packages/0000755000175200017520000000000011517101520012265 5ustar tyndurtyndurpackages/e2fsprogs/0000755000175200017520000000000011517101523014202 5ustar tyndurtyndurpackages/e2fsprogs/bin/0000755000175200017520000000000011517101523014752 5ustar tyndurtyndurpackages/e2fsprogs/bin/fsck0000755000175200017520000120621711517101521015635 0ustar tyndurtyndurELF@@44 (@@  @@l QtdS.U=@t8v$@ҡ$@ut h` @!@ÐUth@h` @@tt h@ЃÐQSP UWVS] _jvuyt&{vSv苭EE$D$y$@")ċEt$|$ t$D$$@=@s& @sBwҁ@rt$<$"á%@$#$3É$yǍ")čt$|$t$$oUWVStvÉvʍJCRtS9\uQAEt?1US]j=ƒtL(XBBB Ћ]ÍvUWVS Eue[^_ÍvE8L(uE tދEt׃ ً} 1Q=ً}1щ $<ÃtptVu V&EY_uSEUBt Pe9}G t PO9EpX 1I V393& P9UVS]tHCBsC9t PC9uCt P8]e[^8e[^ÐUj4j@t‰B@BB f1҉ÐUWVS Nj0t!v^ 6W84$O8ރue[^_UWVS u} tIt1 GPe;ÃtPWVScB;؍e[^_f1эy뼐1ۉ؍e[^_UjufUWVSƉj:Ãt VtCe[^_à Su7UWVSXuLrƃ 1}I VoqƒZ1򮋅)=ẁz.uBt<.vSuh*@P藶Y[URPkxE%puU 9UtZUi=@^EPRcl@E%p=@-U PsU Vqe[^_Àz,UWVSEEE@t1ۍvU(@Cu}uf]tGCEVWu3GX35$5EuEuƋEEE]uEEe[^_UVSƊtv\uF>tFue[^Ð PP3utFUSÊu vCt P3u؋]ÍvUWS1эA;t$< GO;t GP2u؍e[_ÐUWVSlEtJjEpadƃx1EPV+ixEU;BtBt VZ^e[^_Ãh@VdÃtՍPShPَ0t*vw>PS)PP蠎t1эQ\tNJq<#i@Rj>Pz>ƅ1@x>]j<=t5@ ut G +PZƃyPjVuy  V_2j=|=ƅMF8"8t @@u?WjjBA b S腅UbEBi @ucVjj9G@j"P<OW0 W+v@u!QjjBA$1IQ `j V0UWVS}u ]}EEtaPSVutK Pr$jÃEt P%0Et P0tK؍e[^_Ð1ǃj=V!;tjREPEPVSEtdUtdƉd uA؍e[^_ÃjEP~.v1ۉ؍e[^_à VÃ81D11vUVSu]t~utbQjSu7 t@u Pt- pBÃu u؍e[^f1ۅt؍e[^ÃjEPy1ۉ؍e[^ÐUWVS\ME9@PU\EPucƃWyEh@uE EEE9u }19]ttKtC8/us$s hH@uxC{s9twwh*@uix?9uPsh3@uOx19]ux Ub uhE9EtYo 1}уQ0Ãt-WuhA@P$QZYSuo_$7-Et' u"-e[^_Ã=)@1e[^_þe[^_Ãju^xӋE%p= ` 1}уQ/E>Ruh@PNXuhÃxyh@PN\E_XhS_]UU RPh @uv6E@5)@ u[PhP_UVSUM ]u [^Ð:L(urB9tFFB1UWVS ׅu 1e[^_ÍvtXp9u9t݃Ws6u؍e[^_ÐUWVS U} u 1ۉ؍e[^_ÐtBr9tfÃWpn6tЋ9uƍvUEuËM tu PUtt݃up6ÅfUWVS EuEEe[^_ËE t}t uEvU EXx9EE v9tIsuvm5uFU9P~׃jp[uËvuFE9uutDUB(8RuEO@(U EE]t&E@ PE uEvUEt8L(t)US]tJCBSC BCt P(Ct P(]](v]ÍvUS]j +ƒtL(XCBЋ]UWVS ]u e[^_Ãj=S3ƅt߃ S~ǃt)ލ0XP"t#'t STt*U :U1뜍XPS2tƃ W'jUjj/t‰B@BB f1҉fUWVS ]ue[^_ÍvM tuu;E~@u CEu SƃE~uWv2t3 W'EFsEtMU tN1I u&14k@u S,U] V}sDž u GUW_S { CW:sMʉEtesEH WP GO q@u tEsK0MUw?EtO u MAtMsV N FQ bEt u% WV W@Xu7U1ÐUEfUS]jCK1҉]fUWVS }u u 1ۉ؍e[^_Ðt9u$9Vs0uEtƒSWÃt@(t7E9tF(SFPR/S,UtF,tPR/umC0EtF0tPut/uIEF,t7MV0t%VWt@(u PfU9E%Eu1EÅ@$ VC{G_;COF,uQF0uWUDH tu9s19w)@ÍvU1ÐUWVSׅ~GtAq 1 v t.1ȉƒ3@ƒ3 @Fu;KuC E̍S!MͿfBF!tA@DDt-ABF!uj&EPhq@Ep1e[^_ËEEƉ]EfUjE(Phk@Ep]1ÐUS]( PShk@Ep-1]fUS]jjhq@s jjhk@s1]ÐUEP0x0tjRhk@Ep1Ív1UEPxtjRhk@Ep1Ív1US8j(EP]S}*j(Shq@Epb1]ÍvUWVSHE։Rt e[^_Ív}WVtj%WSue[^_ûq@fUVS]uj@Phk@sPC1s1e[^fUVS]sЉ9Ct e[^C9Su)C9uݍt-jPhk@Ep_MA111ϐUVSuEx$t+X$PF1jShk@v1e[^f1USMA, u ]Ë] C1;A w,U B@2<v#1jShk@]s1뾸뷀ydu1ۍQTMA1-ōYdfUVSu]{lt+Clj Phk@vXS F11e[^f1UWVS E׉ˀyxuJ1jPhk@uSh1ɋEC\uJ7E@t C`te[^_ÍAx볍vjhE@h@ue[^_Ð Vu@E7돐UMA`u fUBU *1fUMA\tAduA`uUBU 1fUM`tA\tAduA`uUBU 1ÐUVSu]jh SP)t hSP(opnqwaEUPEPhk@vFsrPPh@v UF11e[^Ðjh@h@v농vjh@h@vgUWVS ljUM]1΃~EE;GvPw!tGEGjuu7zy=1e[^_Ð|wG tT;D3 wMA= 9}jWhk@Ep1ow0q Ѓ?Ȁ)Pq ?Ȁ)Ѓ?Ȁ)OUSjQRP!xPjEPS5]Ð1]ÐUWVSd}EPWV:uE%p= EEEEfEUEUEUUMQuݐEU9U|~EUe[^_Ð9EsvEUEUӉ1ډt ]u땐]u댋Eؙe[^_UE U|#~)@)Ív=wRuPu2ÐUU1ɊBu Au1UVS։ˍURPUE$EPEPEPEPEPPREPEPuSV諃@e[^ÐUEU @fUEU @wvUEU @_USM] A Q Q ЉQA fCQA fCQA fCA C fAfC[ÐUWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1U1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐU]Ít&'U]]u}CvMsV tR@Ѓ@%=t&ftt]u}]a)믍t&@@֋~t11҃9Љw~N1)=(@,@A)AVF ޭޅttYPtOAtU4@fP +PA +A9R 4@G @$@]u}]ËVfQ맍v9 0@tQ9 4@t=tABAtA 1)8@<@A $ D$h4@뷋A0@륍'U0VS <@ 8@h@h@9s։ D$ $蚇ۉt11҃9ᆳމw1 AqA AA8@<@[^]Ív Ft&P|^~h@t&9t&wv|.~5h@t& @t&w0h@vwv|ލ~h@t& @$@$&UWVSt& @$@]EEE8Mtы0@! 4@50@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉54@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf1hfL QA UQEyACKGDGE1ҍY(@,@ڃt )ÃfC[^_]ÉE}tETF^050@E;11FKAA y]YEAGDGFE0@GG@ GG@GxUGPGMHGDGE1(@,@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0FCP X9<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&xX [^_]Í@Ѓ@%=t ftu@@ 1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$to$V;E\$H)ʉ}9}EE{ƍ4Ct"$ju${u߉M tU :Uth}-)@ [^_]Í<0Ct9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@@D$E$0ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]&UWVS ]} &$Ju+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$u<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$HAEEs{xC{$~EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& `@t;=d@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]4t&]Eu}]t&FED$$W1 f?[D$E)@D$U$ uɍFD$ ED$E<$D$U)@FD$ ED$E<$D$`@v'UUE `@U]4UW V)@S1ۃED$D$$P}D$ED$E$t&߃ t;>t[)@D$ED$$ u˃1[^_]Í& tED$)@D$$ E )@[^_]Ív'U%3$y@d@3)@&@ = +@uÐUWVS }1 vl@t$$Dxt&9{ul@t$$Hx$ƍ [^_]UWVS }1 v9{t+l@t$$wu [^_]}t&l@t$$w$ [^_]QUVSl@$ƋEh@Fh@1&@;Fwl@\$$,wul@\$t$$xE D$F$!j^[^];yl@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$z\$D$D$ E D$E$$[]ÍUED$E D$ D$D$E$# UED$E D$ D$D$E$# UED$D$ED$ E D$E$b#Uw`@}@p@Ít&UWVS,EUM=t@Gt@p@ Eu&)ċE\$#D$D$$oED$ED$C$E\$t$ |$D$$"t&1 &p@\$$ttF;~up@\$$tE;uL;~t)&o&떍#vދE;u֍ e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$+$#]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEJp@t`$É0E{C<$|$ƋE4$D$s \$p@$Ft]u}]t&뙐U]Ít&'UV1SiM֍&9ws [^]fÍ&9Ív鐐t&֍UV1SiM@B$`~@։L$t&k9w)&s1[^]Í&9ÍvylƐU 0]Ít&U j0]ÐU(0]ÐUED$x@$p1tÍv'UED$x@$p1tBÉ'UWVS }1Mv<$D$t&x@t$$rpuԃ [^_] $FC$;$3x@t$$RpUWVS 1t&<$D$Zt.x@t$$ou [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$r9E r݉4$rt$$D$&$r4$E r$W맍vUE]utoU1u ]u]ÍvE $er$ ƋE $Mr4$D$E D$GE tC$1s롸$tE$q$E $q$҉CthtdE$qD$ED$$E $qD$E D$C$x@\$$ox@1$C$$U]]u$I"\$D$$@o4$e؋u]]É'U(]u}D$=E$^¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&)@eUx@$kÍt&'UWVS,EEE E6EEE}&$oEF$o]]x;D$E$EED$D$EE$|$FD$]$EEEED$x@$klED$ ED$E܉D$E$EE,[^_]'UWVSmD$@$@x@$%u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$n<$D$tt$<$xn4$nnUDNjB B9r[^_]ÐU]+UU S]G) ʃ)1[]Ðt&)@獴&UU S]G) ʃ) 1[]Ðt&)@獴&UU SG,Ћ] ʃ)[]Í)@䍴&UVSUMu t@%@D%@BH%@Bt\1ۅt.)@[^]É\$$@%@Ht\$4$4u؃Hu1[^]Í&@%@FD%@FH%@1[^]Í&1 t&Ht\$4$t\$$@%@p֍&'US@]uu%@1[]Í&$ti@B$@D$@1[]ÐUED$ D$$/l1Ít&'UED$ D$$k1Ít&'UD$D$$@kD$ D$$@%@k@t&Њ@=@%@u@ U=@]]uu}} G~&)@&]u}]Ív tՅt4@@C@C@C @C1t@G@G@G @G@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$@%@u@t$Ѓ1[]Ð1[]v빍)@ U$nÍUEwE]U7t&]Í&'UU ~ÍD$D$ D$D$E$1ÐU)@]ÍU)@]ÍUWVS1ۃ }9~t3L%@\$$du)@ [^_]fL%@\$$d$M)uȉ4$q 1[^_]Í&UWVS1ۃ}9~t3L%@\$$Gdu)@[^_]f} tr} t} ft")@[^_]ËF [^_]Ë]F 9t!tD$%@\$ D$@$A^ 1[^_]Ít&]F9tD$%@\$ D$@$ ^1[^_]ËE cF[^_]ÍUWVS }L%@1 f9>tlL%@\$$ cu$NƸt>L%@t$$dL%@>P%@FP%@FF t&F [^_]u)@fU L%@tÍdL%@%@$%@$%@$Ðt&UVSL%@t519pt#L%@\$$bu[^]Ít&[^]bf&'U(Eu]}t;$'D$4$NjED$'t.]Ћu}]f)@ލ&Et$ D$D$E $'D$|$4$,'څt떍t&U(Eu]}t;$k&D$4$NjED$&t.]Ћu}]f)@ލ&Et$ D$D$E $)D$|$4$|&څt떍t&UE]uu}} #tEt$|$$=&t]u}]Í&]u]}]|%t&)@ÍUEt&D$ ED$D$E $p&Í)@Í&UE]u\tVD$ ED$D$E $(t]u]Í$#u)@Ӎv)@ UE]t&UVS u ]00 D$@$+0$#ft^ErtDaDED$$A+t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$@$*@)@됍&15D$@$*uLvEwfvEwE+D$@$@*v$K")@UE D$RD$E$0ÐUS]D$@$)t$!1[]f$t$1[])@ːU)@]ÍUE]uD$A@$A)t;D$ ED$D$E $%$3!]u]Í&)@ UE D$D$E$ ÐU]ÍU1]É'U)@]ÍU)@]ÍUE D$D@D$E$1ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$_M<É'U}׉$]ÉuD$4D$^G!$& D$D$$ $ D$t$$G} G1G,w, O0tAG0G]GT%@uT%@G}1] US] D$@E$t[]v)@[]Ít&'Uuu]}} D$@4$k&t%$t]u}]Ðt&4$KtI$1KD$4D$<$b]GAGGT%@T%@G)@농v'U(]]}} u$|$t]u}]Í&$D$A@%tԋG G\$ D$D$$!G0G$Y두U1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtGX%@\$$Xu)@ [^_]$K@GٍEt1~t01t&ȍ<$t&Kta ~t&uދE tFU 1fX%@\$$|WnU;uݡX%@\$$|W [^_]fUED$$D$Í'UVSu1 t&;0tkX%@\$$Vu$ D$_D$X@$_@1D$ G3CCX%@\$$X[^]N&'UWVSE}}Et[^_]1 &;8t X%@\$$2Vuމ<$1ۍt&;>tVX%@\$$Uu1D$ D$D$X@$_@FUFF[^_]zf뿐UWD$@$r@X%@ÐUED${@D$@$`%@D$ GG`%@UE D$D$E$GÍ&'UED$D$$GÍ'U$@D1Ív'UEu1}]$tGtL$6X$fw7D$F|$$Ɔ<$R]u}]Ív‰'UE$FɃÍU]7FUWVS }<$W4s/|X4t&B)E4$萸 v@UWVSI1ɉ‰EE#E$(HËE$FStdfuC.C E\$$I11vD$xE$GtXC$JƋCt+rǍ&CC뗐t&$@DJƉ떍F$ݺEE$EuE#&tcu :F/<$TmED$E$NFt8_4$\$$IƋGu/볍&|E$BGE[^_]Í&$ضE$-ED$E$E8$@@E$D\$D$E$FaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$GҍUUE $T$E ÐU)@$@D$ED$n3ÍU%@$Ít&'U]&US$%@]t$D$ $É[]Í&]ED$$Z=؃$[]fUWV1S }'%@$st4$ t7%@$t7 [^_]f%@$u%@$t1fʍ&'US$%@]tE $D$ $É[]Ít&]ED$$z<؃$[]fUS%@]U u$T$N<؃[]Í\$D$ D$$ []Ít&US]$^E\$$t%@t$ 2[]Ðt&D$@$;ؐt&UVSD$@$@ wD$ D$D$4$5 Ƅw%@D$D$@4$$%@D$ D$D$$D$@$@[ )wD$ D$D$4$ Ƅw%@ZD$D$@4$6$%@D$ D$D$%@$D$@$#@ wD$ D$D$4$ Ƅw%@D$D$@4$%@D$ D$D$$$cĠ[^]Ð%@%@@%@Ġ[^]Ít&D$@4$ %@vD$@4$ %@*D$@4$ %@U1]É'U]Ít&'UE@1] U]&US]U taҋCu@CC{%t't#9t$t&c1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$ut$u\$ D$3@F$Ɖ]u}]Íu \$KS<$Q6C $f6U|$T$$\$ D$D$3@F$$ƋC $G6뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$<@C$1 Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$E@F$4$谫딍US$]u$[]Í&Ct$ELED$ D$D$N@C$*D$Ë@ D$E$޷C $#$E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+31҄u뱍vC!C$螪뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$g<$wt&tyvC!C$n:vK9Crt$ED$ $sY&{Cft$ED$CC$貵sv'U]]u$y;U $D$T$ D$^$T;]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$蓮tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;'@v/'@Eܣ'@$>0'@$Q0'@'@EED$ D$D$W@G$Ë@ <9}sE<D$'@D$E$衳C $$ަ,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$_utRu4ttG!9u܍f]v֍ovɍt͉$vG!9uIvvE<$ED$ D$D$W@G$Ë@<9}sE<D$C $.t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$6 )čt$<$69s@a<w%$|@vЃ|+uf<$e69rE1ۉ$T6UT$D$F$KE$06t$ D$`@$D$QU$dw t Nun1ۉ<$Le[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$]5$FU$T$@$&ËFCFCF C FCFCFCFCF C F$C%C$$藥D$ D$$D$C%4$v'UD$i@$m@Ít&UWVS] D$@E$~C$L# D$@$N84$t$ D$D$<$uN%@D$D$X@$4$ $)@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$1[^_]á%@D$@$%)@e%@D$@$)@<%@D$,@$4$ )@ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$r@4$貪]$t$D$ D$D$$$%f&'U$~ÍU'@tED$'@$/1Ð/'@u)@É'UVS1ۃ'@uu!&Ѓ'@\$$*-uu[^]U(}}EU u1]]EUt\$t$ $T$1EU\$t$ $T$}]u}]ÍUWVS,E ]E@E܋EuE|@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$~8$t 1҃[]f[]Ít&'UWVS$1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @ @|}z;; @ @|fE xQM 6AA +@ @ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$(@$Ðt&UED$(@$Ðt&U8 @]ÍU4 @]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$wD$$FFF D$D$$ta$EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ)@EE؃<[^_]ÍvEE)@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$\$UT$M܉ $\$E$FU F$E] UMV~HU1fC D$CD$EE$MC K9}MƋVT$D$U$~F D$$ 4$rUE ]u$tD$E$^$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx$(@t9t)ȉ vt̅u$(@((@,(@뵋5((@9|͡,(@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$pk9$(@u,((@9|Qu!