C`root\*(C'\fR should never run Wget in a non-trusted user's directory. A user could do something as simple as linking \fIindex.html\fR to \fI/etc/passwd\fR and asking \f(CW\*(C`root\*(C'\fR to run Wget with \fB\-N\fR or \fB\-r\fR so the file will be overwritten. .IP "\fB\-\-no\-glob\fR" 4 .IX Item "--no-glob" Turn off \s-1FTP\s0 globbing. Globbing refers to the use of shell-like special characters (\fIwildcards\fR), like \fB*\fR, \fB?\fR, \fB[\fR and \fB]\fR to retrieve more than one file from the same directory at once, like: .Sp .Vb 1 \& wget ftp://gnjilux.srk.fer.hr/*.msg .Ve .Sp By default, globbing will be turned on if the \s-1URL\s0 contains a globbing character. This option may be used to turn globbing on or off permanently. .Sp You may have to quote the \s-1URL\s0 to protect it from being expanded by your shell. Globbing makes Wget look for a directory listing, which is system\-specific. This is why it currently works only with Unix \s-1FTP\s0 servers (and the ones emulating Unix \f(CW\*(C`ls\*(C'\fR output). .IP "\fB\-\-no\-passive\-ftp\fR" 4 .IX Item "--no-passive-ftp" Disable the use of the \fIpassive\fR \s-1FTP\s0 transfer mode. Passive \s-1FTP\s0 mandates that the client connect to the server to establish the data connection rather than the other way around. .Sp If the machine is connected to the Internet directly, both passive and active \s-1FTP\s0 should work equally well. Behind most firewall and \s-1NAT\s0 configurations passive \s-1FTP\s0 has a better chance of working. However, in some rare firewall configurations, active \s-1FTP\s0 actually works when passive \s-1FTP\s0 doesn't. If you suspect this to be the case, use this option, or set \f(CW\*(C`passive_ftp=off\*(C'\fR in your init file. .IP "\fB\-\-retr\-symlinks\fR" 4 .IX Item "--retr-symlinks" Usually, when retrieving \s-1FTP\s0 directories recursively and a symbolic link is encountered, the linked-to file is not downloaded. Instead, a matching symbolic link is created on the local filesystem. The pointed-to file will not be downloaded unless this recursive retrieval would have encountered it separately and downloaded it anyway. .Sp When \fB\-\-retr\-symlinks\fR is specified, however, symbolic links are traversed and the pointed-to files are retrieved. At this time, this option does not cause Wget to traverse symlinks to directories and recurse through them, but in the future it should be enhanced to do this. .Sp Note that when retrieving a file (not a directory) because it was specified on the command\-line, rather than because it was recursed to, this option has no effect. Symbolic links are always traversed in this case. .IP "\fB\-\-no\-http\-keep\-alive\fR" 4 .IX Item "--no-http-keep-alive" Turn off the \*(L"keep\-alive\*(R" feature for \s-1HTTP\s0 downloads. Normally, Wget asks the server to keep the connection open so that, when you download more than one document from the same server, they get transferred over the same \s-1TCP\s0 connection. This saves time and at the same time reduces the load on the server. .Sp This option is useful when, for some reason, persistent (keep\-alive) connections don't work for you, for example due to a server bug or due to the inability of server-side scripts to cope with the connections. .Sh "Recursive Retrieval Options" .IX Subsection "Recursive Retrieval Options" .IP "\fB\-r\fR" 4 .IX Item "-r" .PD 0 .IP "\fB\-\-recursive\fR" 4 .IX Item "--recursive" .PD Turn on recursive retrieving. .IP "\fB\-l\fR \fIdepth\fR" 4 .IX Item "-l depth" .PD 0 .IP "\fB\-\-level=\fR\fIdepth\fR" 4 .IX Item "--level=depth" .PD Specify recursion maximum depth level \fIdepth\fR. The default maximum depth is 5. .IP "\fB\-\-delete\-after\fR" 4 .IX Item "--delete-after" This option tells Wget to delete every single file it downloads, \&\fIafter\fR having done so. It is useful for pre-fetching popular pages through a proxy, e.g.: .Sp .Vb 1 \& wget \-r \-nd \-\-delete\-after http://whatever.com/~popular/page/ .Ve .Sp The \fB\-r\fR option is to retrieve recursively, and \fB\-nd\fR to not create directories. .Sp Note that \fB\-\-delete\-after\fR deletes files on the local machine. It does not issue the \fB\s-1DELE\s0\fR command to remote \s-1FTP\s0 sites, for instance. Also note that when \fB\-\-delete\-after\fR is specified, \&\fB\-\-convert\-links\fR is ignored, so \fB.orig\fR files are simply not created in the first place. .IP "\fB\-k\fR" 4 .IX Item "-k" .PD 0 .IP "\fB\-\-convert\-links\fR" 4 .IX Item "--convert-links" .PD After the download is complete, convert the links in the document to make them suitable for local viewing. This affects not only the visible hyperlinks, but any part of the document that links to external content, such as embedded images, links to style sheets, hyperlinks to non-HTML content, etc. .Sp Each link will be changed in one of the two ways: .RS 4 .IP "*" 4 The links to files that have been downloaded by Wget will be changed to refer to the file they point to as a relative link. .Sp Example: if the downloaded file \fI/foo/doc.html\fR links to \&\fI/bar/img.gif\fR, also downloaded, then the link in \fIdoc.html\fR will be modified to point to \fB../bar/img.gif\fR. This kind of transformation works reliably for arbitrary combinations of directories. .IP "*" 4 The links to files that have not been downloaded by Wget will be changed to include host name and absolute path of the location they point to. .Sp Example: if the downloaded file \fI/foo/doc.html\fR links to \&\fI/bar/img.gif\fR (or to \fI../bar/img.gif\fR), then the link in \&\fIdoc.html\fR will be modified to point to \&\fIhttp://\fIhostname\fI/bar/img.gif\fR. .RE .RS 4 .Sp Because of this, local browsing works reliably: if a linked file was downloaded, the link will refer to its local name; if it was not downloaded, the link will refer to its full Internet address rather than presenting a broken link. The fact that the former links are converted to relative links ensures that you can move the downloaded hierarchy to another directory. .Sp Note that only at the end of the download can Wget know which links have been downloaded. Because of that, the work done by \fB\-k\fR will be performed at the end of all the downloads. .RE .IP "\fB\-K\fR" 4 .IX Item "-K" .PD 0 .IP "\fB\-\-backup\-converted\fR" 4 .IX Item "--backup-converted" .PD When converting a file, back up the original version with a \fB.orig\fR suffix. Affects the behavior of \fB\-N\fR. .IP "\fB\-m\fR" 4 .IX Item "-m" .PD 0 .IP "\fB\-\-mirror\fR" 4 .IX Item "--mirror" .PD Turn on options suitable for mirroring. This option turns on recursion and time\-stamping, sets infinite recursion depth and keeps \s-1FTP\s0 directory listings. It is currently equivalent to \&\fB\-r \-N \-l inf \-\-no\-remove\-listing\fR. .IP "\fB\-p\fR" 4 .IX Item "-p" .PD 0 .IP "\fB\-\-page\-requisites\fR" 4 .IX Item "--page-requisites" .PD This option causes Wget to download all the files that are necessary to properly display a given \s-1HTML\s0 page. This includes such things as inlined images, sounds, and referenced stylesheets. .Sp Ordinarily, when downloading a single \s-1HTML\s0 page, any requisite documents that may be needed to display it properly are not downloaded. Using \&\fB\-r\fR together with \fB\-l\fR can help, but since Wget does not ordinarily distinguish between external and inlined documents, one is generally left with \*(L"leaf documents\*(R" that are missing their requisites. .Sp For instance, say document \fI1.html\fR contains an \f(CW\*(C`\*(C'\fR tag referencing \fI1.gif\fR and an \f(CW\*(C`\*(C'\fR tag pointing to external document \fI2.html\fR. Say that \fI2.html\fR is similar but that its image is \fI2.gif\fR and it links to \fI3.html\fR. Say this continues up to some arbitrarily high number. .Sp If one executes the command: .Sp .Vb 1 \& wget \-r \-l 2 http:///1.html .Ve .Sp then \fI1.html\fR, \fI1.gif\fR, \fI2.html\fR, \fI2.gif\fR, and \&\fI3.html\fR will be downloaded. As you can see, \fI3.html\fR is without its requisite \fI3.gif\fR because Wget is simply counting the number of hops (up to 2) away from \fI1.html\fR in order to determine where to stop the recursion. However, with this command: .Sp .Vb 1 \& wget \-r \-l 2 \-p http:///1.html .Ve .Sp all the above files \fIand\fR \fI3.html\fR's requisite \fI3.gif\fR will be downloaded. Similarly, .Sp .Vb 1 \& wget \-r \-l 1 \-p http:///1.html .Ve .Sp will cause \fI1.html\fR, \fI1.gif\fR, \fI2.html\fR, and \fI2.gif\fR to be downloaded. One might think that: .Sp .Vb 1 \& wget \-r \-l 0 \-p http:///1.html .Ve .Sp would download just \fI1.html\fR and \fI1.gif\fR, but unfortunately this is not the case, because \fB\-l 0\fR is equivalent to \&\fB\-l inf\fR\-\-\-that is, infinite recursion. To download a single \s-1HTML\s0 page (or a handful of them, all specified on the command-line or in a \&\fB\-i\fR \s-1URL\s0 input file) and its (or their) requisites, simply leave off \&\fB\-r\fR and \fB\-l\fR: .Sp .Vb 1 \& wget \-p http:///1.html .Ve .Sp Note that Wget will behave as if \fB\-r\fR had been specified, but only that single page and its requisites will be downloaded. Links from that page to external documents will not be followed. Actually, to download a single page and all its requisites (even if they exist on separate websites), and make sure the lot displays properly locally, this author likes to use a few options in addition to \fB\-p\fR: .Sp .Vb 1 \& wget \-E \-H \-k \-K \-p http:/// .Ve .Sp To finish off this topic, it's worth knowing that Wget's idea of an external document link is any \s-1URL\s0 specified in an \f(CW\*(C`\*(C'\fR tag, an \&\f(CW\*(C`\*(C'\fR tag, or a \f(CW\*(C`\*(C'\fR tag other than \f(CW\*(C`\*(C'\fR. .IP "\fB\-\-strict\-comments\fR" 4 .IX Item "--strict-comments" Turn on strict parsing of \s-1HTML\s0 comments. The default is to terminate comments at the first occurrence of \fB\-\->\fR. .Sp According to specifications, \s-1HTML\s0 comments are expressed as \s-1SGML\s0 \&\fIdeclarations\fR. Declaration is special markup that begins with \&\fB\fR, such as \fB\fR, that may contain comments between a pair of \fB\-\-\fR delimiters. \s-1HTML\s0 comments are \*(L"empty declarations\*(R", \s-1SGML\s0 declarations without any non-comment text. Therefore, \fB\fR is a valid comment, and so is \fB\fR, but \fB\fR is not. .Sp On the other hand, most \s-1HTML\s0 writers don't perceive comments as anything other than text delimited with \fB\fR, which is not quite the same. For example, something like \fB\fR works as a valid comment as long as the number of dashes is a multiple of four (!). If not, the comment technically lasts until the next \&\fB\-\-\fR, which may be at the other end of the document. Because of this, many popular browsers completely ignore the specification and implement what users have come to expect: comments delimited with \&\fB\fR. .Sp Until version 1.9, Wget interpreted comments strictly, which resulted in missing links in many web pages that displayed fine in browsers, but had the misfortune of containing non-compliant comments. Beginning with version 1.9, Wget has joined the ranks of clients that implements \&\*(L"naive\*(R" comments, terminating each comment at the first occurrence of \&\fB\-\->\fR. .Sp If, for whatever reason, you want strict comment parsing, use this option to turn it on. .Sh "Recursive Accept/Reject Options" .IX Subsection "Recursive Accept/Reject Options" .IP "\fB\-A\fR \fIacclist\fR \fB\-\-accept\fR \fIacclist\fR" 4 .IX Item "-A acclist --accept acclist" .PD 0 .IP "\fB\-R\fR \fIrejlist\fR \fB\-\-reject\fR \fIrejlist\fR" 4 .IX Item "-R rejlist --reject rejlist" .PD Specify comma-separated lists of file name suffixes or patterns to accept or reject. Note that if any of the wildcard characters, \fB*\fR, \fB?\fR, \fB[\fR or \&\fB]\fR, appear in an element of \fIacclist\fR or \fIrejlist\fR, it will be treated as a pattern, rather than a suffix. .IP "\fB\-D\fR \fIdomain-list\fR" 4 .IX Item "-D domain-list" .PD 0 .IP "\fB\-\-domains=\fR\fIdomain-list\fR" 4 .IX Item "--domains=domain-list" .PD Set domains to be followed. \fIdomain-list\fR is a comma-separated list of domains. Note that it does \fInot\fR turn on \fB\-H\fR. .IP "\fB\-\-exclude\-domains\fR \fIdomain-list\fR" 4 .IX Item "--exclude-domains domain-list" Specify the domains that are \fInot\fR to be followed.. .IP "\fB\-\-follow\-ftp\fR" 4 .IX Item "--follow-ftp" Follow \s-1FTP\s0 links from \s-1HTML\s0 documents. Without this option, Wget will ignore all the \s-1FTP\s0 links. .IP "\fB\-\-follow\-tags=\fR\fIlist\fR" 4 .IX Item "--follow-tags=list" Wget has an internal table of \s-1HTML\s0 tag / attribute pairs that it considers when looking for linked documents during a recursive retrieval. If a user wants only a subset of those tags to be considered, however, he or she should be specify such tags in a comma-separated \fIlist\fR with this option. .IP "\fB\-\-ignore\-tags=\fR\fIlist\fR" 4 .IX Item "--ignore-tags=list" This is the opposite of the \fB\-\-follow\-tags\fR option. To skip certain \s-1HTML\s0 tags when recursively looking for documents to download, specify them in a comma-separated \fIlist\fR. .Sp In the past, this option was the best bet for downloading a single page and its requisites, using a command-line like: .Sp .Vb 1 \& wget \-\-ignore\-tags=a,area \-H \-k \-K \-r http:/// .Ve .Sp However, the author of this option came across a page with tags like \&\f(CW\*(C`\*(C'\fR and came to the realization that specifying tags to ignore was not enough. One can't just tell Wget to ignore \f(CW\*(C`\*(C'\fR, because then stylesheets will not be downloaded. Now the best bet for downloading a single page and its requisites is the dedicated \fB\-\-page\-requisites\fR option. .IP "\fB\-\-ignore\-case\fR" 4 .IX Item "--ignore-case" Ignore case when matching files and directories. This influences the behavior of \-R, \-A, \-I, and \-X options, as well as globbing implemented when downloading from \s-1FTP\s0 sites. For example, with this option, \fB\-A *.txt\fR will match \fBfile1.txt\fR, but also \&\fBfile2.TXT\fR, \fBfile3.TxT\fR, and so on. .IP "\fB\-H\fR" 4 .IX Item "-H" .PD 0 .IP "\fB\-\-span\-hosts\fR" 4 .IX Item "--span-hosts" .PD Enable spanning across hosts when doing recursive retrieving. .IP "\fB\-L\fR" 4 .IX Item "-L" .PD 0 .IP "\fB\-\-relative\fR" 4 .IX Item "--relative" .PD Follow relative links only. Useful for retrieving a specific home page without any distractions, not even those from the same hosts. .IP "\fB\-I\fR \fIlist\fR" 4 .IX Item "-I list" .PD 0 .IP "\fB\-\-include\-directories=\fR\fIlist\fR" 4 .IX Item "--include-directories=list" .PD Specify a comma-separated list of directories you wish to follow when downloading. Elements of \fIlist\fR may contain wildcards. .IP "\fB\-X\fR \fIlist\fR" 4 .IX Item "-X list" .PD 0 .IP "\fB\-\-exclude\-directories=\fR\fIlist\fR" 4 .IX Item "--exclude-directories=list" .PD Specify a comma-separated list of directories you wish to exclude from download. Elements of \&\fIlist\fR may contain wildcards. .IP "\fB\-np\fR" 4 .IX Item "-np" .PD 0 .IP "\fB\-\-no\-parent\fR" 4 .IX Item "--no-parent" .PD Do not ever ascend to the parent directory when retrieving recursively. This is a useful option, since it guarantees that only the files \&\fIbelow\fR a certain hierarchy will be downloaded. .SH "FILES" .IX Header "FILES" .IP "\fB/usr/local/etc/wgetrc\fR" 4 .IX Item "/usr/local/etc/wgetrc" Default location of the \fIglobal\fR startup file. .IP "\fB.wgetrc\fR" 4 .IX Item ".wgetrc" User startup file. .SH "BUGS" .IX Header "BUGS" You are welcome to submit bug reports via the \s-1GNU\s0 Wget bug tracker (see <\fBhttp://wget.addictivecode.org/BugTracker\fR>). .PP Before actually submitting a bug report, please try to follow a few simple guidelines. .IP "1." 4 Please try to ascertain that the behavior you see really is a bug. If Wget crashes, it's a bug. If Wget does not behave as documented, it's a bug. If things work strange, but you are not sure about the way they are supposed to work, it might well be a bug, but you might want to double-check the documentation and the mailing lists. .IP "2." 4 Try to repeat the bug in as simple circumstances as possible. E.g. if Wget crashes while downloading \fBwget \-rl0 \-kKE \-t5 \-\-no\-proxy http://yoyodyne.com \-o /tmp/log\fR, you should try to see if the crash is repeatable, and if will occur with a simpler set of options. You might even try to start the download at the page where the crash occurred to see if that page somehow triggered the crash. .Sp Also, while I will probably be interested to know the contents of your \&\fI.wgetrc\fR file, just dumping it into the debug message is probably a bad idea. Instead, you should first try to see if the bug repeats with \fI.wgetrc\fR moved out of the way. Only if it turns out that \&\fI.wgetrc\fR settings affect the bug, mail me the relevant parts of the file. .IP "3." 4 Please start Wget with \fB\-d\fR option and send us the resulting output (or relevant parts thereof). If Wget was compiled without debug support, recompile it\-\-\-it is \fImuch\fR easier to trace bugs with debug support on. .Sp Note: please make sure to remove any potentially sensitive information from the debug log before sending it to the bug address. The \&\f(CW\*(C`\-d\*(C'\fR won't go out of its way to collect sensitive information, but the log \fIwill\fR contain a fairly complete transcript of Wget's communication with the server, which may include passwords and pieces of downloaded data. Since the bug address is publically archived, you may assume that all bug reports are visible to the public. .IP "4." 4 If Wget has crashed, try to run it in a debugger, e.g. \f(CW\*(C`gdb `which wget` core\*(C'\fR and type \f(CW\*(C`where\*(C'\fR to get the backtrace. This may not work if the system administrator has disabled core files, but it is safe to try. .SH "SEE ALSO" .IX Header "SEE ALSO" This is \fBnot\fR the complete manual for \s-1GNU\s0 Wget. For more complete information, including more detailed explanations of some of the options, and a number of commands available for use with \fI.wgetrc\fR files and the \fB\-e\fR option, see the \s-1GNU\s0 Info entry for \fIwget\fR. .SH "AUTHOR" .IX Header "AUTHOR" Originally written by Hrvoje Niksic . Currently maintained by Micah Cowan . .SH "COPYRIGHT" .IX Header "COPYRIGHT" Copyright (c) 1996\-\-2008 Free Software Foundation, Inc. .PP Permission is granted to make and distribute verbatim copies of this manual provided the copyright notice and this permission notice are preserved on all copies. .PP Permission is granted to copy, distribute and/or modify this document under the terms of the \s-1GNU\s0 Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled \*(L"\s-1GNU\s0 Free Documentation License\*(R". packages/wget/1.11/share/info/0000755000175200017520000000000011517102173015655 5ustar tyndurtyndurpackages/wget/1.11/share/info/wget.info0000644000175200017520000054523411517102173017515 0ustar tyndurtyndurThis is wget.info, produced by makeinfo version 4.11 from ./wget.texi. INFO-DIR-SECTION Network Applications START-INFO-DIR-ENTRY * Wget: (wget). The non-interactive network downloader. END-INFO-DIR-ENTRY This file documents the GNU Wget utility for downloading network data. Copyright (C) 1996-2008 Free Software Foundation, Inc. Permission is granted to make and distribute verbatim copies of this manual provided the copyright notice and this permission notice are preserved on all copies. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License".  File: wget.info, Node: Top, Next: Overview, Up: (dir) Wget 1.11 ********* This manual documents version 1.11 of GNU Wget, the freely available utility for network downloads. Copyright (C) 1996-2008 Free Software Foundation, Inc. * Menu: * Overview:: Features of Wget. * Invoking:: Wget command-line arguments. * Recursive Download:: Downloading interlinked pages. * Following Links:: The available methods of chasing links. * Time-Stamping:: Mirroring according to time-stamps. * Startup File:: Wget's initialization file. * Examples:: Examples of usage. * Various:: The stuff that doesn't fit anywhere else. * Appendices:: Some useful references. * Copying this manual:: You may give out copies of Wget and of this manual. * Concept Index:: Topics covered by this manual.  File: wget.info, Node: Overview, Next: Invoking, Prev: Top, Up: Top 1 Overview ********** GNU Wget is a free utility for non-interactive download of files from the Web. It supports HTTP, HTTPS, and FTP protocols, as well as retrieval through HTTP proxies. This chapter is a partial overview of Wget's features. * Wget is non-interactive, meaning that it can work in the background, while the user is not logged on. This allows you to start a retrieval and disconnect from the system, letting Wget finish the work. By contrast, most of the Web browsers require constant user's presence, which can be a great hindrance when transferring a lot of data. * Wget can follow links in HTML and XHTML pages and create local versions of remote web sites, fully recreating the directory structure of the original site. This is sometimes referred to as "recursive downloading." While doing that, Wget respects the Robot Exclusion Standard (`/robots.txt'). Wget can be instructed to convert the links in downloaded HTML files to the local files for offline viewing. * File name wildcard matching and recursive mirroring of directories are available when retrieving via FTP. Wget can read the time-stamp information given by both HTTP and FTP servers, and store it locally. Thus Wget can see if the remote file has changed since last retrieval, and automatically retrieve the new version if it has. This makes Wget suitable for mirroring of FTP sites, as well as home pages. * Wget has been designed for robustness over slow or unstable network connections; if a download fails due to a network problem, it will keep retrying until the whole file has been retrieved. If the server supports regetting, it will instruct the server to continue the download from where it left off. * Wget supports proxy servers, which can lighten the network load, speed up retrieval and provide access behind firewalls. However, if you are behind a firewall that requires that you use a socks style gateway, you can get the socks library and build Wget with support for socks. Wget uses the passive FTP downloading by default, active FTP being an option. * Wget supports IP version 6, the next generation of IP. IPv6 is autodetected at compile-time, and can be disabled at either build or run time. Binaries built with IPv6 support work well in both IPv4-only and dual family environments. * Built-in features offer mechanisms to tune which links you wish to follow (*note Following Links::). * The progress of individual downloads is traced using a progress gauge. Interactive downloads are tracked using a "thermometer"-style gauge, whereas non-interactive ones are traced with dots, each dot representing a fixed amount of data received (1KB by default). Either gauge can be customized to your preferences. * Most of the features are fully configurable, either through command line options, or via the initialization file `.wgetrc' (*note Startup File::). Wget allows you to define "global" startup files (`/usr/local/etc/wgetrc' by default) for site settings. * Finally, GNU Wget is free software. This means that everyone may use it, redistribute it and/or modify it under the terms of the GNU General Public License, as published by the Free Software Foundation (see the file `COPYING' that came with GNU Wget, for details).  File: wget.info, Node: Invoking, Next: Recursive Download, Prev: Overview, Up: Top 2 Invoking ********** By default, Wget is very simple to invoke. The basic syntax is: wget [OPTION]... [URL]... Wget will simply download all the URLs specified on the command line. URL is a "Uniform Resource Locator", as defined below. However, you may wish to change some of the default parameters of Wget. You can do it two ways: permanently, adding the appropriate command to `.wgetrc' (*note Startup File::), or specifying it on the command line. * Menu: * URL Format:: * Option Syntax:: * Basic Startup Options:: * Logging and Input File Options:: * Download Options:: * Directory Options:: * HTTP Options:: * HTTPS (SSL/TLS) Options:: * FTP Options:: * Recursive Retrieval Options:: * Recursive Accept/Reject Options::  File: wget.info, Node: URL Format, Next: Option Syntax, Up: Invoking 2.1 URL Format ============== "URL" is an acronym for Uniform Resource Locator. A uniform resource locator is a compact string representation for a resource available via the Internet. Wget recognizes the URL syntax as per RFC1738. This is the most widely used form (square brackets denote optional parts): http://host[:port]/directory/file ftp://host[:port]/directory/file You can also encode your username and password within a URL: ftp://user:password@host/path http://user:password@host/path Either USER or PASSWORD, or both, may be left out. If you leave out either the HTTP username or password, no authentication will be sent. If you leave out the FTP username, `anonymous' will be used. If you leave out the FTP password, your email address will be supplied as a default password.(1) *Important Note*: if you specify a password-containing URL on the command line, the username and password will be plainly visible to all users on the system, by way of `ps'. On multi-user systems, this is a big security risk. To work around it, use `wget -i -' and feed the URLs to Wget's standard input, each on a separate line, terminated by `C-d'. You can encode unsafe characters in a URL as `%xy', `xy' being the hexadecimal representation of the character's ASCII value. Some common unsafe characters include `%' (quoted as `%25'), `:' (quoted as `%3A'), and `@' (quoted as `%40'). Refer to RFC1738 for a comprehensive list of unsafe characters. Wget also supports the `type' feature for FTP URLs. By default, FTP documents are retrieved in the binary mode (type `i'), which means that they are downloaded unchanged. Another useful mode is the `a' ("ASCII") mode, which converts the line delimiters between the different operating systems, and is thus useful for text files. Here is an example: ftp://host/directory/file;type=a Two alternative variants of URL specification are also supported, because of historical (hysterical?) reasons and their widespreaded use. FTP-only syntax (supported by `NcFTP'): host:/dir/file HTTP-only syntax (introduced by `Netscape'): host[:port]/dir/file These two alternative forms are deprecated, and may cease being supported in the future. If you do not understand the difference between these notations, or do not know which one to use, just use the plain ordinary format you use with your favorite browser, like `Lynx' or `Netscape'. ---------- Footnotes ---------- (1) If you have a `.netrc' file in your home directory, password will also be searched for there.  File: wget.info, Node: Option Syntax, Next: Basic Startup Options, Prev: URL Format, Up: Invoking 2.2 Option Syntax ================= Since Wget uses GNU getopt to process command-line arguments, every option has a long form along with the short one. Long options are more convenient to remember, but take time to type. You may freely mix different option styles, or specify options after the command-line arguments. Thus you may write: wget -r --tries=10 http://fly.srk.fer.hr/ -o log The space between the option accepting an argument and the argument may be omitted. Instead of `-o log' you can write `-olog'. You may put several options that do not require arguments together, like: wget -drc URL This is a complete equivalent of: wget -d -r -c URL Since the options can be specified after the arguments, you may terminate them with `--'. So the following will try to download URL `-x', reporting failure to `log': wget -o log -- -x The options that accept comma-separated lists all respect the convention that specifying an empty list clears its value. This can be useful to clear the `.wgetrc' settings. For instance, if your `.wgetrc' sets `exclude_directories' to `/cgi-bin', the following example will first reset it, and then set it to exclude `/~nobody' and `/~somebody'. You can also clear the lists in `.wgetrc' (*note Wgetrc Syntax::). wget -X '' -X /~nobody,/~somebody Most options that do not accept arguments are "boolean" options, so named because their state can be captured with a yes-or-no ("boolean") variable. For example, `--follow-ftp' tells Wget to follow FTP links from HTML files and, on the other hand, `--no-glob' tells it not to perform file globbing on FTP URLs. A boolean option is either "affirmative" or "negative" (beginning with `--no'). All such options share several properties. Unless stated otherwise, it is assumed that the default behavior is the opposite of what the option accomplishes. For example, the documented existence of `--follow-ftp' assumes that the default is to _not_ follow FTP links from HTML pages. Affirmative options can be negated by prepending the `--no-' to the option name; negative options can be negated by omitting the `--no-' prefix. This might seem superfluous--if the default for an affirmative option is to not do something, then why provide a way to explicitly turn it off? But the startup file may in fact change the default. For instance, using `follow_ftp = off' in `.wgetrc' makes Wget _not_ follow FTP links by default, and using `--no-follow-ftp' is the only way to restore the factory default from the command line.  File: wget.info, Node: Basic Startup Options, Next: Logging and Input File Options, Prev: Option Syntax, Up: Invoking 2.3 Basic Startup Options ========================= `-V' `--version' Display the version of Wget. `-h' `--help' Print a help message describing all of Wget's command-line options. `-b' `--background' Go to background immediately after startup. If no output file is specified via the `-o', output is redirected to `wget-log'. `-e COMMAND' `--execute COMMAND' Execute COMMAND as if it were a part of `.wgetrc' (*note Startup File::). A command thus invoked will be executed _after_ the commands in `.wgetrc', thus taking precedence over them. If you need to specify more than one wgetrc command, use multiple instances of `-e'.  File: wget.info, Node: Logging and Input File Options, Next: Download Options, Prev: Basic Startup Options, Up: Invoking 2.4 Logging and Input File Options ================================== `-o LOGFILE' `--output-file=LOGFILE' Log all messages to LOGFILE. The messages are normally reported to standard error. `-a LOGFILE' `--append-output=LOGFILE' Append to LOGFILE. This is the same as `-o', only it appends to LOGFILE instead of overwriting the old log file. If LOGFILE does not exist, a new file is created. `-d' `--debug' Turn on debug output, meaning various information important to the developers of Wget if it does not work properly. Your system administrator may have chosen to compile Wget without debug support, in which case `-d' will not work. Please note that compiling with debug support is always safe--Wget compiled with the debug support will _not_ print any debug info unless requested with `-d'. *Note Reporting Bugs::, for more information on how to use `-d' for sending bug reports. `-q' `--quiet' Turn off Wget's output. `-v' `--verbose' Turn on verbose output, with all the available data. The default output is verbose. `-nv' `--no-verbose' Turn off verbose without being completely quiet (use `-q' for that), which means that error messages and basic information still get printed. `-i FILE' `--input-file=FILE' Read URLs from FILE. If `-' is specified as FILE, URLs are read from the standard input. (Use `./-' to read from a file literally named `-'.) If this function is used, no URLs need be present on the command line. If there are URLs both on the command line and in an input file, those on the command lines will be the first ones to be retrieved. The FILE need not be an HTML document (but no harm if it is)--it is enough if the URLs are just listed sequentially. However, if you specify `--force-html', the document will be regarded as `html'. In that case you may have problems with relative links, which you can solve either by adding `' to the documents or by specifying `--base=URL' on the command line. `-F' `--force-html' When input is read from a file, force it to be treated as an HTML file. This enables you to retrieve relative links from existing HTML files on your local disk, by adding `' to HTML, or using the `--base' command-line option. `-B URL' `--base=URL' Prepends URL to relative links read from the file specified with the `-i' option.  File: wget.info, Node: Download Options, Next: Directory Options, Prev: Logging and Input File Options, Up: Invoking 2.5 Download Options ==================== `--bind-address=ADDRESS' When making client TCP/IP connections, bind to ADDRESS on the local machine. ADDRESS may be specified as a hostname or IP address. This option can be useful if your machine is bound to multiple IPs. `-t NUMBER' `--tries=NUMBER' Set number of retries to NUMBER. Specify 0 or `inf' for infinite retrying. The default is to retry 20 times, with the exception of fatal errors like "connection refused" or "not found" (404), which are not retried. `-O FILE' `--output-document=FILE' The documents will not be written to the appropriate files, but all will be concatenated together and written to FILE. If `-' is used as FILE, documents will be printed to standard output, disabling link conversion. (Use `./-' to print to a file literally named `-'.) Use of `-O' is _not_ intended to mean simply "use the name FILE instead of the one in the URL;" rather, it is analogous to shell redirection: `wget -O file http://foo' is intended to work like `wget -O - http://foo > file'; `file' will be truncated immediately, and _all_ downloaded content will be written there. Note that a combination with `-k' is only permitted when downloading a single document, and combination with any of `-r', `-p', or `-N' is not allowed. `-nc' `--no-clobber' If a file is downloaded more than once in the same directory, Wget's behavior depends on a few options, including `-nc'. In certain cases, the local file will be "clobbered", or overwritten, upon repeated download. In other cases it will be preserved. When running Wget without `-N', `-nc', `-r', or `p', downloading the same file in the same directory will result in the original copy of FILE being preserved and the second copy being named `FILE.1'. If that file is downloaded yet again, the third copy will be named `FILE.2', and so on. When `-nc' is specified, this behavior is suppressed, and Wget will refuse to download newer copies of `FILE'. Therefore, "`no-clobber'" is actually a misnomer in this mode--it's not clobbering that's prevented (as the numeric suffixes were already preventing clobbering), but rather the multiple version saving that's prevented. When running Wget with `-r' or `-p', but without `-N' or `-nc', re-downloading a file will result in the new copy simply overwriting the old. Adding `-nc' will prevent this behavior, instead causing the original version to be preserved and any newer copies on the server to be ignored. When running Wget with `-N', with or without `-r' or `-p', the decision as to whether or not to download a newer copy of a file depends on the local and remote timestamp and size of the file (*note Time-Stamping::). `-nc' may not be specified at the same time as `-N'. Note that when `-nc' is specified, files with the suffixes `.html' or `.htm' will be loaded from the local disk and parsed as if they had been retrieved from the Web. `-c' `--continue' Continue getting a partially-downloaded file. This is useful when you want to finish up a download started by a previous instance of Wget, or by another program. For instance: wget -c ftp://sunsite.doc.ic.ac.uk/ls-lR.Z If there is a file named `ls-lR.Z' in the current directory, Wget will assume that it is the first portion of the remote file, and will ask the server to continue the retrieval from an offset equal to the length of the local file. Note that you don't need to specify this option if you just want the current invocation of Wget to retry downloading a file should the connection be lost midway through. This is the default behavior. `-c' only affects resumption of downloads started _prior_ to this invocation of Wget, and whose local files are still sitting around. Without `-c', the previous example would just download the remote file to `ls-lR.Z.1', leaving the truncated `ls-lR.Z' file alone. Beginning with Wget 1.7, if you use `-c' on a non-empty file, and it turns out that the server does not support continued downloading, Wget will refuse to start the download from scratch, which would effectively ruin existing contents. If you really want the download to start from scratch, remove the file. Also beginning with Wget 1.7, if you use `-c' on a file which is of equal size as the one on the server, Wget will refuse to download the file and print an explanatory message. The same happens when the file is smaller on the server than locally (presumably because it was changed on the server since your last download attempt)--because "continuing" is not meaningful, no download occurs. On the other side of the coin, while using `-c', any file that's bigger on the server than locally will be considered an incomplete download and only `(length(remote) - length(local))' bytes will be downloaded and tacked onto the end of the local file. This behavior can be desirable in certain cases--for instance, you can use `wget -c' to download just the new portion that's been appended to a data collection or log file. However, if the file is bigger on the server because it's been _changed_, as opposed to just _appended_ to, you'll end up with a garbled file. Wget has no way of verifying that the local file is really a valid prefix of the remote file. You need to be especially careful of this when using `-c' in conjunction with `-r', since every file will be considered as an "incomplete download" candidate. Another instance where you'll get a garbled file if you try to use `-c' is if you have a lame HTTP proxy that inserts a "transfer interrupted" string into the local file. In the future a "rollback" option may be added to deal with this case. Note that `-c' only works with FTP servers and with HTTP servers that support the `Range' header. `--progress=TYPE' Select the type of the progress indicator you wish to use. Legal indicators are "dot" and "bar". The "bar" indicator is used by default. It draws an ASCII progress bar graphics (a.k.a "thermometer" display) indicating the status of retrieval. If the output is not a TTY, the "dot" bar will be used by default. Use `--progress=dot' to switch to the "dot" display. It traces the retrieval by printing dots on the screen, each dot representing a fixed amount of downloaded data. When using the dotted retrieval, you may also set the "style" by specifying the type as `dot:STYLE'. Different styles assign different meaning to one dot. With the `default' style each dot represents 1K, there are ten dots in a cluster and 50 dots in a line. The `binary' style has a more "computer"-like orientation--8K dots, 16-dots clusters and 48 dots per line (which makes for 384K lines). The `mega' style is suitable for downloading very large files--each dot represents 64K retrieved, there are eight dots in a cluster, and 48 dots on each line (so each line contains 3M). Note that you can set the default style using the `progress' command in `.wgetrc'. That setting may be overridden from the command line. The exception is that, when the output is not a TTY, the "dot" progress will be favored over "bar". To force the bar output, use `--progress=bar:force'. `-N' `--timestamping' Turn on time-stamping. *Note Time-Stamping::, for details. `-S' `--server-response' Print the headers sent by HTTP servers and responses sent by FTP servers. `--spider' When invoked with this option, Wget will behave as a Web "spider", which means that it will not download the pages, just check that they are there. For example, you can use Wget to check your bookmarks: wget --spider --force-html -i bookmarks.html This feature needs much more work for Wget to get close to the functionality of real web spiders. `-T seconds' `--timeout=SECONDS' Set the network timeout to SECONDS seconds. This is equivalent to specifying `--dns-timeout', `--connect-timeout', and `--read-timeout', all at the same time. When interacting with the network, Wget can check for timeout and abort the operation if it takes too long. This prevents anomalies like hanging reads and infinite connects. The only timeout enabled by default is a 900-second read timeout. Setting a timeout to 0 disables it altogether. Unless you know what you are doing, it is best not to change the default timeout settings. All timeout-related options accept decimal values, as well as subsecond values. For example, `0.1' seconds is a legal (though unwise) choice of timeout. Subsecond timeouts are useful for checking server response times or for testing network latency. `--dns-timeout=SECONDS' Set the DNS lookup timeout to SECONDS seconds. DNS lookups that don't complete within the specified time will fail. By default, there is no timeout on DNS lookups, other than that implemented by system libraries. `--connect-timeout=SECONDS' Set the connect timeout to SECONDS seconds. TCP connections that take longer to establish will be aborted. By default, there is no connect timeout, other than that implemented by system libraries. `--read-timeout=SECONDS' Set the read (and write) timeout to SECONDS seconds. The "time" of this timeout refers to "idle time": if, at any point in the download, no data is received for more than the specified number of seconds, reading fails and the download is restarted. This option does not directly affect the duration of the entire download. Of course, the remote server may choose to terminate the connection sooner than this option requires. The default read timeout is 900 seconds. `--limit-rate=AMOUNT' Limit the download speed to AMOUNT bytes per second. Amount may be expressed in bytes, kilobytes with the `k' suffix, or megabytes with the `m' suffix. For example, `--limit-rate=20k' will limit the retrieval rate to 20KB/s. This is useful when, for whatever reason, you don't want Wget to consume the entire available bandwidth. This option allows the use of decimal numbers, usually in conjunction with power suffixes; for example, `--limit-rate=2.5k' is a legal value. Note that Wget implements the limiting by sleeping the appropriate amount of time after a network read that took less time than specified by