$(@vWu1]u}]Í&tq $;p뛐((@ȍ&'U]]u1t#1tr$ok9$(@t]u]Ít&((@t((@ݐt&$(@̍t&US]$xu][]o&U$]]urۉƋEFtM u:3C9$(@t؋u]]Ít&((@9E ((@܍t&U ؃t21빉'US]t$$&rU PC9$(@t؃[]Í؃((@[]ÐU$q@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐU}}]u<$6p4$ptt$|$$%z؋u]}]ÐU1M9t :u)]ÐUSM] tU&9tu1[]Ít&B[]vÐUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐU$辵ÍU]闵UWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS@t1ېЋ@uX[ Ungueltiger PPB! ,autofsck.%s/fsck.%s%s/%s:bindnoopts=loopext2ext3ext4ext4dev-C%dfsck: %s: not found [%s (%d) -- %s] %s Checking all file systems. /dev/md--waiting-- (pass %d) PATH%s: too many devices /proc/partitionsIs /proc mounted? %s: too many arguments FSCK_FORCE_ALL_PARALLELFSCK_MAX_INST12-Oct-20081.41.3fsck %s (%s) FSTAB_FILE/etc/fstabignoreiso9660nfsprocswswaptmpfsdevptsminixjfsreiserfsxiafsUsage: fsck [-AMNPRTV] [ -C [ fd ] ] [-t fstype] [fs-options] [filesys ...] %s: skipping bad line in /etc/fstab: bind mount with nonzero fsck pass number fsck: cannot check %s: fsck.%s not found %s: Error %d while executing fsck.%s for %s Finished with %s (exit status %d) ----------------------------------Couldn't open /proc/partitions: %s Must be root to scan for matching filesystems: %s Couldn't find matching filesystem: %s Couldn't allocate memory for filesystem types WARNING: couldn't open %s: %s WARNING: Your /etc/fstab does not contain the fsck passno field. I will kludge around things for you, but you should fix your /etc/fstab file as soon as you can. %s: Unable to allocate memory for fsck_path WARNING: bad format on line %d of %s /sbin:/sbin/fs.d:/sbin/fs:/etc/fs:/etcEither all or none of the filesystem types passed to -t must be prefixed with 'no' or '!'. p@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@f@`@[@`@@`@`@`@`@`@`@`@`@`@@@`@@`@@`@@`@@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@@@@/dev/dsk/rd/ide/scsi/discs/discdisks/diskhostbustargetlunBLKID_FILE/etc/blkid.tab/devices/devfs/devDEVNOPRITIME%s-XXXXXX PRI="%d" %s="%s">%s %s.old %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt lrtyndurwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert 1qay2wsx3edc4rfv5tgb6zhn7ujm8ik9ol0prdIO_ULINKlwIO_LINK ..:/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createx@@@h@@@@@@@@X@@@@@@@@@@@0@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZ@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@m@@@@@@@@@@@@b@@o@o@@b@@@@@@m@m@@@@@m@@@m@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@k@@@y@__PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 I@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@7@%@%@@%@%@%@@@%@%@%@@%@%@%@%@j@@@r@%@'@%@ @%@%@%@%@%@%@%@@@%@@@%@%@@%@@%@%@~@t@%@X@%@@%@@%@%@@%@@@@@@ @@@@@@"@&@*@1@9@?@ @E@J@O@V@`@h@q@z@}@@@@@@@@@@@@@@@@Q @@@@@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d wdDEV_LISTDEV_REG SERV_GET;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK zR| R'AB E<_AB E @@z@@@@@@@@@E@J@O@T@@@@@@@@@@@@@ @L@@(@-@xI@6@8:@@/@@>@/@@>@/@@>@3@@$X@3@@$X@3@@$X@@@H@;@\@?@D@I@N@@ S@@@@ @H@^@ h@H@^@ r@H@@ S@@@@ @H@^@ h@H@^@ r@H@@? S@@@@? @H@^@? h@H@^@? r@H@@ S@@@@ @H@^@ h@H@^@ r@H@@ S@@@@ @H@^@ h@H@^@ r@H@@ |@D@@@A@@@A@@@A@@@A@@@8A@@@@@@@?@@@?@@@?@@@?@@@@ @@@@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@  "@9$@9$@o&@Vy"(@',@/0@A32@95@A0<@E0>@b |[@4~\@G]@ F0]@z]@nӃD^@'Іp_@`a@3i@k@KÓk@Q0l@)`l@<Dl@.l@>m@-y@m@ʙ n@ܚo@Pu@ۡx@y@g`~@ 0@!`@ ]p@Mݱ@ Ѕ@yVP@@@]@p@S@@70@@0_0@9p@U @d@0@ 1@@]@| @@F@@@6@@(!p@p@ @ @`@?@2@@@@fP@S @!@#@$@B*@A .@$/@J/@00@91p@2@@)F3l@_jmaindevicesargsnum_devicesnum_argsverbosedoallnoexecute"serialize4skip_rootFignore_mountedXnotitlejparallel_root|progressprogress_fdforce_all_parallelnum_runningmax_runningcancel_requestedkill_sentprognamefstype#filesys_info5filesys_lastGinstance_listYfsck_prefix_pathkfsck_path}cachefs_type_compiled ,xbase_device9is_mounted^96fblkid_gc_cacheblkid_get_cachepblkid_put_cache#blkid_debug_masko blkid_dev_devnameblkid_dev_iterate_end1blkid_dev_next~blkid_dev_iterate_beginblkid_dev_set_searchNblkid_free_devblkid_new_dev`y"`Iblkid_strndupblkid_strdupblkid__scan_dirblkid_devno_to_devname#'"blkid_read_cache</oKblkid_get_devnameblkid_get_tag_value$A3blkid_flush_cache9blkid_tag_nextblkid_find_tag_dev1blkid_dev_has_tagblkid_find_dev_with_tagJblkid_tag_iterate_endublkid_free_tagblkid_tag_iterate_beginKblkid_parse_tag_string2blkid_set_tagLAUblkid_probe_all_newblkid_probe_allblkid_get_dev6Eo6Ublkid_known_fstypeS/blkid_verify% |blkid_get_dev_size~blkid_llseeknuuid_is_nullMF4huuid_unparseuuid_unparse_upperuuid_unparse_lowerzYuuid_unpackӃ__udivdi3І isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperډ?%errnoQinit_memory_managerfreeZmallocrealloccallocdstrtolostrncmpÓostrncpydstrrchrdstrcatDdstrchrdstrcmpdstrcpy(yQd__strtok_r strtokʙomemcpyܚ9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoullibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEۡtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses#msleepsleep* nsyscall_psyscall_v!get_tick_count]agetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsݱrunlink7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killV=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatoaccess0iolinkreadlink!symlinkKfgetpagesizeisattyforkpipegethostnameiSchmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat<getuidgeteuidgetgidgetegidGvwaitpid,waitXwait_child_addqinit_waitpidxstrerrorY_=seekdiryrewinddirtelldirreaddir3closedir_opendir%_vmktempmkstemp'UZrpcsend_message4 io_remove_linkio_create_linknyieldR1,io_split_filenameio_get_absolute_pathZio_split_dirnamed]get_pidget_parent_pidcreate_processmdestroy_processget_cmdline" nset_rpc_handler#yadd_intr_handlerJFa)vfprintffprintffprintf_putsn+fprintf_putc}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr# Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen66_exit2abortGatexit{exiti! 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf{ gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF 0vprintfcprintfprintf_putsnprintf_putc8 sprintf_putcQvsprintfsprintfa_assert;~]snprintf_putcvsnprintf!snprintf2Pdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timerdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namelio_seekVcreate_shared_memoryopen_shared_memoryclose_shared_memory  ysyscall_putsnq!mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6#nwait_for_rpcv_and_wait_for_rpcc$ppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvB*list_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_create .strcspn$/ostrdup/ostrlen0omemchr1memset%2getppidgetpidF3__umoddi3fQ@@q@h"intXI5Lf7e~t] (e 'eoy.Z%1H id2# @43# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFz 3H=I3 =c-vl3d@@k@@q<b7IY+,3t@"@h"intXI5Lf7e~t] (e 'e(e)ek(ec)e*e+e ,3-e.e0sy6.4`a#b#c#d# e#f#Cg#w5i#[k# Zl#$m#(n#,o#0o.Z%1p id2#@43p# pid4#.5# 7#8z#>9z#:A#4]4|  (Y )p#c *p#:# +p# ,p#  -3# .3#-, /3# 0# 5$ 9 pid :3#-, ;3# <3# =#  >p#:# ?p#Y @p#T Ap# B#    #  ^-#:##3# p 3.t@@2`p^ppqpac3i33@?@.p@@@Lsxretp @C@WY +:#Ji33fs>D@@}i>@@3@@s*lsRpp=693@@0opt8!8p^-:ps:ppLcppphcppp@@Dbufpp p 0@@!A"L!]#E@Y@fsD"tFpVp\@ @:#psp$tpl%ppt%st&@'N3(fsM(cmpM$nO3$retO3)iO3$cpPp n3 @ @lfsm?$ipolyp3s*!!+0,--- B3 @] @G 3s  n 3 ':3i .:#.Y..d3$sp) =i )y )=3$i3)$p$pid/$tmpy 0py 1O0 1O#)` @\@ d fs d3$ :#D ;3 *X!2 !!+-  3 |3 -" P -. -8 -D h -N +3[ ~0\@Y@ -,/3 13Q $sig233} 3 3pid4:4N@v3\@@cT -,33)3'&3 .Yp))p3@=@& fs 3T 333*T 82f +X-r H-~ 5PRSK .=J3. =J$iL3$jL3$argMp$devMp$tmpMp)N $optO3)P36K0 175 .p(cmp$cpp)^-p$sp$num3)3)36B7U .*T$fV $bufW )X3)Y3$fsZ 0 8'J35.Vp.5$devp)Yp)p):#p)p)p)p$cpp$fs 9]:Vppp'.p$fs;W3@@"@=3a =i33d3p\fs<& !@ !4 +-L 3V tv-` O-l -x 3 ~3 tv3 tv= @* ! ! +- C3 tv- - k- ~3 tv=, @<5 !C +8-O 3Y v-e -q v-} * xf! ! +, - M- - W- --7-,)>;@@!H+,S?]@ @-2o+,{@N@@9010$1AH`@0E1 ArT5@&h|@Bb7 B8 Bz Y30p1Cf)@C 3g`(@Ch3(@Ch3(@Cjj3@CTk3@C`l3@C$m3@Cn3@Cqo3@Cp3@C\q3@Cr3@Cs3@Ct3@CKu3@Cv3@Cww@D3Cx3@Cyp@(@CZzp@C{@Cj{@C<|(@C}@@Cp~p@C@E(@( "@$@noh"intXf~t]y%T*r "@$@/Y)[str+rcp+rv, {,len-: i#@ %  p%@$@$@oh"intXf~t]yd%OrM}M}N: :$@$@ } ;r :2C3$@&@hh"intXf~t](O)Ok(Oc)O*O+O ,3-O.O0]y6.4`az#b#c#d# ed#fo#Cgz#w5i#[k# Zl#$m#(n#,o#0og 4a_&#V'#(a#M)#^*#+3#;,z# q-#$z.O#(/#,*0#0lr# ]#U^#|_#`#haO#&b# ##3>U!?#@#DA#B#C#E`$@T%@D ap p  st %@D%@dev &arg%O3T%@%@MrNM *NEPa(hax3p&wEt%@&@# saS@~d"&@+&@devSXd" A&@k&@tagUSp d6 L&@X&@badU"3@&@(@h"intXf~t]k(O0]yog 4F_&#V'#(F#M)#^*#+3#;,d# q-o#$z.O#(/#,*0#0QW# ]#U^#|_o#`o#haO#&b#b k3#lF#{ m# n# poC#C C#C#3>!?#@#DA#B#C#EI X VC WC 9&@&@I dev8  &@&@u1]  3&@('@x]  x.dev s('@e'@drF] t / 3h'@h(@] {   ' S  e1 <dCx3N &wCD  h(@(@G devs t(@(@)$y(@(@f  1*B (@(@tag+! (@(@!dev0!\J  (@,@ oh"intXI5Sf7l~t] (l 'l(l)lk(lc)l*l+l ,:-l.l0zy.a%1id2#@43#pid4#.5# 7#8#>9#:H#4<#A=#! % HO> 6.4`a#b#c#d# e#f#Cg#w5i#[k# Zl#$m#(n#,o#0 ! "Z#O## % DIR&  P: # #  R(@8)@N!C^-QCz!dpS! S!  %8)@)@!s$!$:B"ret&" %& 7)@)@"s6 ?)@*@"P:>'#^->CP#dp@ _*@X+@y#0]#?]#^-]C# ^ dir`)$dpah$@4bw c:std    % X+@,@$8?$^-tp tl thdir8   N  >@  ,@0@r oh"intXI5Sf7l~t] (l 'l(l)lk(lc)l*l+l ,:-l.l0zy.a%1id2#@43#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 6.4`a#b#c#d# e#f#Cg#w5i#[k# Zl#$m#(n#,o#0g   4 J_ &#V '# (J#M )#^ *# +:#; ,# q -#$z .l#( /#,* 0#0 U [ #  ]#U ^#| _# `#h al#& b#   # #   E,@T,@$' cpD*%chF%S% >T,@,@%R cp=% Y,@,@%VX%pZZ X:WJk WcpWdevYretZ: 3 :DJdevcpDtmpendP:ret:  :ocpDp{ :cpDq 1:0Jdev0cp0DP:2^63ret4:N :"P:D^6DcpDend= },@0@&&|JR&~r&buf_fd:&:sti--@ dev&endl'!";'## $%'&h]### %'%Z($!P9# ## h$!c### % (%($"%- )$8'o.@.@ӻ#(J-@.@#[ %eu) )%*k  0@2@E oh"intXf~t]k(V0dy%g 4F_&#V'#(F#M)#^*#+:#;,k# q-v#$z.V#(/#,*0#0QW# ]#U^#|_v#`v#haV#&b# ##3>:!?