the rate. Eventually this strategy causes the TCP transfer to slow down to approximately the specified rate. However, it may take some time for this balance to be achieved, so don't be surprised if limiting the rate doesn't work well with very small files. `-w SECONDS' `--wait=SECONDS' Wait the specified number of seconds between the retrievals. Use of this option is recommended, as it lightens the server load by making the requests less frequent. Instead of in seconds, the time can be specified in minutes using the `m' suffix, in hours using `h' suffix, or in days using `d' suffix. Specifying a large value for this option is useful if the network or the destination host is down, so that Wget can wait long enough to reasonably expect the network error to be fixed before the retry. The waiting interval specified by this function is influenced by `--random-wait', which see. `--waitretry=SECONDS' If you don't want Wget to wait between _every_ retrieval, but only between retries of failed downloads, you can use this option. Wget will use "linear backoff", waiting 1 second after the first failure on a given file, then waiting 2 seconds after the second failure on that file, up to the maximum number of SECONDS you specify. Therefore, a value of 10 will actually make Wget wait up to (1 + 2 + ... + 10) = 55 seconds per file. Note that this option is turned on by default in the global `wgetrc' file. `--random-wait' Some web sites may perform log analysis to identify retrieval programs such as Wget by looking for statistically significant similarities in the time between requests. This option causes the time between requests to vary between 0.5 and 1.5 * WAIT seconds, where WAIT was specified using the `--wait' option, in order to mask Wget's presence from such analysis. A 2001 article in a publication devoted to development on a popular consumer platform provided code to perform this analysis on the fly. Its author suggested blocking at the class C address level to ensure automated retrieval programs were blocked despite changing DHCP-supplied addresses. The `--random-wait' option was inspired by this ill-advised recommendation to block many unrelated users from a web site due to the actions of one. `--no-proxy' Don't use proxies, even if the appropriate `*_proxy' environment variable is defined. For more information about the use of proxies with Wget, *Note Proxies::. `-Q QUOTA' `--quota=QUOTA' Specify download quota for automatic retrievals. The value can be specified in bytes (default), kilobytes (with `k' suffix), or megabytes (with `m' suffix). Note that quota will never affect downloading a single file. So if you specify `wget -Q10k ftp://wuarchive.wustl.edu/ls-lR.gz', all of the `ls-lR.gz' will be downloaded. The same goes even when several URLs are specified on the command-line. However, quota is respected when retrieving either recursively, or from an input file. Thus you may safely type `wget -Q2m -i sites'--download will be aborted when the quota is exceeded. Setting quota to 0 or to `inf' unlimits the download quota. `--no-dns-cache' Turn off caching of DNS lookups. Normally, Wget remembers the IP addresses it looked up from DNS so it doesn't have to repeatedly contact the DNS server for the same (typically small) set of hosts it retrieves from. This cache exists in memory only; a new Wget run will contact DNS again. However, it has been reported that in some situations it is not desirable to cache host names, even for the duration of a short-running application like Wget. With this option Wget issues a new DNS lookup (more precisely, a new call to `gethostbyname' or `getaddrinfo') each time it makes a new connection. Please note that this option will _not_ affect caching that might be performed by the resolving library or by an external caching layer, such as NSCD. If you don't understand exactly what this option does, you probably won't need it. `--restrict-file-names=MODE' Change which characters found in remote URLs may show up in local file names generated from those URLs. Characters that are "restricted" by this option are escaped, i.e. replaced with `%HH', where `HH' is the hexadecimal number that corresponds to the restricted character. By default, Wget escapes the characters that are not valid as part of file names on your operating system, as well as control characters that are typically unprintable. This option is useful for changing these defaults, either because you are downloading to a non-native partition, or because you want to disable escaping of the control characters. When mode is set to "unix", Wget escapes the character `/' and the control characters in the ranges 0-31 and 128-159. This is the default on Unix-like OS'es. When mode is set to "windows", Wget escapes the characters `\', `|', `/', `:', `?', `"', `*', `<', `>', and the control characters in the ranges 0-31 and 128-159. In addition to this, Wget in Windows mode uses `+' instead of `:' to separate host and port in local file names, and uses `@' instead of `?' to separate the query portion of the file name from the rest. Therefore, a URL that would be saved as `www.xemacs.org:4300/search.pl?input=blah' in Unix mode would be saved as `www.xemacs.org+4300/search.pl@input=blah' in Windows mode. This mode is the default on Windows. If you append `,nocontrol' to the mode, as in `unix,nocontrol', escaping of the control characters is also switched off. You can use `--restrict-file-names=nocontrol' to turn off escaping of control characters without affecting the choice of the OS to use as file name restriction mode. `-4' `--inet4-only' `-6' `--inet6-only' Force connecting to IPv4 or IPv6 addresses. With `--inet4-only' or `-4', Wget will only connect to IPv4 hosts, ignoring AAAA records in DNS, and refusing to connect to IPv6 addresses specified in URLs. Conversely, with `--inet6-only' or `-6', Wget will only connect to IPv6 hosts and ignore A records and IPv4 addresses. Neither options should be needed normally. By default, an IPv6-aware Wget will use the address family specified by the host's DNS record. If the DNS responds with both IPv4 and IPv6 addresses, Wget will try them in sequence until it finds one it can connect to. (Also see `--prefer-family' option described below.) These options can be used to deliberately force the use of IPv4 or IPv6 address families on dual family systems, usually to aid debugging or to deal with broken network configuration. Only one of `--inet6-only' and `--inet4-only' may be specified at the same time. Neither option is available in Wget compiled without IPv6 support. `--prefer-family=IPv4/IPv6/none' When given a choice of several addresses, connect to the addresses with specified address family first. IPv4 addresses are preferred by default. This avoids spurious errors and connect attempts when accessing hosts that resolve to both IPv6 and IPv4 addresses from IPv4 networks. For example, `www.kame.net' resolves to `2001:200:0:8002:203:47ff:fea5:3085' and to `203.178.141.194'. When the preferred family is `IPv4', the IPv4 address is used first; when the preferred family is `IPv6', the IPv6 address is used first; if the specified value is `none', the address order returned by DNS is used without change. Unlike `-4' and `-6', this option doesn't inhibit access to any address family, it only changes the _order_ in which the addresses are accessed. Also note that the reordering performed by this option is "stable"--it doesn't affect order of addresses of the same family. That is, the relative order of all IPv4 addresses and of all IPv6 addresses remains intact in all cases. `--retry-connrefused' Consider "connection refused" a transient error and try again. Normally Wget gives up on a URL when it is unable to connect to the site because failure to connect is taken as a sign that the server is not running at all and that retries would not help. This option is for mirroring unreliable sites whose servers tend to disappear for short periods of time. `--user=USER' `--password=PASSWORD' Specify the username USER and password PASSWORD for both FTP and HTTP file retrieval. These parameters can be overridden using the `--ftp-user' and `--ftp-password' options for FTP connections and the `--http-user' and `--http-password' options for HTTP connections.  File: wget.info, Node: Directory Options, Next: HTTP Options, Prev: Download Options, Up: Invoking 2.6 Directory Options ===================== `-nd' `--no-directories' Do not create a hierarchy of directories when retrieving recursively. With this option turned on, all files will get saved to the current directory, without clobbering (if a name shows up more than once, the filenames will get extensions `.n'). `-x' `--force-directories' The opposite of `-nd'--create a hierarchy of directories, even if one would not have been created otherwise. E.g. `wget -x http://fly.srk.fer.hr/robots.txt' will save the downloaded file to `fly.srk.fer.hr/robots.txt'. `-nH' `--no-host-directories' Disable generation of host-prefixed directories. By default, invoking Wget with `-r http://fly.srk.fer.hr/' will create a structure of directories beginning with `fly.srk.fer.hr/'. This option disables such behavior. `--protocol-directories' Use the protocol name as a directory component of local file names. For example, with this option, `wget -r http://HOST' will save to `http/HOST/...' rather than just to `HOST/...'. `--cut-dirs=NUMBER' Ignore NUMBER directory components. This is useful for getting a fine-grained control over the directory where recursive retrieval will be saved. Take, for example, the directory at `ftp://ftp.xemacs.org/pub/xemacs/'. If you retrieve it with `-r', it will be saved locally under `ftp.xemacs.org/pub/xemacs/'. While the `-nH' option can remove the `ftp.xemacs.org/' part, you are still stuck with `pub/xemacs'. This is where `--cut-dirs' comes in handy; it makes Wget not "see" NUMBER remote directory components. Here are several examples of how `--cut-dirs' option works. No options -> ftp.xemacs.org/pub/xemacs/ -nH -> pub/xemacs/ -nH --cut-dirs=1 -> xemacs/ -nH --cut-dirs=2 -> . --cut-dirs=1 -> ftp.xemacs.org/xemacs/ ... If you just want to get rid of the directory structure, this option is similar to a combination of `-nd' and `-P'. However, unlike `-nd', `--cut-dirs' does not lose with subdirectories--for instance, with `-nH --cut-dirs=1', a `beta/' subdirectory will be placed to `xemacs/beta', as one would expect. `-P PREFIX' `--directory-prefix=PREFIX' Set directory prefix to PREFIX. The "directory prefix" is the directory where all other files and subdirectories will be saved to, i.e. the top of the retrieval tree. The default is `.' (the current directory).  File: wget.info, Node: HTTP Options, Next: HTTPS (SSL/TLS) Options, Prev: Directory Options, Up: Invoking 2.7 HTTP Options ================ `-E' `--html-extension' If a file of type `application/xhtml+xml' or `text/html' is downloaded and the URL does not end with the regexp `\.[Hh][Tt][Mm][Ll]?', this option will cause the suffix `.html' to be appended to the local filename. This is useful, for instance, when you're mirroring a remote site that uses `.asp' pages, but you want the mirrored pages to be viewable on your stock Apache server. Another good use for this is when you're downloading CGI-generated materials. A URL like `http://site.com/article.cgi?25' will be saved as `article.cgi?25.html'. Note that filenames changed in this way will be re-downloaded every time you re-mirror a site, because Wget can't tell that the local `X.html' file corresponds to remote URL `X' (since it doesn't yet know that the URL produces output of type `text/html' or `application/xhtml+xml'. To prevent this re-downloading, you must use `-k' and `-K' so that the original version of the file will be saved as `X.orig' (*note Recursive Retrieval Options::). `--http-user=USER' `--http-password=PASSWORD' Specify the username USER and password PASSWORD on an HTTP server. According to the type of the challenge, Wget will encode them using either the `basic' (insecure), the `digest', or the Windows `NTLM' authentication scheme. Another way to specify username and password is in the URL itself (*note URL Format::). Either method reveals your password to anyone who bothers to run `ps'. To prevent the passwords from being seen, store them in `.wgetrc' or `.netrc', and make sure to protect those files from other users with `chmod'. If the passwords are really important, do not leave them lying in those files either--edit the files and delete them after Wget has started the download. `--no-cache' Disable server-side cache. In this case, Wget will send the remote server an appropriate directive (`Pragma: no-cache') to get the file from the remote service, rather than returning the cached version. This is especially useful for retrieving and flushing out-of-date documents on proxy servers. Caching is allowed by default. `--no-cookies' Disable the use of cookies. Cookies are a mechanism for maintaining server-side state. The server sends the client a cookie using the `Set-Cookie' header, and the client responds with the same cookie upon further requests. Since cookies allow the server owners to keep track of visitors and for sites to exchange this information, some consider them a breach of privacy. The default is to use cookies; however, _storing_ cookies is not on by default. `--load-cookies FILE' Load cookies from FILE before the first HTTP retrieval. FILE is a textual file in the format originally used by Netscape's `cookies.txt' file. You will typically use this option when mirroring sites that require that you be logged in to access some or all of their content. The login process typically works by the web server issuing an HTTP cookie upon receiving and verifying your credentials. The cookie is then resent by the browser when accessing that part of the site, and so proves your identity. Mirroring such a site requires Wget to send the same cookies your browser sends when communicating with the site. This is achieved by `--load-cookies'--simply point Wget to the location of the `cookies.txt' file, and it will send the same cookies your browser would send in the same situation. Different browsers keep textual cookie files in different locations: Netscape 4.x. The cookies are in `~/.netscape/cookies.txt'. Mozilla and Netscape 6.x. Mozilla's cookie file is also named `cookies.txt', located somewhere under `~/.mozilla', in the directory of your profile. The full path usually ends up looking somewhat like `~/.mozilla/default/SOME-WEIRD-STRING/cookies.txt'. Internet Explorer. You can produce a cookie file Wget can use by using the File menu, Import and Export, Export Cookies. This has been tested with Internet Explorer 5; it is not guaranteed to work with earlier versions. Other browsers. If you are using a different browser to create your cookies, `--load-cookies' will only work if you can locate or produce a cookie file in the Netscape format that Wget expects. If you cannot use `--load-cookies', there might still be an alternative. If your browser supports a "cookie manager", you can use it to view the cookies used when accessing the site you're mirroring. Write down the name and value of the cookie, and manually instruct Wget to send those cookies, bypassing the "official" cookie support: wget --no-cookies --header "Cookie: NAME=VALUE" `--save-cookies FILE' Save cookies to FILE before exiting. This will not save cookies that have expired or that have no expiry time (so-called "session cookies"), but also see `--keep-session-cookies'. `--keep-session-cookies' When specified, causes `--save-cookies' to also save session cookies. Session cookies are normally not saved because they are meant to be kept in memory and forgotten when you exit the browser. Saving them is useful on sites that require you to log in or to visit the home page before you can access some pages. With this option, multiple Wget runs are considered a single browser session as far as the site is concerned. Since the cookie file format does not normally carry session cookies, Wget marks them with an expiry timestamp of 0. Wget's `--load-cookies' recognizes those as session cookies, but it might confuse other browsers. Also note that cookies so loaded will be treated as other session cookies, which means that if you want `--save-cookies' to preserve them again, you must use `--keep-session-cookies' again. `--ignore-length' Unfortunately, some HTTP servers (CGI programs, to be more precise) send out bogus `Content-Length' headers, which makes Wget go wild, as it thinks not all the document was retrieved. You can spot this syndrome if Wget retries getting the same document again and again, each time claiming that the (otherwise normal) connection has closed on the very same byte. With this option, Wget will ignore the `Content-Length' header--as if it never existed. `--header=HEADER-LINE' Send HEADER-LINE along with the rest of the headers in each HTTP request. The supplied header is sent as-is, which means it must contain name and value separated by colon, and must not contain newlines. You may define more than one additional header by specifying `--header' more than once. wget --header='Accept-Charset: iso-8859-2' \ --header='Accept-Language: hr' \ http://fly.srk.fer.hr/ Specification of an empty string as the header value will clear all previous user-defined headers. As of Wget 1.10, this option can be used to override headers otherwise generated automatically. This example instructs Wget to connect to localhost, but to specify `foo.bar' in the `Host' header: wget --header="Host: foo.bar" http://localhost/ In versions of Wget prior to 1.10 such use of `--header' caused sending of duplicate headers. `--max-redirect=NUMBER' Specifies the maximum number of redirections to follow for a resource. The default is 20, which is usually far more than necessary. However, on those occasions where you want to allow more (or fewer), this is the option to use. `--proxy-user=USER' `--proxy-password=PASSWORD' Specify the username USER and password PASSWORD for authentication on a proxy server. Wget will encode them using the `basic' authentication scheme. Security considerations similar to those with `--http-password' pertain here as well. `--referer=URL' Include `Referer: URL' header in HTTP request. Useful for retrieving documents with server-side processing that assume they are always being retrieved by interactive web browsers and only come out properly when Referer is set to one of the pages that point to them. `--save-headers' Save the headers sent by the HTTP server to the file, preceding the actual contents, with an empty line as the separator. `-U AGENT-STRING' `--user-agent=AGENT-STRING' Identify as AGENT-STRING to the HTTP server. The HTTP protocol allows the clients to identify themselves using a `User-Agent' header field. This enables distinguishing the WWW software, usually for statistical purposes or for tracing of protocol violations. Wget normally identifies as `Wget/VERSION', VERSION being the current version number of Wget. However, some sites have been known to impose the policy of tailoring the output according to the `User-Agent'-supplied information. While this is not such a bad idea in theory, it has been abused by servers denying information to clients other than (historically) Netscape or, more frequently, Microsoft Internet Explorer. This option allows you to change the `User-Agent' line issued by Wget. Use of this option is discouraged, unless you really know what you are doing. Specifying empty user agent with `--user-agent=""' instructs Wget not to send the `User-Agent' header in HTTP requests. `--post-data=STRING' `--post-file=FILE' Use POST as the method for all HTTP requests and send the specified data in the request body. `--post-data' sends STRING as data, whereas `--post-file' sends the contents of FILE. Other than that, they work in exactly the same way. Please be aware that Wget needs to know the size of the POST data in advance. Therefore the argument to `--post-file' must be a regular file; specifying a FIFO or something like `/dev/stdin' won't work. It's not quite clear how to work around this limitation inherent in HTTP/1.0. Although HTTP/1.1 introduces "chunked" transfer that doesn't require knowing the request length in advance, a client can't use chunked unless it knows it's talking to an HTTP/1.1 server. And it can't know that until it receives a response, which in turn requires the request to have been completed - a chicken-and-egg problem. Note: if Wget is redirected after the POST request is completed, it will not send the POST data to the redirected URL. This is because URLs that process POST often respond with a redirection to a regular page, which does not desire or accept POST. It is not completely clear that this behavior is optimal; if it doesn't work out, it might be changed in the future. This example shows how to log to a server using POST and then proceed to download the desired pages, presumably only accessible to authorized users: # Log in to the server. This can be done only once. wget --save-cookies cookies.txt \ --post-data 'user=foo&password=bar' \ http://server.com/auth.php # Now grab the page or pages we care about. wget --load-cookies cookies.txt \ -p http://server.com/interesting/article.php If the server is using session cookies to track user authentication, the above will not work because `--save-cookies' will not save them (and neither will browsers) and the `cookies.txt' file will be empty. In that case use `--keep-session-cookies' along with `--save-cookies' to force saving of session cookies. `--content-disposition' If this is set to on, experimental (not fully-functional) support for `Content-Disposition' headers is enabled. This can currently result in extra round-trips to the server for a `HEAD' request, and is known to suffer from a few bugs, which is why it is not currently enabled by default. This option is useful for some file-downloading CGI programs that use `Content-Disposition' headers to describe what the name of a downloaded file should be.  