#@#DA#B#C#EE ?0@2@) =F) T =?* ^6>* dev@X+ cAFtp tBtl vBth retC+ outc;1@ % 2@2@+ F, [, , :, dev!- c Ftt ret!J-  2@5@Aoh"intXI5Sf7l~t] (l 'l(l)lk(lc)l*l+l ,:-l.l0zy.a%1id2#@43#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 6.4`a#b#c#d# e#f#Cg#w5i#[k# Zl#$m#(n#,o#0g   4 J_ &#V '# (J#M )#^ *# +:#; ,# q -#$z .l#( /#,* 0#0 U [ #  ]#U ^#| _# `#h al#& b#   # #  3 >>! ?# @#D A# B# C# EI   x:l & w : dev ptag.>  ::2@5@s-9J-p;-tmp<- =:.*>v.?.fd@:.ret@:;/stAi<4@devyl(|}H/3@3@3@<4@Z: %z Y:" 5@.<@h"intXf~t]k(O0]yog 4F_&#V'#(F#M)#^*#+3#;,d# q-o#$z.O#(/#,*0#0QW# ]#U^#|_o#`o#haO#&b#  3# dev# p*#* *#*#3>!?#@#DA#B#C#E0 . add+* ,* -* X V* W* e <d*  .35@5@/\] ,0:#-\;0^6-\Z0tag/bh k5@#6@0jF0:#jb0&l/1tmplpm*M14 F$6@q6@k11devE1:#Eb1pG*2T6@i6@tmpM-2^ X3t6@6@K2devVw2:#Vb2^6Wb2tagY2 N6@58@"3JKFN3:#Lbn3^6Mb3&O3devP3priQ34pR*"4z S3@4p qR7@7@tmpc`4H >88@X8@~4u] =4 .X8@8@4tag-5f8@p8@6 !k8@p8@f"C5"V5!p8@{8@7 !v8@{8@f"i5"50 8@8@5K#dev5$]  38@9@5T b(6%% P:j6^66cp&i}9@a9@}9@c 9@9@7 tag@7 & K2 addJ* &J*  39@.<@^7dev7P:b7^6b@8( `8t8&9val[9 {9'i;@  ;@;@ % !;@;@L "9  <;@X;@V % !E;@X;@L "9"3:! ;@;@ % !;@;@L "g: 3 0<@0>@oh"intXf~t]k(V0dy%g 4I_&#V'#(I#M)#^*#+:#;,k# q-v#$z.V#(/#,*0#0TZ# ]#U^#|_v#`v#haV#&b# ## . add+ , - M k:0<@7<@:U jI:W j:Rh :8<@F<@:Iret:G :H<@n<@:Iret: & K addJ &J| 3p<@0>@;2IH; 2~;-,2:;dev4;tmp4p5W<5<hc \<=@ >@L>@ >@L =% yk6J 0>@[@oh"intXI5Sf7l~t] (l"z 'l(l)lk(lc)l*l+l ,:-l.l0zy.a%1id2#@43#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>$]4 6.4 ` a# b# c# d#  e# f#C g#w5 i#[ k# Z l#$ m#( n#, o#0# S , Z 8l bs9 sAg   4 _ &+#V '+# (#M )#^ *# +:#; ,# q -#$z .l#( /#,* 0#0   #   ]+#U ^+#| _# `#h al#& b#   %   T T# T# +,e Su u yfd:##dev#! # h #buf#i# S9" : x # g%#&z#'l#h(l# q)#*# %Y3!4#5#6#T7# 8#9#~ :#];!#<1#8=#: >A#<!?#\(@#`/A#d[ Be#hCQ#xDa#E# F#G#H#Iq# J# !K#L#jM#U N#O#P#Q#R#S# T#UU#V#vW#X#Y#Z#z[# \#F]# ^#_# 1 u SA u Q u %a u %q u?  u  u  u  u i i #?#{###y #1e#   #0$ #lDy #x#}## Sy u  u  u % u 7tl ####  !#)#Rl ##,\| #. #4fl #@e#TQ#d | u  u S u < e# #e#9!e#$ #4  u  i ###### #%## # Z e#te#e#  u   W #y #be# S u Ba crcѾ#Ҿ#Ӿ#(Ծ# 7@  #;̾#-,;#bξ# Hq#q # P:q#0  u P ۾#ܾ#ݾ#e# pQ#P #,# S` utx# #Y1# # ##1#1#S###N# #-# #$#(#*#,#0#2 #4P#@i #C#G #Ry*#Z1# S u   u  u S* u S: ukvl#  #*!1# #  # # 1#0 1# S###;#a#Q# #$ i #'#+ #6v#>F1# S u 9P:9## # #( #x!#""#b ##$#%#;&# I u i@;G<# =#>#* ?# @#+A#B#C#;D#  E#$ F#(G#,H#0I#4GJ#8K#< TUi # Vi #HW#hX#Y1# S u % u,\]#=!^a#0_1#pb`e#ra1# S- u/`mHn #o#p#uqa#[ re# S u S uO;@|}#~# >#( % u % u % uC`{ S#D#aS#-,S#<# #(\ #H #P  #X S u S u####m# #8O#E#v{#### #$#( #,s##0##@##PJa#`a#-T#8 ## \ #$#(#0#8T#@ #A#D#E/#HY#P  u  u  u #E##lsn##V##-,## #L:##len#*## # -,# ##l# #w### #a#id#kfH#K #X# # Q# ## #N### #v#" #$=! f#%  #@ #D #F@#J#N=#R#T#XL#\#|#~# v u# ##:# #M!# m "# ## ' &Ft'#e(#[)#_*# +#,#/0#1#g2##3# u67#P8#=P<=#>#?# @# ( ucCHD#"E#F#G#H# I# J# K#L#M# {N#$O#(P#,Q#0R#4ZS#8T#<JU#@V#DNW#HXL#PJY#pZ#[#>\#K]#@e(idg#h#i# j#:#k#m(# 8 u(:0>@Y>@@==!'l=len':=end)= S:\>@c>@=΄=d>@>@>dir1>:O>i:> .(:>@>@>U &!id&!buf'"N :>@?@>Z %?#id $l%buf&;l#il#crcl')(6@ ) :?@J@@g? id?buf?(:t@*=! ?p@q@(! Dil.@blA@+a?@?@,-T@.a?@?@/0r@/  %! u':L@@o@@@Y! !id!buf#dlY! +:p@@@@@! !id!buf#iso!*=! A Mb:@@@@A" _!id`!bufa? S:@@A@HA|" P!idQbufRtA#csbT|"*=!UA a  D:A@8A@A" A!idBbufCA#rosE"*=!F*B  7:8A@mA@HBH# 4!id5!buf6(!8 L1pA@A@tB#devB!BtagB2str#G %# u$:A@B@'C$ !id!buf#osb$ -;:B@B@SCn$  !id bufC#jsn$*=!C  5:B@B@C$C!idbuf5D#rs4$'=!  1:B@JC@kDQ% idDbufD#rsQ%'l*=!E   :LC@C@DE%pE!idbufE#xs%*=!E 1hC@;D@E&&dev&FidEFbufyFes&&F3=!F :* P'i'6'''': ` : %, u >:P@P@P4-;%Qid<EQbuf=Q#ms?,s:P@R@Q-Q2f-t2buf-cpQ7t  %- uOw:R@pR@R-nowHR(@4ret:`@ :pR@R@[RI.nowR8@2ret:d@ 7:R@1S@R. 5!id5buf6R#es8&&:4S@S@R. !idbuf(S#es&&9a:.,/-/T6///%/?0/_$> 0%valq :$W@W@TO1'U!idbufGU#sbdO1*=!U@01W@8W@41-0U+0OW@VW@-0U O:W@$X@U1V!idbuf:V#sbdO1*=!V@0W@W@1-0V+0W@W@-0V$L2%valAR&q2%str$&+$:%buf%&%:#i':#j':#c(l-\:$X@[@V5Y W!idZbuf[EW(]'^5* _5Wkey`5W'3a5sbdbj)W'&cl' dl' eloffflX*glX'nhl* ilX*LjlX'kl*llY'ml*nl%Y*iolCY'plextq:aY'L r*!rY(sp)[(=!s5{@0{X@X@=4,0@0X@X@W4,0@0X@X@q4,0@1X@X@4-2Y@0X@X@4,0@0Y@Y@4,0@0Y@Y@4,0@1^Y@dY@4,2@0Y@Y@|5,0@1Y@Y@}/5-2Y@1Y@Y@~M5-2Y@0cZ@jZ@k5-0Z@1qZ@wZ@5-2Z>2,F2-:2,Z,.2,"260R2NZ/\2/f2 v  F ( %5u l6 u5(p6@@ -6 u(z6@@ #O6 uV(p?6@BzY:c![@\@3h"intXf~t](O)Ok(Oc)O*O+O ,3-O.O0]yo9s: 6.4`az#b#c#d# ed#fo#Cgz#w5i#[k# Zl#$m#(n#,o#0V!>3[@[@Zfd=3[ \!=/[ ch?s m!L[@\@G[fdK3s[ C!M3 O!QV ;R *S[lowS[0 stx\@\@mid[!\@]@Rh"intXf~t]yo9s: r!}\@]@[fd~3\!~}#\!~3 zY3A!!]@0]@h"intXf~t]y!'3]@0]@\uu&\cp(Ri)3Q A0"!0]@]@Aoh"intXI5SfR"6e7w~t]y%!2"3l#"4Z#"5Z#["6Z#>7# H  6"40]@]@\R uu3R] out3-] fmt3]K] !5`XSc%E"J]@]@i]uuIRoutIe"E]@]@]uuDRoutD#"@]@]@]uu?Rout? x"'@] !*.@]U"!]@B^@h"intXI5LfR"6^7p~t]y!2"3e#"4S#"5S#["6S#>7# A  "']@B^@]< in&< uu&G ptr(M tmp)e BL  SAG""D^@k_@qint~]ohf"#%#,8#X7#tG#?#0#W# +###"low`#*`#  s llv # #M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww "km1km0kM#_D^@k_@^n^E^d^e^H`A7-`LWbm^x^"_d_`=`[`t`^@^@`^@k_@``v#~#p_@Ua@#4AAc3Aint#9Adc8Af# AcA#*Ac)A#HAcGA#MAcLAdp_@~_@av#%A_@_@:ac$A_@_@fa; a#/A_@_@aec.A%_@_@a7H`@`@ bZ#>A `@N`@Lb c=Axb#CAP`@`@b cBAb`@`@b`@`@c3#RA`@`@:c cQAfc `@`@Sv 1 H`@`@S n#WAa@a@c cVAc#\A a@5a@c c[Ac#aA@a@Ua@d c`AGd;v$#Xa@Xa@z7)@intD%#`a@i@h"intXf7Z~to$yZ] (Z$IJ# K#%Lh#;Mh# Nh#%OM#9$OMYM# ZM#[#\Z# ;]h#a%^h#%s3y$z3 $ s cO nz i3  $ ptr%3 ~% %3~ $d s1 s2d nzH$kj%k$xN$xjqoZ $ s c3 nz i3[$`a@ea@fd$pa@c@dptrdminM emaj4ex-hheSa@a@`a@a@mb@b@~b@b@ehb@b@%h%h b@b@!O% c@d@eZ";he#sthe maj lc@c@$ f%m~$*f&2$>d@g@Sf'a%=zf'$?3f%@afpAOgBhxgmajChminDMhS$EMii;Fz|i`d@d@ZSd@d@P`e@e@`5f@@f@p`Dh"j`f@f@Lg@g@hKj&=h@Vi@ijpj';zjptrQkminMk0% zk.hlS.h@3h@0`Ph@Uh@m(  qs.$$87BM!lX5l`h@h@i`.i@8i@^&% `i@i@Il'% zul'; zl0%3pl ~vi@i@vi@i@)R*$b0@*:%c4@+%%eM,3*%f3h@*%g:8@*$h:(@*o%k: @*%l:@*$m:@-%q.A %#i@k@ h"intXf~t]%#]i@k@lstr"l%"m"3m;$]-n%%3an6&n#'3n o zY3%%k@k@ h"intXf~t] (O&%3k@k@ns1# os2#Con$dyoo &&%k@!l@!h"intXf~t] (O0&*k@!l@odst)osrc)pn)d>pPd,Qs-R o   8&%0l@Yl@m!h"intXf~t]G&+0l@Yl@pp*pch*3pB&,pc-po !O&%`l@l@!h"intXf~t]X&#`l@l@qs"0q_&"OqB&$o !m&%l@l@!h"intXf~t]f&+l@l@zqp*qch*3qc,Qo!v&%l@m@)"h"intXf~t]&*3l@m@qs1)rs2)Sroa"&%m@=m@j"h"intXf~t]&#m@=m@rrto"r&"rB&$o M"&%@m@n@"h"intXf~t]&2@m@m@rs1s&1sr1s&3stok3tc43Ntsc43at &@ o   &`m@n@tt s_&_ra@@#&% n@o@#inth"Xf~t] (O$A n@o@t&:t&:t:d udstBYusrcCutDdu}n@   o   5T$6'~#o@Au@#h"intXf~t] (O$'#do@o@rvs"v&"dvlen$dv  o &/p@p@vCn.O&ws.CFw.Orw st0IKi1Owy;Ow ht5O YY ,']p@p@wstr&x&3]hx3x cF'q@q@xstr0#'3q@q@x1s1s2' q@(#;)o#;(w(*zo  E(&`('#n((O#  (ax@tx@/2 n(`O[(b2ic3 Z(Ox@x@y n(NO(P2iQ3,(,Ox@y@% `(+QM(+Oid-O}E(52(<2i=3~(#l@i($Oh@')'y@W~@&h"intXf7Z~t] (Z 'Z (0|Ooz 3 pid4O# p)5O# (6o# )7z# (8 '$ O>(*# ;)o# ;($w(*Ao (tpids|p)sO7u3)v )ry@*z@pidp|p)pO)q;)b0z@az@pida|p)aO)a3(Spz@z@gpidQ|p)QO)RO)Cz@z@:pidA|p)AOlenAo)B; 0)Az@z@f({@I|@{pid|);݁(o);p)OG){)Kg\re}A H!)1P|@j|@xpid0|)0;(0o)0; ")2!(;p|@|@#pid|Ђ$);$(o$);0%^6;P%)c%)Ov&$)3}@Y}@pid|);Ճ(o);^635)S&(O`}@}@|ppid|);Ȅ(o);^6O()߉F'N)L}@W~@oP'J|p)JOх(Ko)Kz')MC)NzG(h)3Ot@)S):*).p@0A*)`~@*@(h"intXf~)8at]o*+`~@e~@Z)#p~@~@)" E($V҆y ).O~@*@ sec-O& E(/VF*L* *0@Q@(h"intXf~t]oB*0@<@n8* @@Q@7+Q* *`@l@(h"intXf7Z~)8lt]ob*!a`@l@Ƈeax"Oedx"OR|+*p@@,)h"intXf7Z~t] (Z 'Z3pid4O#p)5O#(6o#)7z# (8 o   'O>(#;)o# ;( w(*y(VP:)#^6*#++1 8+p@@731*͙ V q*@@Q73}*+C@P@P:BɈiD3*E*P@@dP:Ii3r* @ۀ@P:ډ*1+e@m@ I$d9;doo^6h +3p@ς@Ŋ_P:^6*3I*u@@S  *3Ђ@@@4*3ҋ*#3 @@str"sep$1*.oOP:/*3@Ճ@m +\@@!pidZ|Ōp)ZO";Zo")[z #)]zud#*^ouh#*_oul&+_o$i`3up*a *6@@UB2=|D0@@~*AUW`@@>Cw P:K^6L #*-lx@ %zY3-~+M+@Ʌ@*h"intXf~t]yow+'3@Ʌ@*'k&.,M+Ѕ@I@"+h"intXI5Lf7e~t] 'ey +#A ,K,   3 l,+#X,#*,3#0,++o+3Ѕ@@ԍs+s36 +3 @i@l+s3Ύ+&3p@@+%%30 ,>3@@r^=3+=,=sDi?3y,os@@,nsېidpZ@+3 @E@+s,3P@u@I+s+3@@ui43l,3@ʉ@csig3͑o,coldr9 il, ,Љ@'@o3+`, ,H30@@G32+[v,g@Ċ@3,{Њ@@ɓ<z3+k3@I@w pidjzj3AG!++w@!+,@%@!,-@'"zY390r-M+P@2@,[-!0Q-:oh"intXI5hf7~t] (" '* ,Oy.v%1uid2# @43u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * 8- , - , ' O> (# ; )# ;( w( *(-'8 k-(8#fd)O# ,+O# F-,O# dupOP@d@lkfdO,Op@@fdO@-O9O@ @ĔfdO-iO2 ,O@@PfdO|cmdO-:iO@Č@sap%argOΖЌ@@ap%argO,PO @ލ@k-O8 -\Vi]Oi,:@+@| -~80@@7fd}Oԗ!-iO,@<@&fdORbufr""\!#8#c-ret& $"-@@@OZfdO{buf""\!ۙ#8#c-1retO!@d@xfd~O"\!~Ě"!~O#8^g fp@@ fdeOHe;e#g8ӛ3oH@A@fdGO"HG=";G#I8Ŝ#3Q-8P@\@%fdO& '::O`@@-*Y-,O(,l-fdO#%8:) af 8cH@`@|f8*0 f8+:,-:O@2@*99(-0L%@ (-3OP%@. -68.b78.88.z YOr2-M+@@@/h"intXI5Lf7e~t] (e 'eyo.Z%1?id2#@43?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K -&3@@@ @4%A%3f)H dir-  V dzY3e_3j0M+@b@/h"intXI5Lf7e~t] (e"s 'eyo.Z%1Jid2#@43J#pid4#.5# 7#8z#>9z#:A#4]4V  /+3@@ʟ * -*  -K@1@@4J"bufJJ -JzlenLBN` a -:3@@b@~[ 9 -9zY3bV4-M+p@@0h"intXf~t] (O 'Oy-'3p@z@-03@@֠J;/3E8o@@.A3@Ĕ@. @ 3-J3Д@@ZK bufIK lenIdQo zY34G.M+@@,1h"intXI5Lf7e~t] (e 'e(e)ek(ec)e*e+e ,3-e.e0sy6.4`a#b#c#d# e#f#Cg#w5i#[k# Zl#$m#(n#,o#0o.Z%1p id2#@43p# pid4#.5# 7#8z#>9z#:A#4]4|  !.43@@ *3 3   .C3@@ B3 B .3 @*@ޡN * ޾ ;.30@:@  *  Y  .@@J@6 [, T.3P@g@b @4 ̾1.R3p@1@DfQD.QJآposSs   A.3@@@ 35.JUfD 6.y3@F@ *x.xJ:z3p{D@F@dir  | N.3P@@* .JC3yfD@@buf}'.(T%@z Y3K6Z.M+@'@2h"intXf~t](O)Oyi.#d@@a.)d@@x./o@@ p.5o @'@96.M+0@@3h"intXf7Z~t] (Z 'Z'O>(#;)o#;( w(*o y . )  pid*|#O+ #,3#' .BCCpidA|iC3.DC .nvpidm|io3.pC.|0@.@e&pid|&38.CLH@k@#h .j7I@$@V aj 3.|0@S@X&.T`@@ҧpidS|.VCoutf@x@@V# .)7.@Ϛ@Gqpid}|sp)}O;}o)~z.C  K# .7! # .17".9К@@O#.0X%@ $zY38 /M+@0@4h"intXf~t]oyd/*r@0@{.)3.+`%@d ? 9^/M+0@i@\4h"intXI5Lf7e~)8wt] (e 'e0~y.Z//A%1Yid2#@43Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> ! "S#O## _  DIR&l%"P:&"#:#'#;(l#)#]*#^+# _2 r/-/t0@R@sdirss\!s~ H/i`@@өdirhs1/]~@@dir\s/C'@7@+'dirBsW?/D-wR/J9/P'ɪ w 2/53@@Z@_dir4sj/*s`@i@P:) _[B:/M+p@@j5h"intXf~t] (Oy/,p@@?/+klen/di03numB3/.3%@ o/^3@@?/]Ifd_3 len`dP bufa? N NzY3V;< * @@6h"2>intXf7e~t]orpc" @;@pid!Zլ #ZP /2>@@@Dpid0Z '0ZK p)0Zklen1Z )1z 33P /:Th ZT D;e0@+@s6h"intXI5Lf7e~t] (eo 'ey.Z%1?id2#@43?#pid4#.5# 7#8z#>9z#:A#4]4K  Z[0[#,0\#^z#P:_#  a}0`dc,0d#fz#P:g#  a0h =03@@խ303Z0?ul0?