File: wget.info, Node: HTTPS (SSL/TLS) Options, Next: FTP Options, Prev: HTTP Options, Up: Invoking 2.8 HTTPS (SSL/TLS) Options =========================== To support encrypted HTTP (HTTPS) downloads, Wget must be compiled with an external SSL library, currently OpenSSL. If Wget is compiled without SSL support, none of these options are available. `--secure-protocol=PROTOCOL' Choose the secure protocol to be used. Legal values are `auto', `SSLv2', `SSLv3', and `TLSv1'. If `auto' is used, the SSL library is given the liberty of choosing the appropriate protocol automatically, which is achieved by sending an SSLv2 greeting and announcing support for SSLv3 and TLSv1. This is the default. Specifying `SSLv2', `SSLv3', or `TLSv1' forces the use of the corresponding protocol. This is useful when talking to old and buggy SSL server implementations that make it hard for OpenSSL to choose the correct protocol version. Fortunately, such servers are quite rare. `--no-check-certificate' Don't check the server certificate against the available certificate authorities. Also don't require the URL host name to match the common name presented by the certificate. As of Wget 1.10, the default is to verify the server's certificate against the recognized certificate authorities, breaking the SSL handshake and aborting the download if the verification fails. Although this provides more secure downloads, it does break interoperability with some sites that worked with previous Wget versions, particularly those using self-signed, expired, or otherwise invalid certificates. This option forces an "insecure" mode of operation that turns the certificate verification errors into warnings and allows you to proceed. If you encounter "certificate verification" errors or ones saying that "common name doesn't match requested host name", you can use this option to bypass the verification and proceed with the download. _Only use this option if you are otherwise convinced of the site's authenticity, or if you really don't care about the validity of its certificate._ It is almost always a bad idea not to check the certificates when transmitting confidential or important data. `--certificate=FILE' Use the client certificate stored in FILE. This is needed for servers that are configured to require certificates from the clients that connect to them. Normally a certificate is not required and this switch is optional. `--certificate-type=TYPE' Specify the type of the client certificate. Legal values are `PEM' (assumed by default) and `DER', also known as `ASN1'. `--private-key=FILE' Read the private key from FILE. This allows you to provide the private key in a file separate from the certificate. `--private-key-type=TYPE' Specify the type of the private key. Accepted values are `PEM' (the default) and `DER'. `--ca-certificate=FILE' Use FILE as the file with the bundle of certificate authorities ("CA") to verify the peers. The certificates must be in PEM format. Without this option Wget looks for CA certificates at the system-specified locations, chosen at OpenSSL installation time. `--ca-directory=DIRECTORY' Specifies directory containing CA certificates in PEM format. Each file contains one CA certificate, and the file name is based on a hash value derived from the certificate. This is achieved by processing a certificate directory with the `c_rehash' utility supplied with OpenSSL. Using `--ca-directory' is more efficient than `--ca-certificate' when many certificates are installed because it allows Wget to fetch certificates on demand. Without this option Wget looks for CA certificates at the system-specified locations, chosen at OpenSSL installation time. `--random-file=FILE' Use FILE as the source of random data for seeding the pseudo-random number generator on systems without `/dev/random'. On such systems the SSL library needs an external source of randomness to initialize. Randomness may be provided by EGD (see `--egd-file' below) or read from an external source specified by the user. If this option is not specified, Wget looks for random data in `$RANDFILE' or, if that is unset, in `$HOME/.rnd'. If none of those are available, it is likely that SSL encryption will not be usable. If you're getting the "Could not seed OpenSSL PRNG; disabling SSL." error, you should provide random data using some of the methods described above. `--egd-file=FILE' Use FILE as the EGD socket. EGD stands for "Entropy Gathering Daemon", a user-space program that collects data from various unpredictable system sources and makes it available to other programs that might need it. Encryption software, such as the SSL library, needs sources of non-repeating randomness to seed the random number generator used to produce cryptographically strong keys. OpenSSL allows the user to specify his own source of entropy using the `RAND_FILE' environment variable. If this variable is unset, or if the specified file does not produce enough randomness, OpenSSL will read random data from EGD socket specified using this option. If this option is not specified (and the equivalent startup command is not used), EGD is never contacted. EGD is not needed on modern Unix systems that support `/dev/random'.  File: wget.info, Node: FTP Options, Next: Recursive Retrieval Options, Prev: HTTPS (SSL/TLS) Options, Up: Invoking 2.9 FTP Options =============== `--ftp-user=USER' `--ftp-password=PASSWORD' Specify the username USER and password PASSWORD on an FTP server. Without this, or the corresponding startup option, the password defaults to `-wget@', normally used for anonymous FTP. Another way to specify username and password is in the URL itself (*note URL Format::). Either method reveals your password to anyone who bothers to run `ps'. To prevent the passwords from being seen, store them in `.wgetrc' or `.netrc', and make sure to protect those files from other users with `chmod'. If the passwords are really important, do not leave them lying in those files either--edit the files and delete them after Wget has started the download. `--no-remove-listing' Don't remove the temporary `.listing' files generated by FTP retrievals. Normally, these files contain the raw directory listings received from FTP servers. Not removing them can be useful for debugging purposes, or when you want to be able to easily check on the contents of remote server directories (e.g. to verify that a mirror you're running is complete). Note that even though Wget writes to a known filename for this file, this is not a security hole in the scenario of a user making `.listing' a symbolic link to `/etc/passwd' or something and asking `root' to run Wget in his or her directory. Depending on the options used, either Wget will refuse to write to `.listing', making the globbing/recursion/time-stamping operation fail, or the symbolic link will be deleted and replaced with the actual `.listing' file, or the listing will be written to a `.listing.NUMBER' file. Even though this situation isn't a problem, though, `root' should never run Wget in a non-trusted user's directory. A user could do something as simple as linking `index.html' to `/etc/passwd' and asking `root' to run Wget with `-N' or `-r' so the file will be overwritten. `--no-glob' Turn off FTP globbing. Globbing refers to the use of shell-like special characters ("wildcards"), like `*', `?', `[' and `]' to retrieve more than one file from the same directory at once, like: wget ftp://gnjilux.srk.fer.hr/*.msg By default, globbing will be turned on if the URL contains a globbing character. This option may be used to turn globbing on or off permanently. You may have to quote the URL to protect it from being expanded by your shell. Globbing makes Wget look for a directory listing, which is system-specific. This is why it currently works only with Unix FTP servers (and the ones emulating Unix `ls' output). `--no-passive-ftp' Disable the use of the "passive" FTP transfer mode. Passive FTP mandates that the client connect to the server to establish the data connection rather than the other way around. If the machine is connected to the Internet directly, both passive and active FTP should work equally well. Behind most firewall and NAT configurations passive FTP has a better chance of working. However, in some rare firewall configurations, active FTP actually works when passive FTP doesn't. If you suspect this to be the case, use this option, or set `passive_ftp=off' in your init file. `--retr-symlinks' Usually, when retrieving FTP directories recursively and a symbolic link is encountered, the linked-to file is not downloaded. Instead, a matching symbolic link is created on the local filesystem. The pointed-to file will not be downloaded unless this recursive retrieval would have encountered it separately and downloaded it anyway. When `--retr-symlinks' is specified, however, symbolic links are traversed and the pointed-to files are retrieved. At this time, this option does not cause Wget to traverse symlinks to directories and recurse through them, but in the future it should be enhanced to do this. Note that when retrieving a file (not a directory) because it was specified on the command-line, rather than because it was recursed to, this option has no effect. Symbolic links are always traversed in this case. `--no-http-keep-alive' Turn off the "keep-alive" feature for HTTP downloads. Normally, Wget asks the server to keep the connection open so that, when you download more than one document from the same server, they get transferred over the same TCP connection. This saves time and at the same time reduces the load on the server. This option is useful when, for some reason, persistent (keep-alive) connections don't work for you, for example due to a server bug or due to the inability of server-side scripts to cope with the connections.  File: wget.info, Node: Recursive Retrieval Options, Next: Recursive Accept/Reject Options, Prev: FTP Options, Up: Invoking 2.10 Recursive Retrieval Options ================================ `-r' `--recursive' Turn on recursive retrieving. *Note Recursive Download::, for more details. `-l DEPTH' `--level=DEPTH' Specify recursion maximum depth level DEPTH (*note Recursive Download::). The default maximum depth is 5. `--delete-after' This option tells Wget to delete every single file it downloads, _after_ having done so. It is useful for pre-fetching popular pages through a proxy, e.g.: wget -r -nd --delete-after http://whatever.com/~popular/page/ The `-r' option is to retrieve recursively, and `-nd' to not create directories. Note that `--delete-after' deletes files on the local machine. It does not issue the `DELE' command to remote FTP sites, for instance. Also note that when `--delete-after' is specified, `--convert-links' is ignored, so `.orig' files are simply not created in the first place. `-k' `--convert-links' After the download is complete, convert the links in the document to make them suitable for local viewing. This affects not only the visible hyperlinks, but any part of the document that links to external content, such as embedded images, links to style sheets, hyperlinks to non-HTML content, etc. Each link will be changed in one of the two ways: * The links to files that have been downloaded by Wget will be changed to refer to the file they point to as a relative link. Example: if the downloaded file `/foo/doc.html' links to `/bar/img.gif', also downloaded, then the link in `doc.html' will be modified to point to `../bar/img.gif'. This kind of transformation works reliably for arbitrary combinations of directories. * The links to files that have not been downloaded by Wget will be changed to include host name and absolute path of the location they point to. Example: if the downloaded file `/foo/doc.html' links to `/bar/img.gif' (or to `../bar/img.gif'), then the link in `doc.html' will be modified to point to `http://HOSTNAME/bar/img.gif'. Because of this, local browsing works reliably: if a linked file was downloaded, the link will refer to its local name; if it was not downloaded, the link will refer to its full Internet address rather than presenting a broken link. The fact that the former links are converted to relative links ensures that you can move the downloaded hierarchy to another directory. Note that only at the end of the download can Wget know which links have been downloaded. Because of that, the work done by `-k' will be performed at the end of all the downloads. `-K' `--backup-converted' When converting a file, back up the original version with a `.orig' suffix. Affects the behavior of `-N' (*note HTTP Time-Stamping Internals::). `-m' `--mirror' Turn on options suitable for mirroring. This option turns on recursion and time-stamping, sets infinite recursion depth and keeps FTP directory listings. It is currently equivalent to `-r -N -l inf --no-remove-listing'. `-p' `--page-requisites' This option causes Wget to download all the files that are necessary to properly display a given HTML page. This includes such things as inlined images, sounds, and referenced stylesheets. Ordinarily, when downloading a single HTML page, any requisite documents that may be needed to display it properly are not downloaded. Using `-r' together with `-l' can help, but since Wget does not ordinarily distinguish between external and inlined documents, one is generally left with "leaf documents" that are missing their requisites. For instance, say document `1.html' contains an `' tag referencing `1.gif' and an `' tag pointing to external document `2.html'. Say that `2.html' is similar but that its image is `2.gif' and it links to `3.html'. Say this continues up to some arbitrarily high number. If one executes the command: wget -r -l 2 http://SITE/1.html then `1.html', `1.gif', `2.html', `2.gif', and `3.html' will be downloaded. As you can see, `3.html' is without its requisite `3.gif' because Wget is simply counting the number of hops (up to 2) away from `1.html' in order to determine where to stop the recursion. However, with this command: wget -r -l 2 -p http://SITE/1.html all the above files _and_ `3.html''s requisite `3.gif' will be downloaded. Similarly, wget -r -l 1 -p http://SITE/1.html will cause `1.html', `1.gif', `2.html', and `2.gif' to be downloaded. One might think that: wget -r -l 0 -p http://SITE/1.html would download just `1.html' and `1.gif', but unfortunately this is not the case, because `-l 0' is equivalent to `-l inf'--that is, infinite recursion. To download a single HTML page (or a handful of them, all specified on the command-line or in a `-i' URL input file) and its (or their) requisites, simply leave off `-r' and `-l': wget -p http://SITE/1.html Note that Wget will behave as if `-r' had been specified, but only that single page and its requisites will be downloaded. Links from that page to external documents will not be followed. Actually, to download a single page and all its requisites (even if they exist on separate websites), and make sure the lot displays properly locally, this author likes to use a few options in addition to `-p': wget -E -H -k -K -p http://SITE/DOCUMENT To finish off this topic, it's worth knowing that Wget's idea of an external document link is any URL specified in an `' tag, an `' tag, or a `' tag other than `'. `--strict-comments' Turn on strict parsing of HTML comments. The default is to terminate comments at the first occurrence of `-->'. According to specifications, HTML comments are expressed as SGML "declarations". Declaration is special markup that begins with `', such as `', that may contain comments between a pair of `--' delimiters. HTML comments are "empty declarations", SGML declarations without any non-comment text. Therefore, `' is a valid comment, and so is `', but `' is not. On the other hand, most HTML writers don't perceive comments as anything other than text delimited with `', which is not quite the same. For example, something like `' works as a valid comment as long as the number of dashes is a multiple of four (!). If not, the comment technically lasts until the next `--', which may be at the other end of the document. Because of this, many popular browsers completely ignore the specification and implement what users have come to expect: comments delimited with `'. Until version 1.9, Wget interpreted comments strictly, which resulted in missing links in many web pages that displayed fine in browsers, but had the misfortune of containing non-compliant comments. Beginning with version 1.9, Wget has joined the ranks of clients that implements "naive" comments, terminating each comment at the first occurrence of `-->'. If, for whatever reason, you want strict comment parsing, use this option to turn it on.  File: wget.info, Node: Recursive Accept/Reject Options, Prev: Recursive Retrieval Options, Up: Invoking 2.11 Recursive Accept/Reject Options ==================================== `-A ACCLIST --accept ACCLIST' `-R REJLIST --reject REJLIST' Specify comma-separated lists of file name suffixes or patterns to accept or reject (*note Types of Files::). Note that if any of the wildcard characters, `*', `?', `[' or `]', appear in an element of ACCLIST or REJLIST, it will be treated as a pattern, rather than a suffix. `-D DOMAIN-LIST' `--domains=DOMAIN-LIST' Set domains to be followed. DOMAIN-LIST is a comma-separated list of domains. Note that it does _not_ turn on `-H'. `--exclude-domains DOMAIN-LIST' Specify the domains that are _not_ to be followed. (*note Spanning Hosts::). `--follow-ftp' Follow FTP links from HTML documents. Without this option, Wget will ignore all the FTP links. `--follow-tags=LIST' Wget has an internal table of HTML tag / attribute pairs that it considers when looking for linked documents during a recursive retrieval. If a user wants only a subset of those tags to be considered, however, he or she should be specify such tags in a comma-separated LIST with this option. `--ignore-tags=LIST' This is the opposite of the `--follow-tags' option. To skip certain HTML tags when recursively looking for documents to download, specify them in a comma-separated LIST. In the past, this option was the best bet for downloading a single page and its requisites, using a command-line like: wget --ignore-tags=a,area -H -k -K -r http://SITE/DOCUMENT However, the author of this option came across a page with tags like `' and came to the realization that specifying tags to ignore was not enough. One can't just tell Wget to ignore `', because then stylesheets will not be downloaded. Now the best bet for downloading a single page and its requisites is the dedicated `--page-requisites' option. `--ignore-case' Ignore case when matching files and directories. This influences the behavior of -R, -A, -I, and -X options, as well as globbing implemented when downloading from FTP sites. For example, with this option, `-A *.txt' will match `file1.txt', but also `file2.TXT', `file3.TxT', and so on. `-H' `--span-hosts' Enable spanning across hosts when doing recursive retrieving (*note Spanning Hosts::). `-L' `--relative' Follow relative links only. Useful for retrieving a specific home page without any distractions, not even those from the same hosts (*note Relative Links::). `-I LIST' `--include-directories=LIST' Specify a comma-separated list of directories you wish to follow when downloading (*note Directory-Based Limits::). Elements of LIST may contain wildcards. `-X LIST' `--exclude-directories=LIST' Specify a comma-separated list of directories you wish to exclude from download (*note Directory-Based Limits::). Elements of LIST may contain wildcards. `-np' `--no-parent' Do not ever ascend to the parent directory when retrieving recursively. This is a useful option, since it guarantees that only the files _below_ a certain hierarchy will be downloaded. *Note Directory-Based Limits::, for more details.  File: wget.info, Node: Recursive Download, Next: Following Links, Prev: Invoking, Up: Top 3 Recursive Download ******************** GNU Wget is capable of traversing parts of the Web (or a single HTTP or FTP server), following links and directory structure. We refer to this as to "recursive retrieval", or "recursion". With HTTP URLs, Wget retrieves and parses the HTML from the given URL, documents, retrieving the files the HTML document was referring to, through markup like `href', or `src'. If the freshly downloaded file is also of type `text/html' or `application/xhtml+xml', it will be parsed and followed further. Recursive retrieval of HTTP and HTML content is "breadth-first". This means that Wget first downloads the requested HTML document, then the documents linked from that document, then the documents linked by them, and so on. In other words, Wget first downloads the documents at depth 1, then those at depth 2, and so on until the specified maximum depth. The maximum "depth" to which the retrieval may descend is specified with the `-l' option. The default maximum depth is five layers. When retrieving an FTP URL recursively, Wget will retrieve all the data from the given directory tree (including the subdirectories up to the specified depth) on the remote server, creating its mirror image locally. FTP retrieval is also limited by the `depth' parameter. Unlike HTTP recursion, FTP recursion is performed depth-first. By default, Wget will create a local directory tree, corresponding to the one found on the remote server. Recursive retrieving can find a number of applications, the most important of which is mirroring. It is also useful for WWW presentations, and any other opportunities where slow network connections should be bypassed by storing the files locally. You should be warned that recursive downloads can overload the remote servers. Because of that, many administrators frown upon them and may ban access from your site if they detect very fast downloads of big amounts of content. When downloading from Internet servers, consider using the `-w' option to introduce a delay between accesses to the server. The download will take a while longer, but the server administrator will not be alarmed by your rudeness. Of course, recursive download may cause problems on your machine. If left to run unchecked, it can easily fill up the disk. If downloading from local network, it can also take bandwidth on the system, as well as consume memory and CPU. Try to specify the criteria that match the kind of download you are trying to achieve. If you want to download only one page, use `--page-requisites' without any additional recursion. If you want to download things under one directory, use `-np' to avoid downloading things from other directories. If you want to download all the files from one directory, use `-l 1' to make sure the recursion depth never exceeds one. *Note Following Links::, for more information about this. Recursive retrieval should be used with care. Don't say you were not warned.  File: wget.info, Node: Following Links, Next: Time-Stamping, Prev: Recursive Download, Up: Top 4 Following Links ***************** When retrieving recursively, one does not wish to retrieve loads of unnecessary data. Most of the time the users bear in mind exactly what they want to download, and want Wget to follow only specific links. For example, if you wish to download the music archive from `fly.srk.fer.hr', you will not want to download all the home pages that happen to be referenced by an obscure part of the archive. Wget possesses several mechanisms that allows you to fine-tune which links it will follow. * Menu: * Spanning Hosts:: (Un)limiting retrieval based on host name. * Types of Files:: Getting only certain files. * Directory-Based Limits:: Getting only certain directories. * Relative Links:: Follow relative links only. * FTP Links:: Following FTP links.  File: wget.info, Node: Spanning Hosts, Next: Types of Files, Up: Following Links 4.1 Spanning Hosts ================== Wget's recursive retrieval normally refuses to visit hosts different than the one you specified on the command line. This is a reasonable default; without it, every retrieval would have the potential to turn your Wget into a small version of google. However, visiting different hosts, or "host spanning," is sometimes a useful option. Maybe the images are served from a different server. Maybe you're mirroring a site that consists of pages interlinked between three servers. Maybe the server has two equivalent names, and the HTML pages refer to both interchangeably. Span to any host--`-H' The `-H' option turns on host spanning, thus allowing Wget's recursive run to visit any host referenced by a link. Unless sufficient recursion-limiting criteria are applied depth, these foreign hosts will typically link to yet more hosts, and so on until Wget ends up sucking up much more data than you have intended. Limit spanning to certain domains--`-D' The `-D' option allows you to specify the domains that will be followed, thus limiting the recursion only to the hosts that belong to these domains. Obviously, this makes sense only in conjunction with `-H'. A typical example would be downloading the contents of `www.server.com', but allowing downloads from `images.server.com', etc.: wget -rH -Dserver.com http://www.server.com/ You can specify more than one address by separating them with a comma, e.g. `-Ddomain1.com,domain2.com'. Keep download off certain domains--`--exclude-domains' If there are domains you want to exclude specifically, you can do it with `--exclude-domains', which accepts the same type of arguments of `-D', but will _exclude_ all the listed domains. For example, if you want to download all the hosts from `foo.edu' domain, with the exception of `sunsite.foo.edu', you can do it like this: wget -rH -Dfoo.edu --exclude-domains sunsite.foo.edu \ http://www.foo.edu/  File: wget.info, Node: Types of Files, Next: Directory-Based Limits, Prev: Spanning Hosts, Up: Following Links 4.2 Types of Files ================== When downloading material from the web, you will often want to restrict the retrieval to only certain file types. For example, if you are interested in downloading GIFs, you will not be overjoyed to get loads of PostScript documents, and vice versa. Wget offers two options to deal with this problem. Each option description lists a short name, a long name, and the equivalent command in `.wgetrc'. `-A ACCLIST' `--accept ACCLIST' `accept = ACCLIST' The argument to `--accept' option is a list of file suffixes or patterns that Wget will download during recursive retrieval. A suffix is the ending part of a file, and consists of "normal" letters, e.g. `gif' or `.jpg'. A matching pattern contains shell-like wildcards, e.g. `books*' or `zelazny*196[0-9]*'. So, specifying `wget -A gif,jpg' will make Wget download only the files ending with `gif' or `jpg', i.e. GIFs and JPEGs. On the other hand, `wget -A "zelazny*196[0-9]*"' will download only files beginning with `zelazny' and containing numbers from 1960 to 1969 anywhere within. Look up the manual of your shell for a description of how pattern matching works. Of course, any number of suffixes and patterns can be combined into a comma-separated list, and given as an argument to `-A'. `-R REJLIST' `--reject REJLIST' `reject = REJLIST' The `--reject' option works the same way as `--accept', only its logic is the reverse; Wget will download all files _except_ the ones matching the suffixes (or patterns) in the list. So, if you want to download a whole page except for the cumbersome MPEGs and .AU files, you can use `wget -R mpg,mpeg,au'. Analogously, to download all files except the ones beginning with `bjork', use `wget -R "bjork*"'. The quotes are to prevent expansion by the shell. The `-A' and `-R' options may be combined to achieve even better fine-tuning of which files to retrieve. E.g. `wget -A "*zelazny*" -R .ps' will download all the files having `zelazny' as a part of their name, but _not_ the PostScript files. Note that these two options do not affect the downloading of HTML files; Wget must load all the HTMLs to know where to go at all--recursive retrieval would make no sense otherwise.  File: wget.info, Node: Directory-Based Limits, Next: Relative Links, Prev: Types of Files, Up: Following Links 4.3 Directory-Based Limits ========================== Regardless of other link-following facilities, it is often useful to place the restriction of what files to retrieve based on the directories those files are placed in. There can be many reasons for this--the home pages may be organized in a reasonable directory structure; or some directories may contain useless information, e.g. `/cgi-bin' or `/dev' directories. Wget offers three different options to deal with this requirement. Each option description lists a short name, a long name, and the equivalent command in `.wgetrc'. `-I LIST' `--include LIST' `include_directories = LIST' `-I' option accepts a comma-separated list of directories included in the retrieval. Any other directories will simply be ignored. The directories are absolute paths. So, if you wish to download from `http://host/people/bozo/' following only links to bozo's colleagues in the `/people' directory and the bogus scripts in `/cgi-bin', you can specify: wget -I /people,/cgi-bin http://host/people/bozo/ `-X LIST' `--exclude LIST' `exclude_directories = LIST' `-X' option is exactly the reverse of `-I'--this is a list of directories _excluded_ from the download. E.g. if you do not want Wget to download things from `/cgi-bin' directory, specify `-X /cgi-bin' on the command line. The same as with `-A'/`-R', these two options can be combined to get a better fine-tuning of downloading subdirectories. E.g. if you want to load all the files from `/pub' hierarchy except for `/pub/worthless', specify `-I/pub -X/pub/worthless'. `-np' `--no-parent' `no_parent = on' The simplest, and often very useful way of limiting directories is disallowing retrieval of the links that refer to the hierarchy "above" than the beginning directory, i.e. disallowing ascent to the parent directory/directories. The `--no-parent' option (short `-np') is useful in this case. Using it guarantees that you will never leave the existing hierarchy. Supposing you issue Wget with: wget -r --no-parent http://somehost/~luzer/my-archive/ You may rest assured that none of the references to `/~his-girls-homepage/' or `/~luzer/all-my-mpegs/' will be followed. Only the archive you are interested in will be downloaded. Essentially, `--no-parent' is similar to `-I/~luzer/my-archive', only it handles redirections in a more intelligent fashion.  File: wget.info, Node: Relative Links, Next: FTP Links, Prev: Directory-Based Limits, Up: Following Links 4.4 Relative Links ================== When `-L' is turned on, only the relative links are ever followed. Relative links are here defined those that do not refer to the web server root. For example, these links are relative: These links are not relative: Using this option guarantees that recursive retrieval will not span hosts, even without `-H'. In simple cases it also allows downloads to "just work" without having to convert links. This option is probably not very useful and might be removed in a future release.  File: wget.info, Node: FTP Links, Prev: Relative Links, Up: Following Links 4.5 Following FTP Links ======================= The rules for FTP are somewhat specific, as it is necessary for them to be. FTP links in HTML documents are often included for purposes of reference, and it is often inconvenient to download them by default. To have FTP links followed from HTML documents, you need to specify the `--follow-ftp' option. Having done that, FTP links will span hosts regardless of `-H' setting. This is logical, as FTP links rarely point to the same host where the HTTP server resides. For similar reasons, the `-L' options has no effect on such downloads. On the other hand, domain acceptance (`-D') and suffix rules (`-A' and `-R') apply normally. Also note that followed links to FTP directories will not be retrieved recursively further.  File: wget.info, Node: Time-Stamping, Next: Startup File, Prev: Following Links, Up: Top 5 Time-Stamping *************** One of the most important aspects of mirroring information from the Internet is updating your archives. Downloading the whole archive again and again, just to replace a few changed files is expensive, both in terms of wasted bandwidth and money, and the time to do the update. This is why all the mirroring tools offer the option of incremental updating. Such an updating mechanism means that the remote server is scanned in search of "new" files. Only those new files will be downloaded in the place of the old ones. A file is considered new if one of these two conditions are met: 1. A file of that name does not already exist locally. 2. A file of that name does exist, but the remote file was modified more recently than the local file. To implement this, the program needs to be aware of the time of last modification of both local and remote files. We call this information the "time-stamp" of a file. The time-stamping in GNU Wget is turned on using `--timestamping' (`-N') option, or through `timestamping = on' directive in `.wgetrc'. With this option, for each file it intends to download, Wget will check whether a local file of the same name exists. If it does, and the remote file is older, Wget will not download it. If the local file does not exist, or the sizes of the files do not match, Wget will download the remote file no matter what the time-stamps say. * Menu: * Time-Stamping Usage:: * HTTP Time-Stamping Internals:: * FTP Time-Stamping Internals::  File: wget.info, Node: Time-Stamping Usage, Next: HTTP Time-Stamping Internals, Up: Time-Stamping 5.1 Time-Stamping Usage ======================= The usage of time-stamping is simple. Say you would like to download a file so that it keeps its date of modification. wget -S http://www.gnu.ai.mit.edu/ A simple `ls -l' shows that the time stamp on the local file equals the state of the `Last-Modified' header, as returned by the server. As you can see, the time-stamping info is preserved locally, even without `-N' (at least for HTTP). Several days later, you would like Wget to check if the remote file has changed, and download it if it has. wget -N http://www.gnu.ai.mit.edu/ Wget will ask the server for the last-modified date. If the local file has the same timestamp as the server, or a newer one, the remote file will not be re-fetched. However, if the remote file is more recent, Wget will proceed to fetch it. The same goes for FTP. For example: wget "ftp://ftp.ifi.uio.no/pub/emacs/gnus/*" (The quotes around that URL are to prevent the shell from trying to interpret the `*'.) After download, a local directory listing will show that the timestamps match those on the remote server. Reissuing the command with `-N' will make Wget re-fetch _only_ the files that have been modified since the last download. If you wished to mirror the GNU archive every week, you would use a command like the following, weekly: wget --timestamping -r ftp://ftp.gnu.org/pub/gnu/ Note that time-stamping will only work for files for which the server gives a timestamp. For HTTP, this depends on getting a `Last-Modified' header. For FTP, this depends on getting a directory listing with dates in a format that Wget can parse (*note FTP Time-Stamping Internals::).  File: wget.info, Node: HTTP Time-Stamping Internals, Next: FTP Time-Stamping Internals, Prev: Time-Stamping Usage, Up: Time-Stamping 5.2 HTTP Time-Stamping Internals ================================ Time-stamping in HTTP is implemented by checking of the `Last-Modified' header. If you wish to retrieve the file `foo.html' through HTTP, Wget will check whether `foo.html' exists locally. If it doesn't, `foo.html' will be retrieved unconditionally. If the file does exist locally, Wget will first check its local time-stamp (similar to the way `ls -l' checks it), and then send a `HEAD' request to the remote server, demanding the information on the remote file. The `Last-Modified' header is examined to find which file was modified more recently (which makes it "newer"). If the remote file is newer, it will be downloaded; if it is older, Wget will give up.(1) When `--backup-converted' (`-K') is specified in conjunction with `-N', server file `X' is compared to local file `X.orig', if extant, rather than being compared to local file `X', which will always differ if it's been converted by `--convert-links' (`-k'). Arguably, HTTP time-stamping should be implemented using the `If-Modified-Since' request. ---------- Footnotes ---------- (1) As an additional check, Wget will look at the `Content-Length' header, and compare the sizes; if they are not the same, the remote file will be downloaded no matter what the time-stamp says.  File: wget.info, Node: FTP Time-Stamping Internals, Prev: HTTP Time-Stamping Internals, Up: Time-Stamping 5.3 FTP Time-Stamping Internals =============================== In theory, FTP time-stamping works much the same as HTTP, only FTP has no headers--time-stamps must be ferreted out of directory listings. If an FTP download is recursive or uses globbing, Wget will use the FTP `LIST' command to get a file listing for the directory containing the desired file(s). It will try to analyze the listing, treating it like Unix `ls -l' output, extracting the time-stamps. The rest is exactly the same as for HTTP. Note that when retrieving individual files from an FTP server without using globbing or recursion, listing files will not be downloaded (and thus files will not be time-stamped) unless `-N' is specified. Assumption that every directory listing is a Unix-style listing may sound extremely constraining, but in practice it is not, as many non-Unix FTP servers use the Unixoid listing format because most (all?) of the clients understand it. Bear in mind that RFC959 defines no standard way to get a file list, let alone the time-stamps. We can only hope that a future standard will define this. Another non-standard solution includes the use of `MDTM' command that is supported by some FTP servers (including the popular `wu-ftpd'), which returns the exact time of the specified file. Wget may support this command in the future.  File: wget.info, Node: Startup File, Next: Examples, Prev: Time-Stamping, Up: Top 6 Startup File ************** Once you know how to change default settings of Wget through command line arguments, you may wish to make some of those settings permanent. You can do that in a convenient way by creating the Wget startup file--`.wgetrc'. Besides `.wgetrc' is the "main" initialization file, it is convenient to have a special facility for storing passwords. Thus Wget reads and interprets the contents of `$HOME/.netrc', if it finds it. You can find `.netrc' format in your system manuals. Wget reads `.wgetrc' upon startup, recognizing a limited set of commands. * Menu: * Wgetrc Location:: Location of various wgetrc files. * Wgetrc Syntax:: Syntax of wgetrc. * Wgetrc Commands:: List of available commands. * Sample Wgetrc:: A wgetrc example.  File: wget.info, Node: Wgetrc Location, Next: Wgetrc Syntax, Up: Startup File 6.1 Wgetrc Location =================== When initializing, Wget will look for a "global" startup file, `/usr/local/etc/wgetrc' by default (or some prefix other than `/usr/local', if Wget was not installed there) and read commands from there, if it exists. Then it will look for the user's file. If the environmental variable `WGETRC' is set, Wget will try to load that file. Failing that, no further attempts will be made. If `WGETRC' is not set, Wget will try to load `$HOME/.wgetrc'. The fact that user's settings are loaded after the system-wide ones means that in case of collision user's wgetrc _overrides_ the system-wide wgetrc (in `/usr/local/etc/wgetrc' by default). Fascist admins, away!  