/U@/®0 /z;zH4  V  a  /33@+@/1>30102,43Lq05°/60G?H0H?q/@L0@ 0@k@+@/mz;nzñHo4r'  a zY3<) *0@<@7h"intXf~t]o00@<@((=0@@@8h"intXf~t] (Ooyo'O>(#;)d#;(w(*  & 1 2 1 z10/ 11&12#13#05&# o6?1p^-pcwd}0v%230^-p1pcwd}0v%2(3i)31Fv0DlenEd1E1E0Gv o1i@@w@@4hG^-hpe1h31jugposk%2luh1mul0nvH 1wd, h !!!! "#~@ȣ@(!!!! "#ȣ@@[!!!! "$(@w@!!!! "'%U1}@*@&@40v'11p (@@'}('dF1@^-pi3030v)2:d^-9p;;di<30=vg1_^-]pH]}0^ib30cv%1}0@@YZ&@40v*11pud%23';d޴'(1}+6@@r!C ,N"Y"d-| ! ,/,M",k,-` ! , ,),4+@@@!!R "^,j/"t.@@!!! ,X,l/1}@@&@4'0}˶*^-pul';d'0v-@ +!R0 "^,j="t.@s@-!!!` ,q,?]2 *@|@9h"intXf7Z~t] 'Z(Zon2'o@ @ pid(oķ>28o@#@׷ pid7o 9ov2Vo0@Q@m 22TO uidTz 3T 2Uo pidWoB M2k`@l@U2zp@|@ {{@2 *@@r:h"intXf~t]o2@@'@2 *@@:h"intXf7Z~t]o2!@@' O]HA2%3@@;[-!0Q-:oh"intXI5hf7~t] ( 'y.v%1Tid2# @43T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`3  O :u3  O  O  :2   l3v# 2#arg#3##fp$## k24O@@fp3#p3ap3% 35 t36h2<O@!@Dfp;#p;ap=%;>OPQ3/O0@z@p%arg.%&.n.O  _3(O@@arg'%c':>zB3%3@z@<h"intXI5Lf7e~t] (e 'ey.Z%18id2#@438#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 33 3@Ԭ@]/Yo@@{43@ @k- d33@^@,c3 @@V@cs>u{48`@@CI$8opos3c3ûo g33@>@c3 k- @6@cs>u{Y33@@@C neostrY53@ @7strY3/@z@U~30@41~~;2z>V>V3)%@ -$%@b%%@&%@zY3 .DE4%3@<@~=h"intXI5Lf7e~t]o (e 'ey.Z%1?id2#@43?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#p)5Z#(6#)7# (8a 7id8#9#:#e4;Z# 3<?Iid@#A#B#e4CZ# )DI# AX 4EOyidP#45QcUidV#L4W K'  z4& zres {K#5 |#%4k- V$42%;1^43Ek-%@@޽c8@@ k53@@6k->_3@ɱ@b*^53б@@_k-H?3T; 3_R5 ?out8@ 4R3@@k-Q5M3@@k-LHL?;L5G3 @N@k-FHF?4P@K@src<[yk-;r54]5~*@@)  A  X53P@ȴ@%7k-Q;E53д@1@uk- 4yp!s43@@ĵ@"k-3#Zi5hsе@Z@k-g 4npos~*w  4N3`@ڶ@3dk-M_\!Ms!M3$5@@k-5@v@)Eek-;483@Ҹ@^:%str7k-74%3@%@c$3k-$&ch&zu{430@@c3k-75E!%5@@m "I$"""k-M#3 4\' ~*;( )' ~**E;,c@@*i3v+5Ez4F3@B@ k-E,cGz4]?P@@ u I$\?7\3mk-\,i^3,c^3! 5K @V@ "*J"J5-4L?up.msgR +SE*iW3w#~*~#k-/ +3_ z 0J5`@|@,4l3@I@) kU-ku Hm _<4n3o,srcq,dstx/  A 1!4P@<@M "@4@"`"3#4+34V-3-'@-'.Z'@-+5/'@282z Y3F5%3@@h@Ah"intXI5Lf~t] (Zoy'O>(#;)o# ;(w(* .e@@@ d3 msggd )hzVi,A, 35E@@5M3@@Ks'Lus .1 @h@w 03@@Z@i43'5u 5('@zY3 %H6%3p@e@Ah"intXf~t][-!qQ-{o33 d {u33 d 3 { 2  l3# 2# argd#]7|75.76{7556 60 636:6O6VK7W6R6{0# +# U7 :##^6 ]#k6}'^6|buf|7|Oq62Vp@@61V 51OK51k63Vrem4OOx6L@@.^6KVbufK5KOH6KO?pMuXB6N.u`/OV_d6PO5QOup 563@@m 3mc{63@j@6 3mb&n30 i363 73p@@ !6L"73u#j7-@@!p,$ap,f6%p7.ud"/3%703ul"703"703=",613"A723&i33#63@e@= ! 3mi!p$apf&tj"63a"-,{"  O"7!O""Or"6#O'/$O"6%3"p7&(6?@)P &ret23")h &ret=3a) '"&) &len3&pad3) e&ret3*U@@&ret3)&ret3r*6@a@&ret3*@@+ret3P)&ret3,@(@&ret3E,@@&ret3*@@E&retX3)0-bufl %^6m])&ret~3..}/0b1]) +buf "63) &len3'*@@+ret13P*@@!&retH3*k@@?&ret 3)HY&ret#3&*@@w&ret?3e*(@M@&retC3*M@y@&retE3)`&ret-3)x&ret3@,(@U@&ret)3*@@ &ret^3): "^6:)T "^6V5*@@r &retS3&retY3) &c{0&ret3.,]@j@+retc3P2{ 3 45{6 BJ7%3p@@mEh"intXI5Lf7e~t] (e 'e0sytm$".9#3#8$3#8%3#8&3# 8'3#w8(3#7)3#8*3#8+3# o.Z%1 id25#@43# pid4#.55# 7#8z#>9z#:A#4@]4 )  8 7 7 8 7 8 8 9 8 "8 8 8 Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 8 9 8 8 8 7 8 Sun Mon Tue! Wed" Thu# Fri$ Sat% 98& 7' o8( AM) PM* 8+ 8,7|p@ @xV8{{F8K83 83+8}&@ @  8`@7@I8__%9bu|!9o@@[@u 8n7`@{@6V8`8@@bF8b htm@@8ԋh8@@%8݅8z@S@Qstr}7z7)tmbIi.5c.^;znz77H'8i .3..F8D`@@DtCpEut/8G   3& tm"(@9%L8 @7&L4 @r,D83 @b,9L2%3@@fG[-!0Q-:oh"intXf~t]y3O :u3O O : 2  l3# 2# arg#6<O@6@cp;ap;% 3=l2CO@@Z@pBapD%;EOPR3,O`@@Jarg+&+vn+Olen-O`3%O@@arg$c$:^M^9%3@Q@G[-!0Q-:o3LRggn:int u3{gng : 2  l3A# 2p# argn# H9  H!# 6" #:~+9&g@@-Karg%Kc%:U9-g@/@YH,p,ap,% 3.l89/`;0gV9<g0@Q@H;p;ap=%;>gPNs9%3`@@[Hoh"intXI5Sf7l~t] (l 'ly.a%1?id2#@43?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K |9'`@@/ 9%[ % V%: h9&:  % 8 VzBO9%3@@Ih"intXf~t] (O[-!|Q-o33 o u33 o 3 2   l3# 2# argo# 9 "W H#W# 9$d# 6%d#9)3@@arg((c(^ 9C3@k@!HBW;BdpB"apBqB 3D d9EX;F3b9U3p@@uHTW;TdpTapVq;W3PgP9%3@@Ioh"intXI5Sf7l~)8~t] (l 'l0y.a//H%1`id2#@43`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %P:&#:#'#;(s#)#]*#^+# %  r/-:$!!0#' l -%9*:Pk-)!@@n:C@@0B'k-D' w2@@7D9P@0@c?0O'dirQ!@@Q)e2@,@S/:>:0@9@k-=!\!=!=::0@@@k-/!%5[ QR( *@@Jh"intXf7Z~t]o>:!@@yn( OM( O"R:@@Kh"intXI5Lf7e~t] (e 'eo 3 pid4Z# p)5Z# (6z# )7# (8y A;HJE P:KE# :#L3#@ ;Mz#D w;NU#H U? Adi:3@@!res3):3 @J@dev;z:P@@.S 3ؒZ =Sz=zpos3;3@-@ 3#/=3uppos3B':0@@U 3=3supret3 = %:C@@QP:B:l@4@;cmdk#k3.pidmZ:pzuh:q;n;rulw:ze;z)JH@4U:Ydirxa:z:h J Y h w:X@@@:W3L:YmsgZ+;1@@fP:0L:2msg3 O;N@@pidMS!;@F@Lh"intXI5Lf7e~)8wt] (e 'ey.Z%1Cid2#@43C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#\!Jl#!K3# ;Ld V' ;.@F@ k-- \!-l, !-3 ;/dT< *P@@PMh"intXf7Z~t]&<%zo<OP@c@m;O idO;zp@@ idO Ho ;@@ idOSU<< *@@Mh"intXf~t]otd.<3@@nOsniUU< *@@Nh"intXf7Z~to$yZ]<$h&<%o&<'#C<(z#<) <! ; O -, O ptr" @@C.  hH<1 @>@o;0O-,0O ptr22pd<7@@[@;6O16O-,6O ptr8<G3`@|@3<F;FOHO'z<U@@<T;TOV< *@@Nh"intXf~t]o<@@2< @@^W=@@)Oh"intXI5Lf~t] (Z=)3 'Zo B=$ = > < ) :#*# ^6+z# len,o# =/& num0o# r=1&#5 Q=4z ppb5z# <6o# =7o# 4=8o# =QoldP=Po=PonewRA]=>b?5=Y@,@Yppbzo\!o#lenoL=oi3Q'z=30@@ppbzoi3R=3 =@@3+ppbz_o =+=3 i3Qarg 3=b3b`:#`^6alenao ==co 7d3newe!"""!#$!=3bshm3 ;opi3 n=3 \!z <=3@`@9 =9b+shm3Tp9%&#%1"a"V"K"B&8'l#w#(9@@k"""&`#)x"&##''''%#?>`@@E*Ţ =9qshm3retȇ+zY3JY~>>@@Ph"intXf~t] (O'O>(#;)d#;(( ##^6$o# w(*q >N@@ ^-M'  >Vd@@7 ^-U. &>@y@p ^- 73R n3% 7>o@@N ^-z 73>ݿ>o@B@H^-73/^6 oe>&a>( k>oP@@ ^-K>^6o$>B@@B ^-An >@w@' ^- 73 ^6o3>X@w@a>u t>h@@n ^-g ^6go0m >6@@!^-7>+$(@V>,3((@>-,(@Z?%@@Qh"intXf~t] (O ?&zy?%d@@Ms$y"?$s1* bit+o tbl,Lidx-3  o os[*?%@ @Rh"intXf~t] (O, &@ @str%len'dA(T o  \3?%@.@vRh"intXf~t] (O@(Sh"intXf~t] (O\?#Ac?%Oy$<p@>@w &: c0:3 :d  t=d0  c?z  dstA  o]p?M+@@i@Sh"intXf~t] 'Oyoy?1d@@T@ i?'d`@i@* ]""l@@Tint~]ohf"#%#,8#X7#tG#?#0#W# +###"low`#*`#  s llv # #M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww "km1km0k?Sl@@V uR vR2 wTVA7-LWbtPmc x   q   @@ <@@ % $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > <  : ; : ;I8 .: ; ' @: ; I4: ; I4: ; I.: ;' I@4: ;I.: ; ' I@: ; I&I.: ;' @4: ; I : ;I: ;I4: ;I.: ; ' I : ; I4: ; I 1X Y !1"1UX Y #.: ;' @$4: ;I%4: ;I &4: ;I '.: ;' I (: ;I)4: ;I*1UX Y+ U,41-41.: ;I/ 0I1!I/ 21341 4 : ;5.: ;' 6 : ;7.: ;' 8!I/9.: ; ' :: ; I;.? : ;' I@<1UX Y= 1>1X Y?1X Y@ A4: ; I B4: ; I? < C4: ; I?  D5IE4: ;I?  % $ > $ >  I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ;  &I I !I/ $ > 4: ; I % $ > $ > : ; I I&I.: ; ' I : ; I .? : ; ' I@ : ; I 4: ; I% $ > $ > : ; I : ;  : ; I8  I.? : ; ' @ : ; I 4: ; I 4: ; I 4: ; I 4: ; I.: ; ' I : ; I&I.? : ; ' I@: ; I 4: ; I1UX Y 1: ; I1UX Y  14: ; I?  % $ > $ > : ; I I : ;  : ; I8  : ; I8 .: ; '  : ; I .? : ; ' I@ : ; I &I.? : ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I1X Y 11X Y 11UX Y  .? : ; ' I@4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I.: ; ' @: ; I4: ; I4: ; I.? : ; ' I@: ; I&I: ; I 4: ; I.? : ; ' @: ; I 4: ; I 4: ; I4: ; I !I/ U% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > .: ; ' I@ : ; I4: ; I: ; I4: ; I.: ;' I : ;I: ;I4: ;I.: ; ' I : ; I: ; I4: ; I4: ;I.? : ;' @: ;I4: ;I4: ;I 4: ;I : ; U!1UX Y"1#1$41%41&1UX Y'1X Y (1X Y )I*!I/% $ > $ > : ; I I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I : ;  &I.? : ; ' I@4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  .: ; ' I  : ; I : ; I4: ; I .? : ; ' I@: ; I4: ; I4: ; I4: ; I  : ;  U1UX Y 1 U41 414: ; I&I4: ; I? < % $ > $ > : ; I I : ;  : ; I8  : ;I8 : ;I8 .: ; '  : ; I : ; I .? : ;' I@: ;I4: ;I&I.: ; ' I@: ; I4: ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ;I4: ;I : ;.? : ;' @.? : ; ' @1X Y  1!1X Y "1#: ;I$4: ;I%: ; I & : ;' : ; % $ > $ > : ; I I$ >  : ;  : ; I8 .: ; '  : ; I : ; I .: ;' I@ : ;I: ;I .? : ;' I@4: ;I .? : ; ' I@: ; I4: ; I4: ; I4: ; I U1X Y 11&II!I/ 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  < I !I/ $ > ' II&I : ;  : ;I8  : ; : ; : ;I8 !I/.: ; ' I@: ; I: ; I4: ; I.: ;' I@: ;I: ;I4: ;I : ;I !: ;I ".? : ;' I@#4: ;I$.: ;' I %: ;I&: ;I'4: ;I(4: ;I )&*4: ;I+1X Y,1-1. /410411.: ; ' @24: ; I 34: ; I44: ;I 54: ; I6 U74: ; I84: ; I 9.: ; ' I :: ; I;: ; I< : ;= : ;>1UX Y?41 @1X YA.: ;' B4: ; I? < % $ > $ > : ; I : ;  : ; I8 .: ; ' I@: ; I : ; I 4: ; I .? : ; ' I@ 4: ; I 4: ; I4: ; I U &I% $ > $ > : ; I.? : ; ' I@: ; I : ; I: ; I 4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > : ; I$ > .: ; ' @.? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I &I: ; I: ; I 4: ; I4: ; I4: ; I? < % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I 4: ; I 4: ; I I !I$ > 4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I$ > .? : ; ' I@% $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/blkidfsck.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.hfsck.hblkid.herrno.ht@M0,/ZNjGYKg =kf`puXf?U*\}0x#t_\ <cPt1= stvX/INt1f5!}-uhF{y5xZYjg}K˃~ =Kx /==gKy~=NPut>l? X(~}Kv2 ȟ׻1 thh@.YjJKfYLIeLIן[uuK?k/Jz $5u]˕g˾xts uKZdɑfxkst %tAYZ/|Kנ="faXn  t ag^0r;Chx&!y|=in= .ex-|"={>~O$ base_device.c "@)ui/  %_=v<  QgLJtOhkZZ>$gLgtR9 ../lib/etismounted.ccom_err.h$@<q ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syscache.clist.htypes.htypes.hstat.hblkid.hblkidP.h$@M\[xtMYB򄼄nXt3 3xw3 -[1'H}?h(ױ>Tf-fO= Y=1tKuhKKS<K+ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidresolve.ctypes.hblkid.hblkidP.hlist.h0@>&~=  Jw[uuNrtJ$/] 1gFEDO&Kz0Nt J1  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidsave.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.herrno.h2@9 P#Nt6.vt1خ,X|Ku僭 u0X</ɭuzH f(^. ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systag.clist.htypes.hblkid.hblkidP.h5@ggQYxXNYY~M .sM"RJM6uM1* P[w.w*J'tyT{'?4gxf f=oJ{ycXfg,h}X7JsX= .sf=_.uu=Iug=itJYf?vYgΑwYv=> X~i#Yyf5fJ\wYlك] uKXsY g<c<=Y=.׼tc=g=t&sdOv<c<=Y=tur  ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysdevname.clist.htypes.hblkid.hblkidP.h0<@<Xj[pJH|t$J.AMZ.g ȿ+"$$ijf vuu=c<=/=.6S /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkid../../lib/uuidprobe.cprobe.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid_types.hblkid.hblkidP.hlist.huuid.herrno.h0>@'Yw1)L?X%<XKgwtTJ <X2o3}to<Yff<du" X\/KU_v=_=}kXyhLm0pkJ0pmJy=0z̩ZY~0[Y.guF@tz g//}#Y!