File: wget.info, Node: Wgetrc Syntax, Next: Wgetrc Commands, Prev: Wgetrc Location, Up: Startup File 6.2 Wgetrc Syntax ================= The syntax of a wgetrc command is simple: variable = value The "variable" will also be called "command". Valid "values" are different for different commands. The commands are case-insensitive and underscore-insensitive. Thus `DIr__PrefiX' is the same as `dirprefix'. Empty lines, lines beginning with `#' and lines containing white-space only are discarded. Commands that expect a comma-separated list will clear the list on an empty command. So, if you wish to reset the rejection list specified in global `wgetrc', you can do it with: reject =  File: wget.info, Node: Wgetrc Commands, Next: Sample Wgetrc, Prev: Wgetrc Syntax, Up: Startup File 6.3 Wgetrc Commands =================== The complete set of commands is listed below. Legal values are listed after the `='. Simple Boolean values can be set or unset using `on' and `off' or `1' and `0'. Some commands take pseudo-arbitrary values. ADDRESS values can be hostnames or dotted-quad IP addresses. N can be any positive integer, or `inf' for infinity, where appropriate. STRING values can be any non-empty string. Most of these commands have direct command-line equivalents. Also, any wgetrc command can be specified on the command line using the `--execute' switch (*note Basic Startup Options::.) accept/reject = STRING Same as `-A'/`-R' (*note Types of Files::). add_hostdir = on/off Enable/disable host-prefixed file names. `-nH' disables it. background = on/off Enable/disable going to background--the same as `-b' (which enables it). backup_converted = on/off Enable/disable saving pre-converted files with the suffix `.orig'--the same as `-K' (which enables it). base = STRING Consider relative URLs in URL input files forced to be interpreted as HTML as being relative to STRING--the same as `--base=STRING'. bind_address = ADDRESS Bind to ADDRESS, like the `--bind-address=ADDRESS'. ca_certificate = FILE Set the certificate authority bundle file to FILE. The same as `--ca-certificate=FILE'. ca_directory = DIRECTORY Set the directory used for certificate authorities. The same as `--ca-directory=DIRECTORY'. cache = on/off When set to off, disallow server-caching. See the `--no-cache' option. certificate = FILE Set the client certificate file name to FILE. The same as `--certificate=FILE'. certificate_type = STRING Specify the type of the client certificate, legal values being `PEM' (the default) and `DER' (aka ASN1). The same as `--certificate-type=STRING'. check_certificate = on/off If this is set to off, the server certificate is not checked against the specified client authorities. The default is "on". The same as `--check-certificate'. connect_timeout = N Set the connect timeout--the same as `--connect-timeout'. content_disposition = on/off Turn on recognition of the (non-standard) `Content-Disposition' HTTP header--if set to `on', the same as `--content-disposition'. continue = on/off If set to on, force continuation of preexistent partially retrieved files. See `-c' before setting it. convert_links = on/off Convert non-relative links locally. The same as `-k'. cookies = on/off When set to off, disallow cookies. See the `--cookies' option. cut_dirs = N Ignore N remote directory components. Equivalent to `--cut-dirs=N'. debug = on/off Debug mode, same as `-d'. delete_after = on/off Delete after download--the same as `--delete-after'. dir_prefix = STRING Top of directory tree--the same as `-P STRING'. dirstruct = on/off Turning dirstruct on or off--the same as `-x' or `-nd', respectively. dns_cache = on/off Turn DNS caching on/off. Since DNS caching is on by default, this option is normally used to turn it off and is equivalent to `--no-dns-cache'. dns_timeout = N Set the DNS timeout--the same as `--dns-timeout'. domains = STRING Same as `-D' (*note Spanning Hosts::). dot_bytes = N Specify the number of bytes "contained" in a dot, as seen throughout the retrieval (1024 by default). You can postfix the value with `k' or `m', representing kilobytes and megabytes, respectively. With dot settings you can tailor the dot retrieval to suit your needs, or you can use the predefined "styles" (*note Download Options::). dot_spacing = N Specify the number of dots in a single cluster (10 by default). dots_in_line = N Specify the number of dots that will be printed in each line throughout the retrieval (50 by default). egd_file = FILE Use STRING as the EGD socket file name. The same as `--egd-file=FILE'. exclude_directories = STRING Specify a comma-separated list of directories you wish to exclude from download--the same as `-X STRING' (*note Directory-Based Limits::). exclude_domains = STRING Same as `--exclude-domains=STRING' (*note Spanning Hosts::). follow_ftp = on/off Follow FTP links from HTML documents--the same as `--follow-ftp'. follow_tags = STRING Only follow certain HTML tags when doing a recursive retrieval, just like `--follow-tags=STRING'. force_html = on/off If set to on, force the input filename to be regarded as an HTML document--the same as `-F'. ftp_password = STRING Set your FTP password to STRING. Without this setting, the password defaults to `-wget@', which is a useful default for anonymous FTP access. This command used to be named `passwd' prior to Wget 1.10. ftp_proxy = STRING Use STRING as FTP proxy, instead of the one specified in environment. ftp_user = STRING Set FTP user to STRING. This command used to be named `login' prior to Wget 1.10. glob = on/off Turn globbing on/off--the same as `--glob' and `--no-glob'. header = STRING Define a header for HTTP downloads, like using `--header=STRING'. html_extension = on/off Add a `.html' extension to `text/html' or `application/xhtml+xml' files without it, like `-E'. http_keep_alive = on/off Turn the keep-alive feature on or off (defaults to on). Turning it off is equivalent to `--no-http-keep-alive'. http_password = STRING Set HTTP password, equivalent to `--http-password=STRING'. http_proxy = STRING Use STRING as HTTP proxy, instead of the one specified in environment. http_user = STRING Set HTTP user to STRING, equivalent to `--http-user=STRING'. https_proxy = STRING Use STRING as HTTPS proxy, instead of the one specified in environment. ignore_case = on/off When set to on, match files and directories case insensitively; the same as `--ignore-case'. ignore_length = on/off When set to on, ignore `Content-Length' header; the same as `--ignore-length'. ignore_tags = STRING Ignore certain HTML tags when doing a recursive retrieval, like `--ignore-tags=STRING'. include_directories = STRING Specify a comma-separated list of directories you wish to follow when downloading--the same as `-I STRING'. inet4_only = on/off Force connecting to IPv4 addresses, off by default. You can put this in the global init file to disable Wget's attempts to resolve and connect to IPv6 hosts. Available only if Wget was compiled with IPv6 support. The same as `--inet4-only' or `-4'. inet6_only = on/off Force connecting to IPv6 addresses, off by default. Available only if Wget was compiled with IPv6 support. The same as `--inet6-only' or `-6'. input = FILE Read the URLs from STRING, like `-i FILE'. limit_rate = RATE Limit the download speed to no more than RATE bytes per second. The same as `--limit-rate=RATE'. load_cookies = FILE Load cookies from FILE. See `--load-cookies FILE'. logfile = FILE Set logfile to FILE, the same as `-o FILE'. max_redirect = NUMBER Specifies the maximum number of redirections to follow for a resource. See `--max-redirect=NUMBER'. mirror = on/off Turn mirroring on/off. The same as `-m'. netrc = on/off Turn reading netrc on or off. no_clobber = on/off Same as `-nc'. no_parent = on/off Disallow retrieving outside the directory hierarchy, like `--no-parent' (*note Directory-Based Limits::). no_proxy = STRING Use STRING as the comma-separated list of domains to avoid in proxy loading, instead of the one specified in environment. output_document = FILE Set the output filename--the same as `-O FILE'. page_requisites = on/off Download all ancillary documents necessary for a single HTML page to display properly--the same as `-p'. passive_ftp = on/off Change setting of passive FTP, equivalent to the `--passive-ftp' option. password = STRING Specify password STRING for both FTP and HTTP file retrieval. This command can be overridden using the `ftp_password' and `http_password' command for FTP and HTTP respectively. post_data = STRING Use POST as the method for all HTTP requests and send STRING in the request body. The same as `--post-data=STRING'. post_file = FILE Use POST as the method for all HTTP requests and send the contents of FILE in the request body. The same as `--post-file=FILE'. prefer_family = IPv4/IPv6/none When given a choice of several addresses, connect to the addresses with specified address family first. IPv4 addresses are preferred by default. The same as `--prefer-family', which see for a detailed discussion of why this is useful. private_key = FILE Set the private key file to FILE. The same as `--private-key=FILE'. private_key_type = STRING Specify the type of the private key, legal values being `PEM' (the default) and `DER' (aka ASN1). The same as `--private-type=STRING'. progress = STRING Set the type of the progress indicator. Legal types are `dot' and `bar'. Equivalent to `--progress=STRING'. protocol_directories = on/off When set, use the protocol name as a directory component of local file names. The same as `--protocol-directories'. proxy_password = STRING Set proxy authentication password to STRING, like `--proxy-password=STRING'. proxy_user = STRING Set proxy authentication user name to STRING, like `--proxy-user=STRING'. quiet = on/off Quiet mode--the same as `-q'. quota = QUOTA Specify the download quota, which is useful to put in the global `wgetrc'. When download quota is specified, Wget will stop retrieving after the download sum has become greater than quota. The quota can be specified in bytes (default), kbytes `k' appended) or mbytes (`m' appended). Thus `quota = 5m' will set the quota to 5 megabytes. Note that the user's startup file overrides system settings. random_file = FILE Use FILE as a source of randomness on systems lacking `/dev/random'. random_wait = on/off Turn random between-request wait times on or off. The same as `--random-wait'. read_timeout = N Set the read (and write) timeout--the same as `--read-timeout=N'. reclevel = N Recursion level (depth)--the same as `-l N'. recursive = on/off Recursive on/off--the same as `-r'. referer = STRING Set HTTP `Referer:' header just like `--referer=STRING'. (Note that it was the folks who wrote the HTTP spec who got the spelling of "referrer" wrong.) relative_only = on/off Follow only relative links--the same as `-L' (*note Relative Links::). remove_listing = on/off If set to on, remove FTP listings downloaded by Wget. Setting it to off is the same as `--no-remove-listing'. restrict_file_names = unix/windows Restrict the file names generated by Wget from URLs. See `--restrict-file-names' for a more detailed description. retr_symlinks = on/off When set to on, retrieve symbolic links as if they were plain files; the same as `--retr-symlinks'. retry_connrefused = on/off When set to on, consider "connection refused" a transient error--the same as `--retry-connrefused'. robots = on/off Specify whether the norobots convention is respected by Wget, "on" by default. This switch controls both the `/robots.txt' and the `nofollow' aspect of the spec. *Note Robot Exclusion::, for more details about this. Be sure you know what you are doing before turning this off. save_cookies = FILE Save cookies to FILE. The same as `--save-cookies FILE'. secure_protocol = STRING Choose the secure protocol to be used. Legal values are `auto' (the default), `SSLv2', `SSLv3', and `TLSv1'. The same as `--secure-protocol=STRING'. server_response = on/off Choose whether or not to print the HTTP and FTP server responses--the same as `-S'. span_hosts = on/off Same as `-H'. strict_comments = on/off Same as `--strict-comments'. timeout = N Set all applicable timeout values to N, the same as `-T N'. timestamping = on/off Turn timestamping on/off. The same as `-N' (*note Time-Stamping::). tries = N Set number of retries per URL--the same as `-t N'. use_proxy = on/off When set to off, don't use proxy even when proxy-related environment variables are set. In that case it is the same as using `--no-proxy'. user = STRING Specify username STRING for both FTP and HTTP file retrieval. This command can be overridden using the `ftp_user' and `http_user' command for FTP and HTTP respectively. verbose = on/off Turn verbose on/off--the same as `-v'/`-nv'. wait = N Wait N seconds between retrievals--the same as `-w N'. wait_retry = N Wait up to N seconds between retries of failed retrievals only--the same as `--waitretry=N'. Note that this is turned on by default in the global `wgetrc'.  File: wget.info, Node: Sample Wgetrc, Prev: Wgetrc Commands, Up: Startup File 6.4 Sample Wgetrc ================= This is the sample initialization file, as given in the distribution. It is divided in two section--one for global usage (suitable for global startup file), and one for local usage (suitable for `$HOME/.wgetrc'). Be careful about the things you change. Note that almost all the lines are commented out. For a command to have any effect, you must remove the `#' character at the beginning of its line. ### ### Sample Wget initialization file .wgetrc ### ## You can use this file to change the default behaviour of wget or to ## avoid having to type many many command-line options. This file does ## not contain a comprehensive list of commands -- look at the manual ## to find out what you can put into this file. ## ## Wget initialization file can reside in /usr/local/etc/wgetrc ## (global, for all users) or $HOME/.wgetrc (for a single user). ## ## To use the settings in this file, you will have to uncomment them, ## as well as change them, in most cases, as the values on the ## commented-out lines are the default values (e.g. "off"). ## ## Global settings (useful for setting up in /usr/local/etc/wgetrc). ## Think well before you change them, since they may reduce wget's ## functionality, and make it behave contrary to the documentation: ## # You can set retrieve quota for beginners by specifying a value # optionally followed by 'K' (kilobytes) or 'M' (megabytes). The # default quota is unlimited. #quota = inf # You can lower (or raise) the default number of retries when # downloading a file (default is 20). #tries = 20 # Lowering the maximum depth of the recursive retrieval is handy to # prevent newbies from going too "deep" when they unwittingly start # the recursive retrieval. The default is 5. #reclevel = 5 # By default Wget uses "passive FTP" transfer where the client # initiates the data connection to the server rather than the other # way around. That is required on systems behind NAT where the client # computer cannot be easily reached from the Internet. However, some # firewalls software explicitly supports active FTP and in fact has # problems supporting passive transfer. If you are in such # environment, use "passive_ftp = off" to revert to active FTP. #passive_ftp = off # The "wait" command below makes Wget wait between every connection. # If, instead, you want Wget to wait only between retries of failed # downloads, set waitretry to maximum number of seconds to wait (Wget # will use "linear backoff", waiting 1 second after the first failure # on a file, 2 seconds after the second failure, etc. up to this max). waitretry = 10 ## ## Local settings (for a user to set in his $HOME/.wgetrc). It is ## *highly* undesirable to put these settings in the global file, since ## they are potentially dangerous to "normal" users. ## ## Even when setting up your own ~/.wgetrc, you should know what you ## are doing before doing so. ## # Set this to on to use timestamping by default: #timestamping = off # It is a good idea to make Wget send your email address in a `From:' # header with your request (so that server administrators can contact # you in case of errors). Wget does *not* send `From:' by default. #header = From: Your Name # You can set up other headers, like Accept-Language. Accept-Language # is *not* sent by default. #header = Accept-Language: en # You can set the default proxies for Wget to use for http and ftp. # They will override the value in the environment. #http_proxy = http://proxy.yoyodyne.com:18023/ #ftp_proxy = http://proxy.yoyodyne.com:18023/ # If you do not want to use proxy at all, set this to off. #use_proxy = on # You can customize the retrieval outlook. Valid options are default, # binary, mega and micro. #dot_style = default # Setting this to off makes Wget not download /robots.txt. Be sure to # know *exactly* what /robots.txt is and how it is used before changing # the default! #robots = on # It can be useful to make Wget wait between connections. Set this to # the number of seconds you want Wget to wait. #wait = 0 # You can force creating directory structure, even if a single is being # retrieved, by setting this to on. #dirstruct = off # You can turn on recursive retrieving by default (don't do this if # you are not sure you know what it means) by setting this to on. #recursive = off # To always back up file X as X.orig before converting its links (due # to -k / --convert-links / convert_links = on having been specified), # set this variable to on: #backup_converted = off # To have Wget follow FTP links from HTML files by default, set this # to on: #follow_ftp = off  File: wget.info, Node: Examples, Next: Various, Prev: Startup File, Up: Top 7 Examples ********** The examples are divided into three sections loosely based on their complexity. * Menu: * Simple Usage:: Simple, basic usage of the program. * Advanced Usage:: Advanced tips. * Very Advanced Usage:: The hairy stuff.  File: wget.info, Node: Simple Usage, Next: Advanced Usage, Up: Examples 7.1 Simple Usage ================ * Say you want to download a URL. Just type: wget http://fly.srk.fer.hr/ * But what will happen if the connection is slow, and the file is lengthy? The connection will probably fail before the whole file is retrieved, more than once. In this case, Wget will try getting the file until it either gets the whole of it, or exceeds the default number of retries (this being 20). It is easy to change the number of tries to 45, to insure that the whole file will arrive safely: wget --tries=45 http://fly.srk.fer.hr/jpg/flyweb.jpg * Now let's leave Wget to work in the background, and write its progress to log file `log'. It is tiring to type `--tries', so we shall use `-t'. wget -t 45 -o log http://fly.srk.fer.hr/jpg/flyweb.jpg & The ampersand at the end of the line makes sure that Wget works in the background. To unlimit the number of retries, use `-t inf'. * The usage of FTP is as simple. Wget will take care of login and password. wget ftp://gnjilux.srk.fer.hr/welcome.msg * If you specify a directory, Wget will retrieve the directory listing, parse it and convert it to HTML. Try: wget ftp://ftp.gnu.org/pub/gnu/ links index.html  File: wget.info, Node: Advanced Usage, Next: Very Advanced Usage, Prev: Simple Usage, Up: Examples 7.2 Advanced Usage ================== * You have a file that contains the URLs you want to download? Use the `-i' switch: wget -i FILE If you specify `-' as file name, the URLs will be read from standard input. * Create a five levels deep mirror image of the GNU web site, with the same directory structure the original has, with only one try per document, saving the log of the activities to `gnulog': wget -r http://www.gnu.org/ -o gnulog * The same as the above, but convert the links in the HTML files to point to local files, so you can view the documents off-line: wget --convert-links -r http://www.gnu.org/ -o gnulog * Retrieve only one HTML page, but make sure that all the elements needed for the page to be displayed, such as inline images and external style sheets, are also downloaded. Also make sure the downloaded page references the downloaded links. wget -p --convert-links http://www.server.com/dir/page.html The HTML page will be saved to `www.server.com/dir/page.html', and the images, stylesheets, etc., somewhere under `www.server.com/', depending on where they were on the remote server. * The same as the above, but without the `www.server.com/' directory. In fact, I don't want to have all those random server directories anyway--just save _all_ those files under a `download/' subdirectory of the current directory. wget -p --convert-links -nH -nd -Pdownload \ http://www.server.com/dir/page.html * Retrieve the index.html of `www.lycos.com', showing the original server headers: wget -S http://www.lycos.com/ * Save the server headers with the file, perhaps for post-processing. wget --save-headers http://www.lycos.com/ more index.html * Retrieve the first two levels of `wuarchive.wustl.edu', saving them to `/tmp'. wget -r -l2 -P/tmp ftp://wuarchive.wustl.edu/ * You want to download all the GIFs from a directory on an HTTP server. You tried `wget http://www.server.com/dir/*.gif', but that didn't work because HTTP retrieval does not support globbing. In that case, use: wget -r -l1 --no-parent -A.gif http://www.server.com/dir/ More verbose, but the effect is the same. `-r -l1' means to retrieve recursively (*note Recursive Download::), with maximum depth of 1. `--no-parent' means that references to the parent directory are ignored (*note Directory-Based Limits::), and `-A.gif' means to download only the GIF files. `-A "*.gif"' would have worked too. * Suppose you were in the middle of downloading, when Wget was interrupted. Now you do not want to clobber the files already present. It would be: wget -nc -r http://www.gnu.org/ * If you want to encode your own username and password to HTTP or FTP, use the appropriate URL syntax (*note URL Format::). wget ftp://hniksic:mypassword@unix.server.com/.emacs Note, however, that this usage is not advisable on multi-user systems because it reveals your password to anyone who looks at the output of `ps'. * You would like the output documents to go to standard output instead of to files? wget -O - http://jagor.srce.hr/ http://www.srce.hr/ You can also combine the two options and make pipelines to retrieve the documents from remote hotlists: wget -O - http://cool.list.com/ | wget --force-html -i -  File: wget.info, Node: Very Advanced Usage, Prev: Advanced Usage, Up: Examples 7.3 Very Advanced Usage ======================= * If you wish Wget to keep a mirror of a page (or FTP subdirectories), use `--mirror' (`-m'), which is the shorthand for `-r -l inf -N'. You can put Wget in the crontab file asking it to recheck a site each Sunday: crontab 0 0 * * 0 wget --mirror http://www.gnu.org/ -o /home/me/weeklog * In addition to the above, you want the links to be converted for local viewing. But, after having read this manual, you know that link conversion doesn't play well with timestamping, so you also want Wget to back up the original HTML files before the conversion. Wget invocation would look like this: wget --mirror --convert-links --backup-converted \ http://www.gnu.org/ -o /home/me/weeklog * But you've also noticed that local viewing doesn't work all that well when HTML files are saved under extensions other than `.html', perhaps because they were served as `index.cgi'. So you'd like Wget to rename all the files served with content-type `text/html' or `application/xhtml+xml' to `NAME.html'. wget --mirror --convert-links --backup-converted \ --html-extension -o /home/me/weeklog \ http://www.gnu.org/ Or, with less typing: wget -m -k -K -E http://www.gnu.org/ -o /home/me/weeklog  File: wget.info, Node: Various, Next: Appendices, Prev: Examples, Up: Top 8 Various ********* This chapter contains all the stuff that could not fit anywhere else. * Menu: * Proxies:: Support for proxy servers. * Distribution:: Getting the latest version. * Web Site:: GNU Wget's presence on the World Wide Web. * Mailing List:: Wget mailing list for announcements and discussion. * Internet Relay Chat:: Wget's presence on IRC. * Reporting Bugs:: How and where to report bugs. * Portability:: The systems Wget works on. * Signals:: Signal-handling performed by Wget.  File: wget.info, Node: Proxies, Next: Distribution, Up: Various 8.1 Proxies =========== "Proxies" are special-purpose HTTP servers designed to transfer data from remote servers to local clients. One typical use of proxies is lightening network load for users behind a slow connection. This is achieved by channeling all HTTP and FTP requests through the proxy which caches the transferred data. When a cached resource is requested again, proxy will return the data from cache. Another use for proxies is for companies that separate (for security reasons) their internal networks from the rest of Internet. In order to obtain information from the Web, their users connect and retrieve remote data using an authorized proxy. Wget supports proxies for both HTTP and FTP retrievals. The standard way to specify proxy location, which Wget recognizes, is using the following environment variables: `http_proxy' `https_proxy' If set, the `http_proxy' and `https_proxy' variables should contain the URLs of the proxies for HTTP and HTTPS connections respectively. `ftp_proxy' This variable should contain the URL of the proxy for FTP connections. It is quite common that `http_proxy' and `ftp_proxy' are set to the same URL. `no_proxy' This variable should contain a comma-separated list of domain extensions proxy should _not_ be used for. For instance, if the value of `no_proxy' is `.mit.edu', proxy will not be used to retrieve documents from MIT. In addition to the environment variables, proxy location and settings may be specified from within Wget itself. `--no-proxy' `proxy = on/off' This option and the corresponding command may be used to suppress the use of proxy, even if the appropriate environment variables are set. `http_proxy = URL' `https_proxy = URL' `ftp_proxy = URL' `no_proxy = STRING' These startup file variables allow you to override the proxy settings specified by the environment. Some proxy servers require authorization to enable you to use them. The authorization consists of "username" and "password", which must be sent by Wget. As with HTTP authorization, several authentication schemes exist. For proxy authorization only the `Basic' authentication scheme is currently implemented. You may specify your username and password either through the proxy URL or through the command-line options. Assuming that the company's proxy is located at `proxy.company.com' at port 8001, a proxy URL location containing authorization data might look like this: http://hniksic:mypassword@proxy.company.com:8001/ Alternatively, you may use the `proxy-user' and `proxy-password' options, and the equivalent `.wgetrc' settings `proxy_user' and `proxy_password' to set the proxy username and password.  File: wget.info, Node: Distribution, Next: Web Site, Prev: Proxies, Up: Various 8.2 Distribution ================ Like all GNU utilities, the latest version of Wget can be found at the master GNU archive site ftp.gnu.org, and its mirrors. For example, Wget 1.11 can be found at `ftp://ftp.gnu.org/pub/gnu/wget/wget-1.11.tar.gz'  File: wget.info, Node: Web Site, Next: Mailing List, Prev: Distribution, Up: Various 8.3 Web Site ============ The official web site for GNU Wget is at `http://www.gnu.org/software/wget/'. However, most useful information resides at "The Wget Wgiki", `http://wget.addictivecode.org/'.  File: wget.info, Node: Mailing List, Next: Internet Relay Chat, Prev: Web Site, Up: Various 8.4 Mailing List ================ There are several Wget-related mailing lists. The general discussion list is at . It is the preferred place for support requests and suggestions, as well as for discussion of development. You are invited to subscribe. To subscribe, simply send mail to and follow the instructions. Unsubscribe by mailing to . The mailing list is archived at `http://www.mail-archive.com/wget%40sunsite.dk/' and at `http://news.gmane.org/gmane.comp.web.wget.general'. Another mailing list is at , and is used to submit patches for review by Wget developers. A "patch" is a textual representation of change to source code, readable by both humans and programs. The `http://wget.addictivecode.org/PatchGuidelines' page covers the creation and submitting of patches in detail. Please don't send general suggestions or bug reports to `wget-patches'; use it only for patch submissions. Subscription is the same as above for , except that you send to , instead. The mailing list is archived at `http://news.gmane.org/gmane.comp.web.wget.patches'. Finally, there is the mailing list. This is a non-discussion list that receives commit notifications from the source repository, and also bug report-change notifications. This is the highest-traffic list for Wget, and is recommended only for people who are seriously interested in ongoing Wget development. Subscription is through the `mailman' interface at `http://addictivecode.org/mailman/listinfo/wget-notify'.  File: wget.info, Node: Internet Relay Chat, Next: Reporting Bugs, Prev: Mailing List, Up: Various 8.5 Internet Relay Chat ======================= While, at the time of this writing, there is very low activity, we do have a support channel set up via IRC at `irc.freenode.org', `#wget'. Come check it out!  File: wget.info, Node: Reporting Bugs, Next: Portability, Prev: Internet Relay Chat, Up: Various 8.6 Reporting Bugs ================== You are welcome to submit bug reports via the GNU Wget bug tracker (see `http://wget.addictivecode.org/BugTracker'). Before actually submitting a bug report, please try to follow a few simple guidelines. 1. Please try to ascertain that the behavior you see really is a bug. If Wget crashes, it's a bug. If Wget does not behave as documented, it's a bug. If things work strange, but you are not sure about the way they are supposed to work, it might well be a bug, but you might want to double-check the documentation and the mailing lists (*note Mailing List::). 2. Try to repeat the bug in as simple circumstances as possible. E.g. if Wget crashes while downloading `wget -rl0 -kKE -t5 --no-proxy http://yoyodyne.com -o /tmp/log', you should try to see if the crash is repeatable, and if will occur with a simpler set of options. You might even try to start the download at the page where the crash occurred to see if that page somehow triggered the crash. Also, while I will probably be interested to know the contents of your `.wgetrc' file, just dumping it into the debug message is probably a bad idea. Instead, you should first try to see if the bug repeats with `.wgetrc' moved out of the way. Only if it turns out that `.wgetrc' settings affect the bug, mail me the relevant parts of the file. 3. Please start Wget with `-d' option and send us the resulting output (or relevant parts thereof). If Wget was compiled without debug support, recompile it--it is _much_ easier to trace bugs with debug support on. Note: please make sure to remove any potentially sensitive information from the debug log before sending it to the bug address. The `-d' won't go out of its way to collect sensitive information, but the log _will_ contain a fairly complete transcript of Wget's communication with the server, which may include passwords and pieces of downloaded data. Since the bug address is publically archived, you may assume that all bug reports are visible to the public. 4. If Wget has crashed, try to run it in a debugger, e.g. `gdb `which wget` core' and type `where' to get the backtrace. This may not work if the system administrator has disabled core files, but it is safe to try.  File: wget.info, Node: Portability, Next: Signals, Prev: Reporting Bugs, Up: Various 8.7 Portability =============== Like all GNU software, Wget works on the GNU system. However, since it uses GNU Autoconf for building and configuring, and mostly avoids using "special" features of any particular Unix, it should compile (and work) on all common Unix flavors. Various Wget versions have been compiled and tested under many kinds of Unix systems, including GNU/Linux, Solaris, SunOS 4.x, Mac OS X, OSF (aka Digital Unix or Tru64), Ultrix, *BSD, IRIX, AIX, and others. Some of those systems are no longer in widespread use and may not be able to support recent versions of Wget. If Wget fails to compile on your system, we would like to know about it. Thanks to kind contributors, this version of Wget compiles and works on 32-bit Microsoft Windows platforms. It has been compiled successfully using MS Visual C++ 6.0, Watcom, Borland C, and GCC compilers. Naturally, it is crippled of some features available on Unix, but it should work as a substitute for people stuck with Windows. Note that Windows-specific portions of Wget are not guaranteed to be supported in the future, although this has been the case in practice for many years now. All questions and problems in Windows usage should be reported to Wget mailing list at where the volunteers who maintain the Windows-related features might look at them. Support for building on MS-DOS via DJGPP has been contributed by Gisle Vanem; a port to VMS is maintained by Steven Schweda, and is available at `http://antinode.org/'.  File: wget.info, Node: Signals, Prev: Portability, Up: Various 8.8 Signals =========== Since the purpose of Wget is background work, it catches the hangup signal (`SIGHUP') and ignores it. If the output was on standard output, it will be redirected to a file named `wget-log'. Otherwise, `SIGHUP' is ignored. This is convenient when you wish to redirect the output of Wget after having started it. $ wget http://www.gnus.org/dist/gnus.tar.gz & ... $ kill -HUP %% SIGHUP received, redirecting output to `wget-log'. Other than that, Wget will not try to interfere with signals in any way. `C-c', `kill -TERM' and `kill -KILL' should kill it alike.  File: wget.info, Node: Appendices, Next: Copying this manual, Prev: Various, Up: Top 9 Appendices ************ This chapter contains some references I consider useful. * Menu: * Robot Exclusion:: Wget's support for RES. * Security Considerations:: Security with Wget. * Contributors:: People who helped.  File: wget.info, Node: Robot Exclusion, Next: Security Considerations, Up: Appendices 9.1 Robot Exclusion =================== It is extremely easy to make Wget wander aimlessly around a web site, sucking all the available data in progress. `wget -r SITE', and you're set. Great? Not for the server admin. As long as Wget is only retrieving static pages, and doing it at a reasonable rate (see the `--wait' option), there's not much of a problem. The trouble is that Wget can't tell the difference between the smallest static page and the most demanding CGI. A site I know has a section handled by a CGI Perl script that converts Info files to HTML on the fly. The script is slow, but works well enough for human users viewing an occasional Info file. However, when someone's recursive Wget download stumbles upon the index page that links to all the Info files through the script, the system is brought to its knees without providing anything useful to the user (This task of converting Info files could be done locally and access to Info documentation for all installed GNU software on a system is available from the `info' command). To avoid this kind of accident, as well as to preserve privacy for documents that need to be protected from well-behaved robots, the concept of "robot exclusion" was invented. The idea is that the server administrators and document authors can specify which portions of the site they wish to protect from robots and those they will permit access. The most popular mechanism, and the de facto standard supported by all the major robots, is the "Robots Exclusion Standard" (RES) written by Martijn Koster et al. in 1994. It specifies the format of a text file containing directives that instruct the robots which URL paths to avoid. To be found by the robots, the specifications must be placed in `/robots.txt' in the server root, which the robots are expected to download and parse. Although Wget is not a web robot in the strictest sense of the word, it can downloads large parts of the site without the user's intervention to download an individual page. Because of that, Wget honors RES when downloading recursively. For instance, when you issue: wget -r http://www.server.com/ First the index of `www.server.com' will be downloaded. If Wget finds that it wants to download more documents from that server, it will request `http://www.server.com/robots.txt' and, if found, use it for further downloads. `robots.txt' is loaded only once per each server. Until version 1.8, Wget supported the first version of the standard, written by Martijn Koster in 1994 and available at `http://www.robotstxt.org/wc/norobots.html'. As of version 1.8, Wget has supported the additional directives specified in the internet draft `' titled "A Method for Web Robots Control". The draft, which has as far as I know never made to an RFC, is available at `http://www.robotstxt.org/wc/norobots-rfc.txt'. This manual no longer includes the text of the Robot Exclusion Standard. The second, less known mechanism, enables the author of an individual document to specify whether they want the links from the file to be followed by a robot. This is achieved using the `META' tag, like this: This is explained in some detail at `http://www.robotstxt.org/wc/meta-user.html'. Wget supports this method of robot exclusion in addition to the usual `/robots.txt' exclusion. If you know what you are doing and really really wish to turn off the robot exclusion, set the `robots' variable to `off' in your `.wgetrc'. You can achieve the same effect from the command line using the `-e' switch, e.g. `wget -e robots=off URL...'.  File: wget.info, Node: Security Considerations, Next: Contributors, Prev: Robot Exclusion, Up: Appendices 9.2 Security Considerations =========================== When using Wget, you must be aware that it sends unencrypted passwords through the network, which may present a security problem. Here are the main issues, and some solutions. 1. The passwords on the command line are visible using `ps'. The best way around it is to use `wget -i -' and feed the URLs to Wget's standard input, each on a separate line, terminated by `C-d'. Another workaround is to use `.netrc' to store passwords; however, storing unencrypted passwords is also considered a security risk. 2. Using the insecure "basic" authentication scheme, unencrypted passwords are transmitted through the network routers and gateways. 3. The FTP passwords are also in no way encrypted. There is no good solution for this at the moment. 4. Although the "normal" output of Wget tries to hide the passwords, debugging logs show them, in all forms. This problem is avoided by being careful when you send debug logs (yes, even when you send them to me).  File: wget.info, Node: Contributors, Prev: Security Considerations, Up: Appendices 9.3 Contributors ================ GNU Wget was written by Hrvoje Niksic , and it is currently maintained by Micah Cowan . However, the development of Wget could never have gone as far as it has, were it not for the help of many people, either with bug reports, feature proposals, patches, or letters saying "Thanks!". Special thanks goes to the following people (no particular order): * Dan Harkless--contributed a lot of code and documentation of extremely high quality, as well as the `--page-requisites' and related options. He was the principal maintainer for some time and released Wget 1.6. * Ian Abbott--contributed bug fixes, Windows-related fixes, and provided a prototype implementation of the breadth-first recursive download. Co-maintained Wget during the 1.8 release cycle. * The dotsrc.org crew, in particular Karsten Thygesen--donated system resources such as the mailing list, web space, FTP space, and version control repositories, along with a lot of time to make these actually work. Christian Reiniger was of invaluable help with setting up Subversion. * Heiko Herold--provided high-quality Windows builds and contributed bug and build reports for many years. * Shawn McHorse--bug reports and patches. * Kaveh R. Ghazi--on-the-fly `ansi2knr'-ization. Lots of portability fixes. * Gordon Matzigkeit--`.netrc' support. * Zlatko Calusic, Tomislav Vujec and Drazen Kacar--feature suggestions and "philosophical" discussions. * Darko Budor--initial port to Windows. * Antonio Rosella--help and suggestions, plus the initial Italian translation. * Tomislav Petrovic, Mario Mikocevic--many bug reports and suggestions. * Francois Pinard--many thorough bug reports and discussions. * Karl Eichwalder--lots of help with internationalization, Makefile layout and many other things. * Junio Hamano--donated support for Opie and HTTP `Digest' authentication. * Mauro Tortonesi--Improved IPv6 support, adding support for dual family systems. Refactored and enhanced FTP IPv6 code. Maintained GNU Wget from 2004-2008. * Christopher G. Lewis--Maintenance of the Windows version of GNU WGet. * Gisle Vanem--Many helpful patches and improvements, especially for Windows and MS-DOS support. * People who provided donations for development--including Brian Gough. The following people have provided patches, bug/build reports, useful suggestions, beta testing services, fan mail and all the other things that make maintenance so much fun: Tim Adam, Adrian Aichner, Martin Baehr, Dieter Baron, Roger Beeman, Dan Berger, T. Bharath, Christian Biere, Paul Bludov, Daniel Bodea, Mark Boyns, John Burden, Wanderlei Cavassin, Gilles Cedoc, Tim Charron, Noel Cragg, Kristijan Conkas, John Daily, Andreas Damm, Ahmon Dancy, Andrew Davison, Bertrand Demiddelaer, Andrew Deryabin, Ulrich Drepper, Marc Duponcheel, Damir Dzeko, Alan Eldridge, Hans-Andreas Engel, Aleksandar Erkalovic, Andy Eskilsson, Christian Fraenkel, David Fritz, Charles C. Fu, FUJISHIMA Satsuki, Masashi Fujita, Howard Gayle, Marcel Gerrits, Lemble Gregory, Hans Grobler, Mathieu Guillaume, Aaron Hawley, Jochen Hein, Karl Heuer, HIROSE Masaaki, Ulf Harnhammar, Gregor Hoffleit, Erik Magnus Hulthen, Richard Huveneers, Jonas Jensen, Larry Jones, Simon Josefsson, Mario Juric, Hack Kampbjorn, Const Kaplinsky, Goran Kezunovic, Igor Khristophorov, Robert Kleine, KOJIMA Haime, Fila Kolodny, Alexander Kourakos, Martin Kraemer, Sami Krank, Simos KSenitellis, Christian Lackas, Hrvoje Lacko, Daniel S. Lewart, Nicolas Lichtmeier, Dave Love, Alexander V. Lukyanov, Thomas Lussnig, Andre Majorel, Aurelien Marchand, Matthew J. Mellon, Jordan Mendelson, Lin Zhe Min, Jan Minar, Tim Mooney, Keith Moore, Adam D. Moss, Simon Munton, Charlie Negyesi, R. K. Owen, Leonid Petrov, Simone Piunno, Andrew Pollock, Steve Pothier, Jan Prikryl, Marin Purgar, Csaba Raduly, Keith Refson, Bill Richardson, Tyler Riddle, Tobias Ringstrom, Jochen Roderburg, Juan Jose Rodriguez, Maciej W. Rozycki, Edward J. Sabol, Heinz Salzmann, Robert Schmidt, Nicolas Schodet, Andreas Schwab, Steven M. Schweda, Chris Seawood, Dennis Smit, Toomas Soome, Tage Stabell-Kulo, Philip Stadermann, Daniel Stenberg, Sven Sternberger, Markus Strasser, John Summerfield, Szakacsits Szabolcs, Mike Thomas, Philipp Thomas, Mauro Tortonesi, Dave Turner, Gisle Vanem, Russell Vincent, Zeljko Vrba, Charles G Waldman, Douglas E. Wegscheid, Ralf Wildenhues, Joshua David Williams, YAMAZAKI Makoto, Jasmin Zainul, Bojan Zdrnja, Kristijan Zimmer. Apologies to all who I accidentally left out, and many thanks to all the subscribers of the Wget mailing list.  File: wget.info, Node: Copying this manual, Next: Concept Index, Prev: Appendices, Up: Top Appendix A Copying this manual ****************************** * Menu: * GNU Free Documentation License:: Licnse for copying this manual.  File: wget.info, Node: GNU Free Documentation License, Up: Copying this manual A.1 GNU Free Documentation License ================================== Version 1.2, November 2002 Copyright (C) 2000,2001,2002 Free Software Foundation, Inc. 51 Franklin St, Fifth Floor, Boston, MA 02110-1301, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. 0. PREAMBLE The purpose of this License is to make a manual, textbook, or other functional and useful document "free" in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others. This License is a kind of "copyleft", which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software. We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference. 