ׁ2u@i3i=Y=h ."iz$KL=hu歠בh-z0>zxo -s|!Y!=!=!=gAr )qiEgk.iEg8.tYeJkl<tffYjJf7 hnJ gguu tuuK?S |<t|[u|<tw>K?S?"\{{<{< ufA{XNMvX X]"{tf[ /|) >Y24?{<t{tf~֭/Yx.<~Z!pX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidgetsize.ctypes.htypes.hblkid_types.hblkid.hstat.h[@=wa3l .D .v$pJ ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cblkid_types.hblkid.herrno.h\@vAyX: isnull.c]@&<]s+1n /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.h0]@3B gzJgzgm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.h]@&=uuuA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hD^@}Y/g?LNf~= uZ!LM  ctype.cp_@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h`a@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.hi@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDZ: ../../includestrncmp.cstddef.hk@$>9LV2z Z: ../../includestrncpy.cstddef.hk@)Xg[ye_< rindex.c0l@*xG=v,029 strcat.c`l@"?; index.cl@*z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.hx@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.hy@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=lsC ../../include/arch/i386msleep.cstdint.h`~@*<xK-!ĠK-Ksg&zX3 pv.c0@=xi=eN ../../../include/arch/i386get_tick_count.cstdint.h`@ >{ ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.hp@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf 6 unlink.c@&?y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.hЅ@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.hP@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]9 ../../../includeuser.ctypes.h@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h0@i+G ../../../includemktemp.cstddef.herrno.hp@+?82Y t2,I,Ii.i. >绾;/w X hC ../../../include/arch/i386rpc.cstdint.h @!X@Kxx< [T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ 3 sleep.c0@=xM ../../includelost_path.ccollections.hstddef.h@@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c@=gP ../../../include/arch/i386add_intr_handler.cstdint.h@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h@@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hp@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io\T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.h@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h`@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.hP@?Dx ?Dx =3 puts.c@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.h@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x S9 ../../includestrdup.cstddef.h@%$T9 ../../includestrlen.cstddef.h@##+.?>V9 ../../includememchr.cstddef.h0@(JgKwp@G ../../includememset.cstddef.hbsdtypes.hp@;fr<A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hl@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@AB F4@+AB  4@@TAB FX.$4@AB FN.S.4D@SAB DM.4@&AB R.4@>AB J.4@AB BX. 4@nAB FR. 4@]AB Fm. 4\@AB Ft.44 @AB Fw.Z.M.u.].T.~. 4 @UAB Ff.L4` @AB Ix.x..P.h.\..... S.d.}.04\@AB FB.P..O.g.4\@%AB D@4@AB Fg.P.S.Q.d.\.X..i.n.4@@ D  F AB D\.S._.X.. ..i.I.l.c.x.U.W...T.{.Q..U.i.x..V.|  | "@AB FP.| $@AB |  $@\AB Fg.(T%@AB BJ.e.\.p.X.$%@AB FO..| l&@ AB l&@ AB X. l&@\AB FA.l('@=AB DE. lh'@AB FE. lh(@[AB B_.k.l(@2AB G.|  \(@@AB FS. \8)@hAB FU.\)@AB H. \)@LAB FF.(\*@XAB IC..T.$\X+@AB FS.}.| L,@LAB Bn.LT,@5AB D[.L,@OAB Bu.<L,@AB IR..E.U.C.L.T.a.b.|  0@5AB Ft.2@AB EX.|  X2@AB Fx.| 5@PAB B 5@OAB Fp. $6@MAB Fp.t6@ZAB _.,6@eAB Fm.X.@.{.e.88@ AB X. X8@]AB Dg.b.8@0AB DE. 8@AB FZ.9@2AB G.,9@fAB Fg..U.u..| ( 0<@AB ( 8<@AB  ( H<@&AB DE.P.(( p<@AB Fx.).Z.|  0>@)AB  \>@AB  d>@`AB C >@AB  >@HAB Be. ?@6AB F. L@@#AB W. p@@2AB D_. @@3AB DO. @@0AB ]. A@0AB ]. 8A@5AB DO. pA@ZAB FH. A@:AB BW.P. B@AB BW.S. B@@AB Bg. B@AB DI.f. LC@@AB BZ.M.( C@AB FZ.M.G.q. AB A| m@-AB A| 8@m@AB BD8m@"AB |  n@AB F| o@9AB p@AG Fp@hAB Bq@AB q@ AB  q@AB F@r@ AB `r@ AB r@oAB Ft@#AB  u@!AB |  Pu@vAB FIFv@AB  v@AB AFFw@>AB | x@dAB Fx@oAB Fx@AB E| y@:AB D0z@1AB pz@1AB z@0AB z@AB {@IAB FP|@AB Ap|@AB ON}@YAB X`}@YAB X }@AB IFF| D`~@AB Dp~@JAB ACD~@jAB AF| 0@ AB @@AB | `@ AB |  p@&AB  @'AB  @AB F P@gAB AG @AB  @AB MF p@_AB L Ђ@GAB FF  @AB L @AB  @AB F @AB F| @ AB | Ѕ@IAB D @IAB Dp@IAB D@AB E@_AB D @%AB P@%AB @aAB  @AB MFFЉ@WAB D0@qAB D@AB Њ@"AB @IAG | PP@AG Pp@AG P@yAB CP@ AB CP @AB FP@KAB P0@RAB AFP@AB OP@@AB OP@tAB LFPp@IAB P@AB LPP@ AB P`@AB EP@"AB | @@]AB D| D@AG D@qAB LD@@"AB | p@ AG @AD @AG @AG Д@$AB | 4@AD 4@AD 4 @ AG 40@ AG 4@@ AG 4P@AB  4p@AB FHE4@@EAB D4@AB FI 4P@AB IFF| \ @AD \ @AD \ @AD \ @AD |  0@AB C 0@#AB  `@AB E @AB F К@&AB | t!@0AB | !0@"AB !`@#AB !@AB !@AB IH!@@AB !`@ AB | L"p@AB FL"@AB F| " @AD "@@DAB E| "@dAB F"@+AB JI| @#0@ AB | l#@@7AB Cl#@AB Fl#0@AB Fl#@AB F| $@ AB $@AB $0@!AB D$`@ AB $p@ AB | $@AB | $@AB | $@;AB $@!AB $0@JAB IF$@"AB | d%@$AB d%@AB d%@ AB d%@NAB Dd%`@AB BFd%@NAB Dd%@@\AB Dd%@kAB Dd%@jAB H| p&@AD p&@AB p&@AB p&@ AB p&б@AB Dp&@+AB p&@-AB p& @.AB p&P@AB FKp&P@xAB Dp&д@aAB Dp&@@AB FFp&е@AB Dp&`@zAB Dp&@#AB  p&@fAB IFFp&@RAB FFp&@EAB Dp&0@UAB FFp&@UAB Fp&@RAB Dp&P@AB IIp& @6AB Cp&`@AB p&@AB Ip&P@AB F| d)@@bAB Ed)@AB d)@GAB d) @HAB B|  )p@dAB FLG)@AB F)@'AB )@AB F)p@EAB A)@0AB F)@uAB C| *p@AB F*@'AB *@@AB *`@AB *@ AG *@ AG *@AD *@AB AG*`@AB E| +@6AB +@@AB +`@@AB FF+@AB | T,@ AB DT,@OAB GT,0@!AB | ,`@?AB |  ,@dAB FGG,@[AB H,p@(AB | T-@AB T-@0AB T-@ AB T-@0AB T-0@ AB T-@@`AB FF| .@AB | ,.@QAB A,. @*AB ,.P@mAB F,.@mAB BC,.0@rAB FI,.@7AB D,.@DAB F,.@@AB D,.@AB PF,.@+AB | d/@fAB D| /P@AB /p@AB /@AB | /@AB | 0@AAB LF0 @AB 0@@AB 0`@AB 0@AB | 0@ AB 0@ AB | 0@lAB C00@VAB C0@jAB F0@`AB F0`@HAB L| 1@AG 1@!AB 1@yAB HF1@AB  1@AB FFF1P@lAB FF1@)AB D1@AB MF1@OAB D1@!AB | 2@AD F|  3@JAB FI| @3@AD | l30@9AB A| 3p@AB F| 3@@AB 3`@ AB | 4l@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutchecked_typewait_manyfilesyscompile_fs_typeforce_all_parallelprevcheck_allpass_donefirst_negateold_fstabglobal_statusskip_rootparse_wordst_inostring_to_intfsck_prefix_pathserializeparse_escaperetvalkill_allnum_runningmainparallel_rootfilesys_lastcancel_requestedret_instnlink_tgid_toptionsfilesys_infost_blocksst_uidprogressprogress_fdblkcnt_tlookupnotitlecreate_fs_devicesignumnot_done_yetskip_over_worddevice_already_activeinstance_listparse_fstab_linest_atimeinteractivefsck_patherrnoGNU C 4.2.2st_modemntpntfsck.cinterpret_typeignored_typeswait_flagsfind_fsckfs_matchpassnoblkid_cachefree_instancefs_type_compileskip_over_blank/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscmountptdev_tignore_mountedtime_tprogfs_type_compiledopts_for_fsckignorebasest_nlinkprognameexit_statusload_fs_infofs_type_syntax_errorstring_copyst_blksizekill_sentst_ctimeoptlistfsck_devicefsck_instancest_rdevnext_argbase_devicenoexecuteverbosereally_wantedmax_runningprogress_activestart_timenum_argsst_gidmntptusagelinenostderroldpathstrip_linefreqwait_onemode_tst_devinst2blksize_tnum_devicesret_fsblkid_struct_cacheopt_in_listloop_special_casedoallst_mtimeino_terroutdevfs_hierdiskbase_device.cmount_flagserrcode_tismounted.ccheck_mntent_filemtab_fileis_mountedbit_namesbid_prilist_headblkid_tagblkid_gc_cacheblkid_struct_devbic_devsbic_filenameblkid_struct_tagbit_namebid_namebid_tagsbid_devsbic_flagsret_cachebic_timeblkid_debug_maskbid_labelblkid_get_cachebit_val/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/blkidlist_emptysafe_getenvbit_devbit_tagsbid_uuidcache.cbid_devnoblkid_put_cachebic_tagsbid_typeblkid_devbid_timebid_flagsbid_cachebic_ftimepnextblkid_dev_devnameblkid_dev_iterateblkid_dev_iterate_beginblkid_dev_nextnew_typedev.c__list_delret_devblkid_dev_iterate_endblkid_new_devblkid_dev_set_searchblkid_free_devnew_valueiterblkid_struct_dev_iteratesearch_typesearch_valuedevdirsadd_to_dirlistdirentdir_listblkid__scan_dirnew_listd_reclenfree_dirlistblkid_devno_to_devnamecurrentblkid_strndupdevno.cdirlenblkid_strdupparse_devblkid_read_cacheparse_tokenblkid_parse_linedev_pparse_tagparse_endparse_startread.ctagnameblkid_get_devnamefoundblkid_get_tag_valueresolve.csave.copenedblkid_flush_cachesave_dev__list_addblkid_find_dev_with_tagtag.cvlengthblkid_tag_iterate_beginblkid_tag_iterate_endblkid_dev_has_tagtry_againprobe_newblkid_tag_iterateblkid_find_head_cacheblkid_tag_nextblkid_struct_tag_iterateblkid_set_tagdev_varblkid_new_tagblkid_free_tagret_valblkid_parse_tag_stringlist_add_tailblkid_find_tag_devblkid_probe_allonly_if_newdev2blkid_probe_all_newblkid_get_devdevname.cs_dummy5s_mmp_intervalmodify_datereserved1nr_diskss_journal_inumxs_dummy2rs4_dummy2blkid_loff_t__pad1embed_first_blocksystem_supports_ext4patch_versionoem_idprobe_cramfsleaf_offs_def_hash_versionsb_validprobe_gfsvd_typeprobe_romfsms_sysidvs_hiddens_jnl_blocksoffset_xlvol_bkupocfs_volume_headerbytes_allocatedbuf_mftvolume_idext_block_startmd_magicswap_id_blockos9_folderrs_orig_journal_sizedl_idvd_idnext_cnids_free_blocks_countbim_lensws_volumexs_dblockss_algorithm_usage_bitmapsb_bsize_shiftfs_nameuuid_tsect_countprobe_ext4devreiser4_super_blocklvm2_pv_label_headerfat_entry_offatrbleveltime_creatxs_dummy1probe_hfsplusms_headsxs_dummy3blkid_known_fstypevd_versionms_ignoredsystem_supports_ext4devs_stateprobe_swap1sectors_per_clusterminor_versionlast_checkjumpret_uuidlast_mount_versvs_cluster_sizes_reserved_word_padjs_sizers_journal_blockset_uuid0probe_reiserfs4no_addrheightcluster_per_mft_recordmsdos_super_blockxs_ifreecat_fileromfs_super_blockfile_attributesequence_numbers_prealloc_dir_blocksdir_countbuf_sizesb_multihost_formatrs4_dummynext_sect_offlabel_strvs_sysids_feature_incompatprobe_jfsusa_ofsprobe_swap0checksumvol_idleaf_blockdepthudf_magiccheck_for_modulesusa_counttotal_blockswr_cntvs_flagsbios_parameter_blocksws_badpgjs_versionvs_pmagicattrlvm2_calc_crcno_formal_inos_min_extra_isizexs_fnamentfs_super_blockattr_filesignaturers_dummy2rs_dummy3rs_dummy4no_namevs_ignoredcrctabprobe_ocfs2vfat_super_blockjs_loguuidblkid_verifyjs_l2bsizers4_uuidembed_blockcountprobe_luksrs_magichfsplus_catalog_keys_prealloc_blockss_journal_uuidvs_total_sectget_buffers_mmp_blockunicode_16be_to_utf8unicode_lensb_master_dirsb_bsizehfsplus_extent__u16not_persistents_first_data_blockvs_magicmount_lenparent_idattr_lenvbm_stvol_seq_numvs_versionsws_padblkid_magicgfs2_meta_headernon_residentreiserfs_super_blockext_block_countisosbfuturemdp_superblock_ss_raid_stridefound_typebytes_per_sectorsws_versionms_fat_lengthprobe_lvm2checked_datevalue_lenleaf_node_sizeprobe_fat_nomagicrs_labelalloc_first_blockleaf_node_headout_lenprobe_hfsnum_root_dirsstart_filelink_countosx_foldervalue_offsetvs_dummy2ms_cluster_sizecluster_countprobe_ext2xs_fdblocksmaster_file_table_recordclp_sizes_free_inodes_countxs_magicssize_tname_offsetms_serno__u32create_datealloc_block_sizecramfs_super_blocksb_lockprotoros_magicms_hiddenhfs_mdbfs_proc_checkleaf_node_countrs_uuidcrc_xlvs_insfo_sectormaxloophfs_finder_infoattr_offin_lenmh_magicdate_creatfigure_label_lennext_allocms_secs_trackcheck_mdraidunicodeprobe_iso9660blkid_probe_tset_uuid2nm_flsls_Modprobe_udfroot_startjs_labelopen_errmh_typevs_fat32_lengthset_uuidms_unknownms_magickey_lenjs_bsizerecord_countjs_magicct_clump_sizeuuid_strmft_mirror_cluster_locationret_readdisk_lockfilesprobe_zfsgfs2_inumcramfs_infovs_headsprobe_ocfsros_volumemh_formatstart_apppv_uuid__pad0__pad2space_sizers_free_blockssb_fs_formatvs_backup_bootjs_dummy2jfs_super_blocknumber_of_sectorsbim_kboffsws_nrbadescape_sequencessearch_fat_labels_feature_ro_compatiso_volume_descriptorext2_super_blocks_hash_seeds_free_blocks_hinext_offvs_sernos_inodes_countextentsname_lenjs_l2bfactorstart_blockms_labelms_mediavs_reservedprobe_oracleasm__u64mft_record_size__s8editionhfsplus_bnode_descriptorsystem_idms_pmagicvs_unknownleaf_countvol_sernotype_arraysb_headerprobe_gfs2rs_blocks_counts_jnl_backup_types_first_meta_bgdiffs_last_orphanocfs2_super_blockdl_tagval_lenvs_root_clustergvalid_wordsrs_root_blockprobe_ntfsocfs_volume_labelstart_data_sectal_blk_sizersrc_clump_szmountcat_blockdate_accxs_icounts_mkfs_timeros_dummy1js_pads_default_mount_optsvs_secs_trackcluster_lows_last_mountedleaf_tailxfs_super_blockrs_blocksizemft_cluster_location__u8time_accprobe_reiserfsxt_clump_sizeencodings_bmpunusedhfsplus_vol_headergfs2_sbprobe_ext3ms_fatss_r_blocks_count_hibim_sboffvs_reserved2vs_labelvs_dir_entriesopen_folders_want_extra_isizevs_mediatotal_sizeembed_startblockbim_probecluster_highvolume_serialhfsplus_forkalloc_files_blocks_count_hibim_typefat_sizeblkid_probeset_uuid1s_volume_nameset_uuid3sws_lastpagevs_sectorscluster_per_index_recordvs_fat_lengthrs4_magicvol_labelms_dummy2probe_fatattributesboot_folderjs_l2pbsizexs_uuid__s64xs_blocksizeblkid_swab16vs_sector_sizeget_ext2_infofree_bksal_bl_stmd_minorvs_fatsnr_clustersattrs_offsetext_filexs_rblocksroot_dir_entriessector_xlms_reservedwrite_countembed_sigvol_id_lensb_root_dirs_reserved_gdt_blocksms_sectorsoracle_asm_disk_labelms_total_sectleaf_headbuf_maxbim_magicfolder_countdata_clump_szbytes_in_usefile_countms_dir_entriesprobe_jbddescrsws_uuids_r_blocks_countdate_writesb_locktablealloc_ptrbnodeprobe.cjs_pbsizesbbufhfsplus_bheader_recordblkid_swab32cr_datenewbufjs_uuidtime_writenum_recsval_offs_log_block_sizeattr_typeprobe_xfss_raid_stripe_widthvfat_dir_entryraid_disksmajor_versionbackup_datenm_al_blksnxt_cnidprobe_ext4rs_journal_devs_feature_compatms_sector_sizers4_labelvalid_blkgetsize64valid_offsetgetsize.cblkid_get_dev_sizeoriginllseek.cblkid_llseek/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/uuidisnull.cuuid_is_nullfmt_uppertime_midtime_hi_and_versionuuid_unparse_loweruuid_unparse_xuuid_unparseuint16_tclock_sequuid_unparse_upperfmt_lowertime_lowunparse.cunpack.cuuid_unpack/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex doubleisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockpagesl_pageCountmajSizefirstendptroverflowstrtol.cstrtolstrncmp.c/home/tyndur/tyndur/src/lib/stringstrncmpstrncpy.cstrncpystrrchr.csavestrrchrstrcat.cstrcatappendstrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cstrtok.cspanpdelim__strtok_rstrtokcontdst0memcpy.csrc0positivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_lenmsleep.cuint64_tmsecmsleepdo_nothing/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cget_tick_count.cget_tick_countgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_index/home/tyndur/tyndur/src/modules/lib/posixunlinkunlink.cSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flags__builtin_va_listold_posio_resposix_files.cF_GETFLflags_sizefd_to_filefd_listnext_fdaccess.caccessreadlinksymlinkbufsizenewpathmisc.cgetpagesizeisattygethostnamepipeumaskmkfifostat_buffchmodinode_numlost_statmknodfstatstat.clstatmkdiruser.cgeteuidgetuidgetegidgetgidwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpiderror_messageerror_codestrerrorstrerror.creaddirio_direntry_type_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirfileidmktemp.cmkstempmktemptemplatesend_messagemetadataio_create_linklink_dirend_free_pathlink_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlinkyieldtextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tfputssetbuffopenfflushfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftellsetbufferatexitexit.catexit_listabortptr_typedivisorremainderulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexaFebtime.caFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namerpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_topen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrdup.cstrlen.cstrlenmemchr.cmemchrmemset.cu_charu_intgetpidgetpid.cgetppid__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuut:PPP7Q7ARA\Q\xRxQSSSYrWuutPPuu tPVPVSPSS !u!#u#t <P<tp <R<tl <Q<th EEWtWtW t t  ttGkSkVSSSVuu#tP!S$%u%'u'JtLMuMOuOtL^Pfkt|kpPprt|rPt|uutPS S SR RV VPPPuut+P+RWTXPX^W`W%QVT]V`VHPSdSuutPSPSPVPVuutPS6SS/6PL[PPuutPWWWS24SMStp*tptl1tlXQfQQQQ&Q4>QKTQQuutPWWSSVVuu t P  t{ R  t{HJt| t|^ ` t|r t t| t| t| [ t| t| PS [ PHMPRb g P R RYPP P P- 1 P%5t|5 t|  t| ( t|(  t| t| t| V  V V  V- C V V W5W W/ W  W W  W - W W R P R P R  R S S  S P S u u t P I VL : V V L tp tp tp Y t`Y ] P] t` P t` P t` L tX tX tX tX L t\ t\ t\ H SQ - S S u u t P P P P Suut1cSi~SgSoS.S_SpAt`s.t`J_t`t`Atd|.tdJ_tdAth|.thJ_thAtl|.tlJ_tlAtp|tp.tpJ_tp%V8AV|&VXVV.VJ_V0W8AW|WXWWWPW!P!.WJ_WuQuutqtuqtuEpW 2WCDtvDnS S 2tv',tv6;tvutvtv 2tv:Etv;tvtv[tvltvtv Xtvdtv:tv;tv[ltvEDS -S-2PYtvYtRttvRtvVEVLV"YVu{V V{V+ VX{VV:V;VlVPepPPPnyPPPVVEVLV"YVu{V V-V{VPVVd{VVV [VtvtvtvtvtvtvtvtvQS&+SSSStv Xtvdtv:EtvTtv;tv[ltvtv Xtvdtv:Etv;tv[ltvtv Xtvdtv:Etv;tv[ltv"VrVrPLV"YVu{VP V{V:EV;V"tvVP]V]ftvffVf!tv!EVEtv Xtvdtv:Etv;tv[ltv"tv Xtvdtv:Etv;tv[ltv"rW\W2XW{W"tv Xtvdtv:Etv;tv[ltv"tv Xtvdtv:Etv;tv[ltv"tv Xtvdtv:Etv;tv[ltv"tl Xtldtl:Etl;tl[ltlEYV 2VP P P;=Puut8tt2Ntlbtltlhytdtdtdtd  td @S@aRayStdRtdtdRtdDSRVtd`ctdcmP{~td~RtdRtd]mRR SSSDSuutuu\tZWZ\t$S$&V&XSXYVV$P$NVNTPTYVY\P\]u]_u_t\yySt St St SPuutWtWtBtpIVuu t u u,t ,P,,t,-u-/u/t,EENSNRtRS,EEOVORt RVuutStuuttt tuu#tSt S #tR RRPV$%u%'u'Vt<NRRVRuu@t!P!>W>@P =V<S@AuACuCt@SSVtVVt@SSWt Wt Wt elSllPlSSuutuutPVVRWW u  u `t))6t?`t&&=t =`&t&`)V)1P1NVNQPQ`V?IRKVRVaPaR=FPQ`R`auacuct`tuuLt P )V+LV (S+2S28PBLSLMuMOuOtLWPWSuutPSSuutt%.P.5SIPSP\P\SVP6V69P9VV19t_\t_RR19t_\t_PDct_c}t_} t_ t_t_t_t_\\P P5PP19t_\t_t_t_=t_QSt_t_19t_\t_t_19t_\t_19t_\#t_#+V+.P.Vt_t_Vt_16V\VVP!VVV19t_\t_Vt_uu5tWtWtWt5WVt Vt Vt 5V\S\tStSt S tS't')S).t.0S05tGRP_bPP\SSS S'S).S05S89u9;u;t8JJVtVtVt8wwt t 8JJStStStuPPPbpPPPSSSuuttXSSS{SSattttttvttIKW WattUttaSSS=DSDRPRhSSPSHTVTZPZVVPVVPVVIWWW{WWuuPtPRPQ$S$'t'PSPQuQSuStPaPi|PPP_R_gWgiRipWp|R|WaaPP_eSsSuuttRtWt WPPPSSuuJtPtPJt  Jt !!JtP#3PBEPLMuMOuOtL\\tLuut L||tPP\lPP\nthth\ntltlcjSeS\ntptpVVuutPtuu1t#S#)t)/S/1tRPR R)RP45u57u7dt4NNbSbdtdeuegugtdttySytSttyPyWWPWy}SPSPSPSPSuuBt(:R>BRDEuEGuGtDTT]S]ataSDYYat akkt %t 35t Ft t t t DtD tY_WVW%VF]V_fVfnWnyPyWVVWVYPYWYathththVthuthYatl|tlYatp%tpAtptptptpYaRRRRYaQQQQYaRRRRRDVRuutP u u tuu>t@AuACuCt@SS]W]_t_W@SSUVU_t _Vt Vt @U[SSPSSSPSU\V\_RfSVRSSVUWPW_tptpPtpfwPzPUWPPPuu)t P )Q R R P 'P,-u-/u/3t,1P45u57u7t4BPBQ4ORO_W_qRqWRWRWMSSuutuutVtVtuutt tt*S.SSQRVW!,W1W!.Q5SPSeQePQuu?t@AuACuCrtJpStuuuwuwtuutPtPRRuutPtPRR u  u =t@AuACuCt@VPVt@@VRVbVeVV@VQVaSeSSuutuuWtStWS1PSWPXYuY[u[tXiiVtVXiirPrtPuutt QtQt Q tQSSSuu\t--TVTVtV\V--SSSVtV\S0@PZ\P\]u]_u_ t\rPr tp\rRrWW W\QQlrSrQSQS StPP  u u6t 2Q26t89u9;u;rt8GGnQnrttuuuwuwttQtuut..VtV..t"7PPPuutP-W/WWYWRQthQtht%'PADPv{PPuu t t\ tX tTx W W u u t   t   + W+ t   t u u F t  F t PR . PRH I uI K uK ptH g g t ptH s s ptl } P P PPe W + W Wz R R t~ pt~ We WpWl r R Rl S S!S Vl VpV PR PR PR t~ t~pt~ P t~a v P  P; N t~N U Va t~pt~pquqsustptt  ttptPtPtPt4t>ttVLtT}tt#\S*fSS<V[_V_fPPtLtQQt't'Q+QtQQSSSR)RRy/VfxVVVV#SfSSSuuututlS!t !mSmut uthxyuy{u{txPtVVVuu@tQ@AuACuCtO|QuutStSuuTtStTSTUuUWuWtTttTkkt SWSPSP@QSQSPSStptpPPwSSS*VSVV"VW\VxVuuttMMttStjSjltltSOZPrtPPPP9PtuuuwuwttttStStSPPPPPPuubtNtN--bttP't'.R.2P2CRC-t-URPCLW0WbWV"t{CSVCKt{VKNt{-t{-]SV]vt{Vvt{t{Vbt{QVCKV PCFPQQCNQQCNQLW-0WSCJSQQCNQACPRPRPRRCNRRP3;PJLPFNt{[bt{FJS]_S_cQcSPSQSQSRQRbSuu?tP5S7=SRQ@AuACuC4t@]]Wt2W24t~(t(t RQuuGt  Pt"PR"'t R')t )4PR4APtAGt uu t tuu_tPR]VQ\S`auacucrttuuuwuwtuutuuntuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt)u)Q 'S &Ptt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttuttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVttuttZu))Zu%<SVAZSV`atactcu`uSVSVtt utt!utt u Ptt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Pttu !t!#t#u EEuhuVVACPySttutt uttu !t!(t(4u@AtAHtHTu`atactcuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuWuWPS7[QSSQ{QupQ !t!#t#u CCWuWuCVVttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nulultt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttJu++FWFJu@V')PttuQtt9u'u',,9u*S*,u ,4S49u 9Qttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulSttu !t!