1. APPLICABILITY AND DEFINITIONS This License applies to any manual or other work, in any medium, that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. Such a notice grants a world-wide, royalty-free license, unlimited in duration, to use that work under the conditions stated herein. The "Document", below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as "you". You accept the license if you copy, modify or distribute the work in a way requiring permission under copyright law. A "Modified Version" of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language. A "Secondary Section" is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document's overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (Thus, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them. The "Invariant Sections" are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. If a section does not fit the above definition of Secondary then it is not allowed to be designated as Invariant. The Document may contain zero Invariant Sections. If the Document does not identify any Invariant Sections then there are none. The "Cover Texts" are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A Front-Cover Text may be at most 5 words, and a Back-Cover Text may be at most 25 words. A "Transparent" copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, that is suitable for revising the document straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup, or absence of markup, has been arranged to thwart or discourage subsequent modification by readers is not Transparent. An image format is not Transparent if used for any substantial amount of text. A copy that is not "Transparent" is called "Opaque". Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML, PostScript or PDF designed for human modification. Examples of transparent image formats include PNG, XCF and JPG. Opaque formats include proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML, PostScript or PDF produced by some word processors for output purposes only. The "Title Page" means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, "Title Page" means the text near the most prominent appearance of the work's title, preceding the beginning of the body of the text. A section "Entitled XYZ" means a named subunit of the Document whose title either is precisely XYZ or contains XYZ in parentheses following text that translates XYZ in another language. (Here XYZ stands for a specific section name mentioned below, such as "Acknowledgements", "Dedications", "Endorsements", or "History".) To "Preserve the Title" of such a section when you modify the Document means that it remains a section "Entitled XYZ" according to this definition. The Document may include Warranty Disclaimers next to the notice which states that this License applies to the Document. These Warranty Disclaimers are considered to be included by reference in this License, but only as regards disclaiming warranties: any other implication that these Warranty Disclaimers may have is void and has no effect on the meaning of this License. 2. VERBATIM COPYING You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3. You may also lend copies, under the same conditions stated above, and you may publicly display copies. 3. COPYING IN QUANTITY If you publish printed copies (or copies in media that commonly have printed covers) of the Document, numbering more than 100, and the Document's license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects. If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages. If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a computer-network location from which the general network-using public has access to download using public-standard network protocols a complete Transparent copy of the Document, free of added material. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public. It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document. 4. MODIFICATIONS You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version: A. Use in the Title Page (and on the covers, if any) a title distinct from that of the Document, and from those of previous versions (which should, if there were any, be listed in the History section of the Document). You may use the same title as a previous version if the original publisher of that version gives permission. B. List on the Title Page, as authors, one or more persons or entities responsible for authorship of the modifications in the Modified Version, together with at least five of the principal authors of the Document (all of its principal authors, if it has fewer than five), unless they release you from this requirement. C. State on the Title page the name of the publisher of the Modified Version, as the publisher. D. Preserve all the copyright notices of the Document. E. Add an appropriate copyright notice for your modifications adjacent to the other copyright notices. F. Include, immediately after the copyright notices, a license notice giving the public permission to use the Modified Version under the terms of this License, in the form shown in the Addendum below. G. Preserve in that license notice the full lists of Invariant Sections and required Cover Texts given in the Document's license notice. H. Include an unaltered copy of this License. I. Preserve the section Entitled "History", Preserve its Title, and add to it an item stating at least the title, year, new authors, and publisher of the Modified Version as given on the Title Page. If there is no section Entitled "History" in the Document, create one stating the title, year, authors, and publisher of the Document as given on its Title Page, then add an item describing the Modified Version as stated in the previous sentence. J. Preserve the network location, if any, given in the Document for public access to a Transparent copy of the Document, and likewise the network locations given in the Document for previous versions it was based on. These may be placed in the "History" section. You may omit a network location for a work that was published at least four years before the Document itself, or if the original publisher of the version it refers to gives permission. K. For any section Entitled "Acknowledgements" or "Dedications", Preserve the Title of the section, and preserve in the section all the substance and tone of each of the contributor acknowledgements and/or dedications given therein. L. Preserve all the Invariant Sections of the Document, unaltered in their text and in their titles. Section numbers or the equivalent are not considered part of the section titles. M. Delete any section Entitled "Endorsements". Such a section may not be included in the Modified Version. N. Do not retitle any existing section to be Entitled "Endorsements" or to conflict in title with any Invariant Section. O. Preserve any Warranty Disclaimers. If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version's license notice. These titles must be distinct from any other section titles. You may add a section Entitled "Endorsements", provided it contains nothing but endorsements of your Modified Version by various parties--for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard. You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one. The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version. 5. COMBINING DOCUMENTS You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice, and that you preserve all their Warranty Disclaimers. The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work. In the combination, you must combine any sections Entitled "History" in the various original documents, forming one section Entitled "History"; likewise combine any sections Entitled "Acknowledgements", and any sections Entitled "Dedications". You must delete all sections Entitled "Endorsements." 6. COLLECTIONS OF DOCUMENTS You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects. You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document. 7. AGGREGATION WITH INDEPENDENT WORKS A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, is called an "aggregate" if the copyright resulting from the compilation is not used to limit the legal rights of the compilation's users beyond what the individual works permit. When the Document is included in an aggregate, this License does not apply to the other works in the aggregate which are not themselves derivative works of the Document. If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one half of the entire aggregate, the Document's Cover Texts may be placed on covers that bracket the Document within the aggregate, or the electronic equivalent of covers if the Document is in electronic form. Otherwise they must appear on printed covers that bracket the whole aggregate. 8. TRANSLATION Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License, and all the license notices in the Document, and any Warranty Disclaimers, provided that you also include the original English version of this License and the original versions of those notices and disclaimers. In case of a disagreement between the translation and the original version of this License or a notice or disclaimer, the original version will prevail. If a section in the Document is Entitled "Acknowledgements", "Dedications", or "History", the requirement (section 4) to Preserve its Title (section 1) will typically require changing the actual title. 9. TERMINATION You may not copy, modify, sublicense, or distribute the Document except as expressly provided for under this License. Any other attempt to copy, modify, sublicense or distribute the Document is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 10. FUTURE REVISIONS OF THIS LICENSE The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See `http://www.gnu.org/copyleft/'. Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License "or any later version" applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. ADDENDUM: How to use this License for your documents ==================================================== To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page: Copyright (C) YEAR YOUR NAME. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled ``GNU Free Documentation License''. If you have Invariant Sections, Front-Cover Texts and Back-Cover Texts, replace the "with...Texts." line with this: with the Invariant Sections being LIST THEIR TITLES, with the Front-Cover Texts being LIST, and with the Back-Cover Texts being LIST. If you have Invariant Sections without Cover Texts, or some other combination of the three, merge those two alternatives to suit the situation. If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software.  File: wget.info, Node: Concept Index, Prev: Copying this manual, Up: Top Concept Index ************* [index] * Menu: * #wget: Internet Relay Chat. (line 6) * .html extension: HTTP Options. (line 6) * .listing files, removing: FTP Options. (line 21) * .netrc: Startup File. (line 6) * .wgetrc: Startup File. (line 6) * accept directories: Directory-Based Limits. (line 17) * accept suffixes: Types of Files. (line 15) * accept wildcards: Types of Files. (line 15) * append to log: Logging and Input File Options. (line 11) * arguments: Invoking. (line 6) * authentication <1>: HTTP Options. (line 27) * authentication: Download Options. (line 418) * backing up converted files: Recursive Retrieval Options. (line 71) * bandwidth, limit: Download Options. (line 223) * base for relative links in input file: Logging and Input File Options. (line 68) * bind address: Download Options. (line 6) * bug reports: Reporting Bugs. (line 6) * bugs: Reporting Bugs. (line 6) * cache: HTTP Options. (line 43) * caching of DNS lookups: Download Options. (line 310) * case fold: Recursive Accept/Reject Options. (line 51) * client IP address: Download Options. (line 6) * clobbering, file: Download Options. (line 37) * command line: Invoking. (line 6) * comments, HTML: Recursive Retrieval Options. (line 149) * connect timeout: Download Options. (line 206) * Content-Disposition: HTTP Options. (line 262) * Content-Length, ignore: HTTP Options. (line 132) * continue retrieval: Download Options. (line 71) * contributors: Contributors. (line 6) * conversion of links: Recursive Retrieval Options. (line 32) * cookies: HTTP Options. (line 52) * cookies, loading: HTTP Options. (line 62) * cookies, saving: HTTP Options. (line 110) * cookies, session: HTTP Options. (line 115) * cut directories: Directory Options. (line 32) * debug: Logging and Input File Options. (line 17) * delete after retrieval: Recursive Retrieval Options. (line 16) * directories: Directory-Based Limits. (line 6) * directories, exclude: Directory-Based Limits. (line 30) * directories, include: Directory-Based Limits. (line 17) * directory limits: Directory-Based Limits. (line 6) * directory prefix: Directory Options. (line 60) * DNS cache: Download Options. (line 310) * DNS timeout: Download Options. (line 200) * dot style: Download Options. (line 132) * downloading multiple times: Download Options. (line 37) * EGD: HTTPS (SSL/TLS) Options. (line 101) * entropy, specifying source of: HTTPS (SSL/TLS) Options. (line 85) * examples: Examples. (line 6) * exclude directories: Directory-Based Limits. (line 30) * execute wgetrc command: Basic Startup Options. (line 19) * FDL, GNU Free Documentation License: GNU Free Documentation License. (line 6) * features: Overview. (line 6) * file names, restrict: Download Options. (line 329) * filling proxy cache: Recursive Retrieval Options. (line 16) * follow FTP links: Recursive Accept/Reject Options. (line 23) * following ftp links: FTP Links. (line 6) * following links: Following Links. (line 6) * force html: Logging and Input File Options. (line 61) * ftp authentication: FTP Options. (line 6) * ftp password: FTP Options. (line 6) * ftp time-stamping: FTP Time-Stamping Internals. (line 6) * ftp user: FTP Options. (line 6) * globbing, toggle: FTP Options. (line 45) * hangup: Signals. (line 6) * header, add: HTTP Options. (line 143) * hosts, spanning: Spanning Hosts. (line 6) * HTML comments: Recursive Retrieval Options. (line 149) * http password: HTTP Options. (line 27) * http referer: HTTP Options. (line 184) * http time-stamping: HTTP Time-Stamping Internals. (line 6) * http user: HTTP Options. (line 27) * ignore case: Recursive Accept/Reject Options. (line 51) * ignore length: HTTP Options. (line 132) * include directories: Directory-Based Limits. (line 17) * incomplete downloads: Download Options. (line 71) * incremental updating: Time-Stamping. (line 6) * input-file: Logging and Input File Options. (line 43) * Internet Relay Chat: Internet Relay Chat. (line 6) * invoking: Invoking. (line 6) * IP address, client: Download Options. (line 6) * IPv6: Download Options. (line 364) * IRC: Internet Relay Chat. (line 6) * Keep-Alive, turning off: FTP Options. (line 92) * latest version: Distribution. (line 6) * limit bandwidth: Download Options. (line 223) * link conversion: Recursive Retrieval Options. (line 32) * links: Following Links. (line 6) * list: Mailing List. (line 6) * loading cookies: HTTP Options. (line 62) * location of wgetrc: Wgetrc Location. (line 6) * log file: Logging and Input File Options. (line 6) * mailing list: Mailing List. (line 6) * mirroring: Very Advanced Usage. (line 6) * no parent: Directory-Based Limits. (line 43) * no-clobber: Download Options. (line 37) * nohup: Invoking. (line 6) * number of retries: Download Options. (line 12) * operating systems: Portability. (line 6) * option syntax: Option Syntax. (line 6) * output file: Logging and Input File Options. (line 6) * overview: Overview. (line 6) * page requisites: Recursive Retrieval Options. (line 84) * passive ftp: FTP Options. (line 61) * password: Download Options. (line 418) * pause: Download Options. (line 243) * Persistent Connections, disabling: FTP Options. (line 92) * portability: Portability. (line 6) * POST: HTTP Options. (line 217) * progress indicator: Download Options. (line 132) * proxies: Proxies. (line 6) * proxy <1>: HTTP Options. (line 43) * proxy: Download Options. (line 287) * proxy authentication: HTTP Options. (line 175) * proxy filling: Recursive Retrieval Options. (line 16) * proxy password: HTTP Options. (line 175) * proxy user: HTTP Options. (line 175) * quiet: Logging and Input File Options. (line 28) * quota: Download Options. (line 294) * random wait: Download Options. (line 269) * randomness, specifying source of: HTTPS (SSL/TLS) Options. (line 85) * rate, limit: Download Options. (line 223) * read timeout: Download Options. (line 211) * recursion: Recursive Download. (line 6) * recursive download: Recursive Download. (line 6) * redirect: HTTP Options. (line 169) * redirecting output: Advanced Usage. (line 88) * referer, http: HTTP Options. (line 184) * reject directories: Directory-Based Limits. (line 30) * reject suffixes: Types of Files. (line 34) * reject wildcards: Types of Files. (line 34) * relative links: Relative Links. (line 6) * reporting bugs: Reporting Bugs. (line 6) * required images, downloading: Recursive Retrieval Options. (line 84) * resume download: Download Options. (line 71) * retries: Download Options. (line 12) * retries, waiting between: Download Options. (line 257) * retrieving: Recursive Download. (line 6) * robot exclusion: Robot Exclusion. (line 6) * robots.txt: Robot Exclusion. (line 6) * sample wgetrc: Sample Wgetrc. (line 6) * saving cookies: HTTP Options. (line 110) * security: Security Considerations. (line 6) * server maintenance: Robot Exclusion. (line 6) * server response, print: Download Options. (line 166) * server response, save: HTTP Options. (line 191) * session cookies: HTTP Options. (line 115) * signal handling: Signals. (line 6) * spanning hosts: Spanning Hosts. (line 6) * spider: Download Options. (line 171) * SSL: HTTPS (SSL/TLS) Options. (line 6) * SSL certificate: HTTPS (SSL/TLS) Options. (line 47) * SSL certificate authority: HTTPS (SSL/TLS) Options. (line 73) * SSL certificate type, specify: HTTPS (SSL/TLS) Options. (line 53) * SSL certificate, check: HTTPS (SSL/TLS) Options. (line 23) * SSL protocol, choose: HTTPS (SSL/TLS) Options. (line 10) * startup: Startup File. (line 6) * startup file: Startup File. (line 6) * suffixes, accept: Types of Files. (line 15) * suffixes, reject: Types of Files. (line 34) * symbolic links, retrieving: FTP Options. (line 73) * syntax of options: Option Syntax. (line 6) * syntax of wgetrc: Wgetrc Syntax. (line 6) * tag-based recursive pruning: Recursive Accept/Reject Options. (line 27) * time-stamping: Time-Stamping. (line 6) * time-stamping usage: Time-Stamping Usage. (line 6) * timeout: Download Options. (line 182) * timeout, connect: Download Options. (line 206) * timeout, DNS: Download Options. (line 200) * timeout, read: Download Options. (line 211) * timestamping: Time-Stamping. (line 6) * tries: Download Options. (line 12) * types of files: Types of Files. (line 6) * updating the archives: Time-Stamping. (line 6) * URL: URL Format. (line 6) * URL syntax: URL Format. (line 6) * usage, time-stamping: Time-Stamping Usage. (line 6) * user: Download Options. (line 418) * user-agent: HTTP Options. (line 195) * various: Various. (line 6) * verbose: Logging and Input File Options. (line 32) * wait: Download Options. (line 243) * wait, random: Download Options. (line 269) * waiting between retries: Download Options. (line 257) * web site: Web Site. (line 6) * Wget as spider: Download Options. (line 171) * wgetrc: Startup File. (line 6) * wgetrc commands: Wgetrc Commands. (line 6) * wgetrc location: Wgetrc Location. (line 6) * wgetrc syntax: Wgetrc Syntax. (line 6) * wildcards, accept: Types of Files. (line 15) * wildcards, reject: Types of Files. (line 34) * Windows file names: Download Options. (line 329)  Tag Table: Node: Top888 Node: Overview1753 Node: Invoking5337 Node: URL Format6174 Ref: URL Format-Footnote-18747 Node: Option Syntax8849 Node: Basic Startup Options11531 Node: Logging and Input File Options12336 Node: Download Options14989 Node: Directory Options35150 Node: HTTP Options37855 Node: HTTPS (SSL/TLS) Options50572 Node: FTP Options56247 Node: Recursive Retrieval Options61300 Node: Recursive Accept/Reject Options69168 Node: Recursive Download72628 Node: Following Links75739 Node: Spanning Hosts76676 Node: Types of Files78849 Node: Directory-Based Limits81309 Node: Relative Links83959 Node: FTP Links84796 Node: Time-Stamping85663 Node: Time-Stamping Usage87307 Node: HTTP Time-Stamping Internals89133 Ref: HTTP Time-Stamping Internals-Footnote-190409 Node: FTP Time-Stamping Internals90608 Node: Startup File92074 Node: Wgetrc Location92948 Node: Wgetrc Syntax93747 Node: Wgetrc Commands94467 Node: Sample Wgetrc107934 Node: Examples113136 Node: Simple Usage113476 Node: Advanced Usage114880 Node: Very Advanced Usage118581 Node: Various120076 Node: Proxies120717 Node: Distribution123552 Node: Web Site123890 Node: Mailing List124184 Node: Internet Relay Chat125965 Node: Reporting Bugs126279 Node: Portability128797 Node: Signals130422 Node: Appendices131105 Node: Robot Exclusion131439 Node: Security Considerations135216 Node: Contributors136400 Node: Copying this manual141296 Node: GNU Free Documentation License141535 Node: Concept Index163931  End Tag Table packages/wget/1.11/packageinfo-bin0000644000175200017520000000002311517102174016554 0ustar tyndurtyndurwget 1.11 bin i386 packages/wget/1.11/postinstall-bin0000644000175200017520000000010611517102174016663 0ustar tyndurtyndur#!file:/apps/sh lpt cfg-addbin file:/packages/wget/1.11/bin/wget wget