#t#)uuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_PFH` 4K L>Kh  f  [  N   ~ g p S \ ? H 7 WB   f  N 8| %|08=l;[:X{- =q;[:X{ {-tXvMsQe.J +;[';[' +^=dT{2Xub{2XuMd0;_2X_2Xt]fH_hvLkx!#35BEsvLO`cz @ tev t!,etKT  yDf#+ ||||'W*W*.lNY`b`bLp(,BP'BP'*3*@&(&(*@&(*@*A$p\\,8KX_r02 (:(:@O/25;8X8L0DL]GI$9;57HO`d"*8 *8"8^8EZ^VXT8(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)03"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@T'@-@] 5` @` \?@F@M@R @ L X@l ]l f"# u-_HM6~K_T2H40f?s>`& 0_@@@@` @@@@ @ @     @@(` @;@H@^@ m$@ t@@ @ @ @@@P@!t@@+ @@T@&D@S4@&:@>H@T@n_@]n\@x@  @`@$ @(  @U` @\@\@%@|@@ '(@@4)@LC@ KR,@LaT,@5q,@O|5@O9@20<@0>@)\>@d>@`>@@( ?@6'@@3L@@#Cp@@2Q@@3]@@0jA@0v8A@5pA@ZA@:B@B@@B@LC@@C@`%@@ Q]f%@ rx@@7%@  P@ '@  '@  '@ % , '@ 8 B p@EM T @ @`_ (@$ b 8 @n 4 @{ @              @y $(@ " ((@ - ,(@ 7 A J S \ e nn @0 @N ]@ h'@ &@\ m@- @  @Q @ z@0 0@  @ 0@ X+@% `@- @`; H<@&K @m@"T @!^ @(@ g P|@x @ @@ %@ @O y@ p|@ `(@ )@ 2@ 0@U @O >@H P@% @0 @ }@Y+ p@(4 @E @m@P %@` 6@ex 0@ ~ p@h t6@Z S@ @ @f @ @ @ P@l @@ )@ p<@ q@ @ _@ @+# (@21 `@6 @+E @W 0@Vd x@dq `@ x p@  0@ P@ @  @  n@ `@ @ @  б@ x@o 0@" @$@"@qК@&@k#p@(y@:A`@I a@Q@X`@#b`@Hmд@ard@?y@ @@~@j[@`@?&@ @[ @ u@! @ p@p@`@4]@@@u#_@/+P@x2T%@B@Vv@lX8@]{@2@ @l@_@tЅ@I8@0D^@'@-@@p@@ @ `@ &P`@//@_5$@@(@ Nh(@[]@ g)@ wi@~@o@9P@0@5@0l@)`a@8@@j`i@3 @*`r@ ('@=/@;@)Hp@INq@S]@ `@@Ef@!n@Is@@ 9@f@ @0`l@<@z@@6 @  $@\Ђ@G"p@5@B`@zH@ V@lc@ p@ z,@0@9@'%@ 0@#@@D@@@ @8)@h@@ P@@0@ &@ Љ@W@]@n+q@ 3`@;k@KC@ O@Vk@Q^@ ep@_l@@@'@ @@\h@V@ "@pz@1}@@7 @dm@"  @%+P@ 2@70@rD`@L@`@j@Up@Jw@!@0r@o@@"*@Xw@> @6l@@@p@@@ е@@(@  @ @+5@>@@Ep@&Z@b@ n@@v`@{`@ @ a@`@  `@.p_@@A@Nl@>@`@@P@0@!@@ @mp@ %@ +@R1Д@$=0@!EP@mW@r@ ^@Ge@m`}@Y{%@ @p@I@ @ Pu@v5@P@Ep@d@@]@@'@@@j,`@;(@ D@I_@Q@ d@fk(@ w)@ @@]@@`l@`@  +@@ @@@#P@0z@1`@ @ @H@,8<@@ @IJ @.Q$6@Md @qt@#v_@~0@J@"@ @\@G@@@@b@ v@x@`@@`@ @a@@ $@D0l@.7@dF@RL0@ [@@d x@ @@ @ @ P@p~@J @@y@ Њ@"@@;p@ 0@q@@*88@ @pa@E@Q@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startfsck.cparse_escapeprogress_activestring_copycreate_fs_devicefree_instanceusagestring_to_intopt_in_listparse_wordinterpret_typefind_fsckprog.2582ignoreignored_typesreally_wantedkill_allfsck_devicewait_onewait_manycheck_allfs_type_syntax_errorbase_device.cdevfs_hierismounted.ccache.cdev.cdevno.cfree_dirlistadd_to_dirlistdevdirsread.cskip_over_wordskip_over_blankstrip_lineresolve.csave.ctag.cblkid_find_head_cacheblkid_new_tagdevname.cprobe_allprobe.cfigure_label_lencheck_for_modulessearch_fat_labelprobe_zfstype_arrayprobe_lvm2crctab.3810probe_oracleasmprobe_iso9660probe_swap0probe_cramfsprobe_romfsprobe_luksset_uuidprobe_ocfs2probe_jfsprobe_reiserfs4probe_reiserfsprobe_xfsget_ext2_infoprobe_jbdprobe_ext2probe_ext3probe_ocfsget_bufferprobe_udfudf_magicprobe_swap1probe_hfsprobe_ntfsprobe_fatno_nameprobe_fat_nomagicfs_proc_checksystem_supports_ext4devret.3029last_check.3028system_supports_ext4ret.3010last_check.3009probe_ext4probe_ext4devprobe_gfsprobe_gfs2probe_hfsplusgetsize.cvalid_offsetllseek.cisnull.cunparse.cuuid_unparse_xfmt_lowerfmt_upperunpack.clibgcc2.cctype.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrtol.cstrncmp.cstrncpy.cstrrchr.cstrcat.cstrchr.cstrcmp.cstrcpy.cstrtok.clast.930memcpy.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idmsleep.cdo_nothingpv.cget_tick_count.cenvvars.cenvvar_listgetenvvarunlink.csignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_fileaccess.clink.cmisc.cstat.clost_statinode_numuser.cwait.cwait_listrpc_child_exitstrerror.cerror_message.1085posix_dir.cmktemp.cfileid.1150rpc.clost_link.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indextime.cmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrdup.cstrlen.cmemchr.cmemset.cgetpid.cparse_pos_paramsputcharuuid_unparseblkid_dev_set_searchblkid_dev_nextstrcpyasctimeinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidblkid_devno_to_devnametmpfileppb_from_argvblkid_probe_allstrtok_rlist_sizeprognamerpc_get_responsegetgidprintfstdoutvsprintflibrpc_rpc_handlerrpc_get_stringargsblkid_strdupblkid_get_tag_valueungetclist_pushblkid_known_fstypesigemptysetstrerrorgeteuidrpc_get_intsnprintfio_split_dirname__strtok_rblkid_put_cacheblkid_find_dev_with_tagmknodatolblkid_dev_has_tagblkid_verifyget_parent_pidlio_seekserializegetenvfchmodlist_popfsck_prefix_patherrnoblkid_get_devstrtoldgetegidisblanksetlinebufblkid_new_devgetsio_create_linkio_split_filenameppb_get_argctimer_cancelgetpidgetpagesizeio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freeverbosewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatreadlinkinit_waitpidputsdup2rpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_emptyisattysleepblkid_get_dev_size_assertblkid_dev_devnamevsnprintfrpcstrtoul__dso_handleitoamktempispunctuuid_unparse_lowerreaddirjvprintfisspacefflushblkid_get_cachelist_get_element_atregister_intr_handlerblkid_free_tagdirectory_openblkid_flush_cacheputenv__umoddi3lseeksigaddsetblkid_tag_iterate_begin__udivdi3setbufferabortprintf_putcgmtime_rchmodsprintf_putcget_tick_countisxdigitalarmis_mountedinstance_listblkid_free_devfsck_pathmessage_handlerstrtolpipestrnlencreate_shared_memoryblkid_get_devnamerenamestrrchrinit_memory_managerblkid_parse_tag_stringstdio_initcallocinit_dev_registerstrtodblkid_dev_iterate_beginlist_insertlist_destroywriteatofuuid_is_nullfstatfprintfkillinit_service_registerctimeblkid_set_tagfilesys_infodirectory_createstrcatadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infoblkid_gc_cachechdiropen_shared_memory__dtor_end__fseekparallel_rootppb_is_validfilesys_lastnoexecuteblkid_read_cachememchrjprintf_putcstdinwaitsend_messageinit_envvarsumaskmktimeblkid_strndup_startlstatferrorsyscall_pblkid_dev_iterate_endsignalreaduuid_unpackstrcollisupperstrncmpnum_runningfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexignore_mountedputsnreallocset_rpc_handlerbase_devicerpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopenforkinit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullsymlinkblkid__scan_dirinit_messagingfopen__bss_startlocaltimememsetmainftell__dtor_start__fs_type_compiledblkid_debug_maskinit_service_get_nameclearerrfclosegetenv_name_by_indexgetcharprogress_fdgetppidtimeopendirprogressisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsescachefgetcgethostnamesprintfcmdline_copy_argvstrtofatexitstrcspnrpc_get_dwordstderrmkstempsigismemberkill_sentdirectory_closelibrpc_c_rpc_handlerblkid_tag_nextfputcdivmodpreaduuid_unparse_upperlocaltime_r__ctor_start__strftimeppb_copy_argvwait_child_addnum_argsstatisdigitforce_all_parallelfwritenum_devicesdevicesaccessdirectory_read_edatadestroy_process_endskip_root__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerlinkexitsyscall_timerblkid_probe_all_newsigdelsetsetbufblkid_find_tag_devmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenoblkid_llseeksyscall_v_exitdoallregister_message_handlertimer_registergmtimestrlenopentouppercancel_requested__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClassesnotitlelist_removefcntlfstypemax_runningmkdirmsleep__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitblkid_tag_iterate_endfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/mklost+found0000755000175200017520000057171011517101521017331 0ustar tyndurtyndurELF@@44 (@@@@ DQtdS6U= @t8v@ҡ@ut h@! @ÐUth$@h@@tt h@ЃÐQSP UWVS] ? t&;v/v<EE$D$ry$@fO")ċEt$|$ t$D$$ r@=@s& @sBwҁ@rt$<$Vá@$#A$O38É$iǍ")čt$|$t$$TioL$qUWVSQHh@h"@h)@5@Y8KhhT@(@PhjxP? DžWhe@EPfT@ߥf1fD/Y^PS XZhS' P^_EPhT@%)@EP9UgDžv9tlQhe@EPeT@ߥf1fD/XZPS$@u hu@7$N jM hp@}7$M hj@d7$M h_@K7$M5@jjh?@A$MU]Ít&'U]]u}CvMs%V tR@@ЃD@%=t&ftt]u}])믍t&H@L@֋~t11҃9Љw~N1)=X@\@A)AVF ޭޅttYPtOAtUd@fP +PA +A9R d@GP@T@]u}]ËVfQ맍v9 `@tQ9 d@t=tABAtA 1)h@l@A $ D$ld@뷋A`@륍'U0VS l@ h@@@9s։ D$ $kۉt11҃9ᆳމw1 AqA AAh@l@[^]Ív Ft&P|^~@t&9t&wv|.~5@t& @t&w0@vwv|ލ~@t&P@T@$&UWVSt&P@T@EEEMtы`@! d@5`@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5d@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf 1hfL QA UQEyACKGDGE1ҍYX@\@ڃt )ÃfC* [^_]ÉE}tETF^05`@E;11FKAA y]YEAGDGFE`@GG@ GG@GxUGPGMHGDGE1X@\@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0F CP X9{ <$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Í@@ЃD@%=t ftuH@L@ 1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUVuS] >t9u1ҍu[^]ÐUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Tt&]Eu}]t&FED$$tW1 f?[D$E@D$U$ouɍFD$ ED$E<$D$UȬ@FD$ ED$E<$D$@v'UUE @U]+UW V@S1ۃED$D$$`D$ED$E$vot&߃ t;>t[@D$ED$$nu˃1[^_]Í& tED$@D$$oE Ȭ@[^_]Ív'U)$@@@)@&@ =@@uÐUWVS }1=v@t$$jt&9{uᡌ@t$$j$ƍ [^_]UWVS }1 v9{t+@t$$oju [^_]t&@t$$gj$- [^_]UVS@$OƋE@F@11&@;Fw@\$$iuࡌ@\$t$$#kE D$F$X^[^]k@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$m\$D$D$ E D$E$[]ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$ UED$D$ED$ E D$E$bUj@`@@Ít&UWVS,EUMI=@G@@ Eu&)ċE\$#D$D$$OkED$ED$C$mE\$t$ |$D$$t&1 &@\$$TgtF;~uᡐ@\$$XgE;u|;~t)&{^V떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $3nÍ@$\$ƋG 4$D$iG $2<$*]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1$k$c]u]Í&U(E uu}}]EEEz@t`$dÉ0E{C<$O|$ƋE4$D$ks \$@$f]u}]%t&뙐U 0]Ít&U j0]ÐUED$@$vd1tÍv'UED$@$Fd1tBÉ'UWVS }1]v<$D$*ht&@t$$cuԃ [^_]0$C$$@t$$cUWVS 1t&<$D$gt.@t$$rcu [^_]Ðt& [^_]É'UE1҅tPÐt&U$|@]]uu1ۉ؋u]]Ðt44$g9E r݉4$gt$$D$h&$g4$E g$맍vUE]utoU1u ]u]ÍvE $5g$ƋE $g4$D$E D$GhE tC$1s롸$;tE$f$E $f$҉CthtdE$fD$ED$$gE $lfD$E D$C$g@\$$bc@1$>C$3$+U]]u$\$D$$|@o4$؋u]]É'U(]u}D$=E$d¸tR+ueF)ĉt$E\$$~D$f3D$}$|$te1]u}]Ít&@@eU@$}_Ít&'UWVS,EEE EFEEE}&$dEF$d]]x;D$E$2EED$D$EE$e|$FD$]$eEEEED$@$^_lED$ ED$E܉D$E$EE,[^_] 'UWVSRaD$@$@@$-u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$hc<$D$tt$<$Hc4$>cUDNjB B9r[^_]ÐU]7#UU S]G) ʃ)1[]Ðt&@@獴&UU S]G) ʃ) 1[]Ðt&@@獴&UU SG,Ћ] ʃ)[]Í@@䍴&UVSUMu t`@d@Bh@Bt\1ۅt.@@[^]É\$$`@Ht\$4$4u؃Hu1[^]Í&`@Fd@Fh@1[^]Í&1 t&Ht\$4$t\$$`@p֍&'US@]uu%@1[]Í&$ti@B$p"@D$@1[]ÐUED$ D$$1Ít&'UED$ D$$1Ít&'UD$D$$@D$ D$$`@@t&"@=`@u@ U=@]]uu}} G~&@@&]u}]Ív tՅt4@Ĥ@CȤ@C̤@C Ф@C1t@GĤ@GȤ@G ̤@GФ@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$`@u@t$Ѓ1[]Ð1[]v빍@@ U$nÍUEwE].t&]Í&'UU ~ÍD$D$ D$D$E$ 1ÐU@@]ÍU@@]ÍUWVS1ۃ }9~t3l@\$$GXu@@ [^_]fl@\$$7X$ uȉ4$ 1[^_]Í&UWVS1ۃ}9~t3l@\$$Wu@@[^_]f} tr} t} ft"@@[^_]ËF [^_]Ë]F 9t!tD$@\$ D$ȑ@$^ 1[^_]Ít&]F9tD$@\$ D$@$I^1[^_]ËE cF[^_]ÍUWVS }l@1 f9>tll@\$$Vu$Ƹt>l@t$$rXl@>p@Fp@FF t&F [^_]u@@fU l@tÍSXl@@$@$@$Ðt&UVSl@t519pt#l@\$$Uu[^]Ít&[^]bf&'U(Eu]}t;$[D$4$NjED$t.]Ћu}]f@@ލ&Et$ D$D$E $2D$|$4$lڅt떍t&U(Eu]}t;$D$4$NjED$"t.]Ћu}]f@@ލ&Et$ D$D$E $!D$|$4$څt떍t&UE]uu}} #tEt$|$$}t]u}]Í&]u]}]t&@@ÍUEt&D$ ED$D$E $Í@@Í&UE]u\tVD$ ED$D$E $t]u]Í$u@@Ӎv@@ UE]t&UVS u ]00 D$c@$"0$ft^ErtDaDED$$"t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$c@$"@@@됍&15D$c@$!uLvEwfvEwE+D$@$!v$@@UE D$RD$E$0ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$><É'U}׉$]ÉuD$4D$G!$&D$D$$$D$t$$G}G1G,w, O0tAG0G]Gt@ut@G}1] US] D$c@E$t[]v@@[]Ít&'Uuu]}} D$c@4$kt%$t]u}]Ðt&4$(=tI$1j=D$4D$<$GAGGt@t@G@@농v'U(]]}} u$|$t]u}]Í&$D$@tԋG G\$ D$D$$G0G$Y두UWVS1ۃ }u@t&9ljEtGx@\$$Mu@@ [^_]$@`:ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1fx@\$$LnU;uݡx@\$$L [^_]fUED$$D$Í'UVSu1 t&;0tkx@\$$pLu$ D$_D$@$@1D$ G:3CCx@\$$N[^]^&'UWVSE}}Et[^_]1&;8t x@\$$Kuމ<$1ۍt&;>tVx@\$$zKu1D$ D$D$@$@b9UFF[^_]f뿐UuMD$/@$+@x@ÐU1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[CF$D$4$FuȋE$EE4$;E&D$|$E$=G\$4$Euډ4$FfvD$5@$It$$lJftUcv|$E$E4$It&D$E$=Et xW11vD$xE$Et@C$IƋCtrǍ&$7@IƉ뮍F$EE$DuE#&tcu :F/<$|mED$E$vDt8_4$\$H$9IƋGu/볍&|E$jEE[^_]Í&E$]C9|$E$D1>)E4$ v@UWVSF1ɉ‰EE#E$hDËE$BStdfuC.C E\$$_E11vD$xE$FCtXC$HƋCt+rǍ&CC뗐t&$7@GƉ떍F$EE$BuE#&tcu :F/<$mED$E$Bt8_4$\$F$QGƋGu/볍&|E$CE[^_]Í&$E$mAD$E$ B8$6@@E$(A\$D$E$5CaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE;@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$(EҍUUE $T$E ÐU@@$:@D$ED$,ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$5؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$4؃$[]fUS@]U u$T$4؃[]Í\$D$ D$$ []Ít&US]$B\$$t@t$ 2[]Ðt&D$@$4ؐt&UVSD$c@$H@ wD$ D$D$4$5 Ƅw@D$D$W@4$$@D$ D$D$$D$c@$Z@[ )wD$ D$D$4$ Ƅw@ZD$D$j@4$6$@D$ D$D$@$D$c@$l@ wD$ D$D$4$ Ƅw@D$D$j@4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$j@4$ @vD$W@4$ @*D$j@4$ @U1]É'U]Ít&'UE@1] U]I&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$5?t$u\$ D$|@F$7Ɖ]u}]Íu \$KS<$.C $.U|$T$$>\$ D$D$|@F$ƋC $.뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$J4$딍US$]u$[]Í&Ct$ELED$ D$D$@C$D$Ë@ D$E$<C $c$[E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+1҄u뱍vC!C$޾뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$:$wt&tyvC!C$讽:vK9Crt$ED$ $:sY&{Cft$ED$CC$r:sv'U]]u$ 9U $D$T$ D$^$8]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$(@$(@@EED$ D$D$@G$Ë@ <9}sE<D$@D$E$a8C $&$,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$3_utRu4ttG!9u܍f]v֍ovɍt͉$vCG!9uIvvE<$ED$ D$D$@G$7Ë@<9}sE<D$C $ 't&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$O4 )čt$<$549s@a<w%$Ē@vЃ|+uf<$39rE1ۉ$3UT$D$F$ 5E$3t$ D$@$D$U$褷w t Nun1ۉ<$茷e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$2$BFU$T$P2$&$ËFCFCF C FCFCFCFCF C F$C%C$$׹D$ D$$D$C%4$_v'UD$@$@Ít&UWVS] D$c@E$~C$ D$@$N84$t$ D$D$<$uN@D$D$@$4$ $@@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$1[^_]á@D$P@$%@@e@D$ @$@@<@D$t@$4$ @@ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$+@4$.]$t$D$ D$D$$O$f&'U$~ÍU@tED$@$+1Ð,@u@@É'UVS1ۃ@uu!&Ѓ@\$$j)uu[^]U(}}EU u1]]EUt\$t$ $T$<EU\$t$ $T$;]u}]ÍUWVS,E ]E@E܋EuEē@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$$~8$t 1҃[]f[]Ít&'UWVS$+1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|ܕ@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&U(E Ei@Eh@ED$ED$E$LÍv'UE D$E$ÍUuu ]]4$9~tu ]]u]9u EUE $ÐUMSU AA[]UES4]EEEE0i@]D$E ED$E$_x4[]ÐUED$E D$E$ÐU}MU EtÐD$T$ L$D$@@$UED$@$Ðt&UED$@$1҅t $U]&UED$@$1҅t $U]&Uuu]u1ۉ؋u]]Í&4$u$t$ D$D$É$UFu u0]ÐUSD$ D$D$"@$萩t@ MZ$7؃[] UED$+@$D$ E D$ÍUWVS E}D$@$U v2t&D$@$aU 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$ t<U$ Ɖ<$9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$||$\$E$\$4$ ËE$譗؋u]}]Í&'US]$n\$ D$4@$D$诨[]É'UWVS,]D$@$EU)čD$ET$\$$UE$zEtD$$CUe$͖$=@葪$)č\$t$$D$B@$D2EE(&D$B@$e܅e܉<$,UƍD)č\$|$$3/ED$D$tD$$Tu$$-E\$1ۉ$<e܋EetjU$ƍx@#)ċE\$$D$U TE$\$ |$D$D@$賦t$ſe[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$M@$2$M@$D$M@D$$M@UT$D$$$M@~D$q\$D$D$$D$ []Í&U($V@]uu}"4$D$l$V@$D$V@D$*4$$V@WT$t$$$\$D$D$$D$ Ͽ]u}]fUED$ D$D$_@$ǣÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$h@C$U$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$xD$$FFF D$D$$Gta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ@@EE؃<[^_]ÍvEE@@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$:\$UT$M܉ $ \$E$FU F$E] UMV~HU1fC D$CD$EE$a MC K9}MƋVT$D$U$6 F D$$ 4$UE ]u$tD$E$^$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-@@ [^_]Í<0C %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt lrwaitpid(-1) wait.cwait_child != NULLCHL_EXIT..:/%s: errno=%d console:/stdinrsconsole:/stdoutaconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createxM@L@L@hM@L@L@L@L@L@L@L@XM@L@L@L@L@L@L@L@L@L@L@0M@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZW@V@V@V@V@V@V@V@V@V@V@V@V@V@W@W@V@V@V@V@V@V@V@W@W@V@V@V@V@W@V@V@W@m_@[@[@[@[@[@[@[@[@[@[@_@b^@[@o\@o\@[@b^@[@[@[@[@[@m_@m_@[@[@Y@[@m_@[@[@m_@e@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@e@`@`@`@`@`@`@`@`@`@`@d@`@kd@`@`@ye@__ AZusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK ?telldir: Nicht implementiert IO_ULINKlwIO_LINK zR| 'AB E<_AB E @GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@@3  @<T @\ @"@4@gK@!0@Md @ !@y%#@.+@3-@w70@d801@ U9@1@@:@|-B:@B:@jC:@F;@J@@ZW@Q@(EYpR@4cph@de0i@ygi@?Oij@mk@m0k@rPq@ftq@Sv r@v@r@ys@y0s@_ w@y@z@A@~@@KjP@QW@.@>ɋ @-P@J_@@j@9D@V@@]p@9@L@'t@_j^mainQinit_memory_managerfreeZmallocrealloccalloc dstrcatTmemset\librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerE"timer_cancel8timer_callbackytimer_register4rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*Knsyscall_psyscall_vagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsd runlink!7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill%=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreati.chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstatG3vwaitpid,waitXwait_child_addqinit_waitpid'w7Zrpcsend_message8nyieldRU9,io_split_filenameio_get_absolute_pathZio_split_dirnamed@get_pidget_parent_pidcreate_processmdestroy_processget_cmdline"-Bnset_rpc_handler#Byadd_intr_handlerJjCa)vfprintffprintffprintf_putsn+fprintf_putcF}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#J Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6ZW_exit2abortGatexit{exitiEY 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintfF4c0vprintfcprintfprintf_putsnprintf_putc8desprintf_putcQvsprintfsprintfyga_assertOiPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read mysyscall_timermdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namerlio_seekVtcreate_shared_memoryopen_shared_memoryclose_shared_memory vysyscall_putsnqvmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6ynwait_for_rpcv_and_wait_for_rpccyppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv_ isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperi?%errnodstrtollist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspnostrncmpjostrncpyWdstrchrdstrcmpɋdstrcpyostrdup_ostrlen(Qd__strtok_r strtokjomemchrDomemcpyV9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtouloaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4 io_remove_linkio_create_link__udivdi3__umoddi3fQ@@q@h"intXI5Lf7e~t]f(e 'eoy.Z%1H id2# 3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzHI3 c-vl3d@@k@@q<b7IY+,Z3it@@h"intXI5Lf7e~t]f(e 'e(e)e(e{)eU*e+e,3c-e.e0syo.Z%1id2#3#pid4#.5# 7#8z#>9z#:A#4]4 E 4`\a#xb#c#"d# e#Gf#4g#i#k# rl#$+m#(<n#,o#0   m 3t@@233u 3qA!}"9{st#i$3j$3d%3  J N8W M@ @h"intXf7Z~tyZ]f(ZoI@J#WK#ELh#Mh# Nh#dOM#OM@YM#WZM#[#-\Z# ]h#^h#s3z3 M s cO nz i3  a ptrE3  E3~ 5d s1 s2d nzkk%xxjqoZ ~ s c3 nz i3@@j@S@ptr)minMvmaj-hS@@`@ @m@@[@~@@[@@@h\h &@=@!`@@Z"h0#sthC maj @@$w%m@~$X&>@? @'=z?3 @aBpABhmajCominDMSEMFz`@*@ZS3@8@P`) @+ @`u @ @pp`Dh` @ @L @ @h&@ @ @p'zXptrminM  zE .hn Sn @s @0` @ @m( qs.$$7BM X `# @( @i`n @x @^&  @ @ '3 z ' z 3p ~ @ @ @ @)R*+b`@*cd@+eM,3*Kf3@*g:h@*Eh:X@*k:P@*l:@@*m:H@-8q.Aj @ @`h"intXf~t]s# @ @3 s"_ "~ z$o 0 @ @h"intXf~t]f(O#A%Oy< @ @ : c0:3 ':d7 t=db c?z dstA o; @@!h"intXI5Lf7e~t]f(e 'e0Zzo y , A-#  .#  /k @f@0 jZ\ jZ zj il3r cqZ rZupep@@ 6dA  dAF4@f@4/EF E(GdiHZf5HZlr9p@@^i:Z6@4@  -1@  2@;@?@Ah"intXf7Z~t]f(Z'(#)o#*zo  &'#(O#  a@@2 `Ob2ic3% O @@8y NOdP2iQ3,O@?@ ++Oid-O52/<2i=3B#@$O@;@@h"intXf7Z~t]f(Z 'Z0|Ooz 3 pid4O# 5O# "6o# z7z# k8 '$ (*# )o# $*Ao .tpids|sO5u3Bvr@@Upidp|pOBq;b@@pida|aOBa3DS@A@gpidQ|QOBRO9CP@@pidA|AOlenAozB; A@@ @@1{pid|]+;|"oz;Ov{BKg\r}A H!1@ @pid0|+0;"0oz0; "B2!\;@@C#pid|o$+;$"o$z;%;%B%KO&3@@(pid|T+;t"oz;3B&O@Y@ppid|G+;g"oz;OB߉'L`@@J|:JOp"KozKzBMNz(3O@):* .@0; V@!@gh"intXf~t]o@ @ @!@%| 0@}@h"intXf7Z~t]f(Z 'Z3pid4O#5O#"6o#z7z# k8 o   '(#)o#  *y(VA)#*#Y+1 t0@V@Q53}͙ V `@@53PC@@ABiD3KE@w@idAi3 @@A&Fme@-@Yddoh R30@@_A=]3`@@F 3@@ 3/#3@@1str"]sep$}.oA/"3@@ 6\@@!pidZ|ZO1"Zo"z[z #B]zud#^ouh#_oulb_oQ$i`3upa 6@}@dU =|@u@AU @u@>C8AKL #-l@ %Y3 @@Z h"intXf~t]yo'3@@'k  @ #@ h"intXI5Lf7e~t] 'ey  #A      3 # #l 3#0  o3@@ ssL 3 A 3@)@s 3 &30@y@P% %3|  >3@r@^=3=, =si?3 os@@Q ns'idpZ@3@ @is` 3 @5 @s3@ @ @i43 3 @!@csig3  cO oldr i Y !@!@  3   4!K H3!@a"@R! G3~! [! gp"@"@!u {"@"@"< z3A"< k3"@ #@a"w pidjz j3"G!) +w@!4 ,`@! -@l"Y39 #@*@  !0 :oh"intXI5hf7~t]f( " 'U*,Oy.v%1uid2# 3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  *      '  (#  )#   *~ '8 (8#fd)O# 8 +O# ,O# dupO#@$#@"kfdO3 O0#@D#@"fdO OOP#@#@#fdO<#X iO~# - O#@$@#fdO#cmdOf$X $iO$T$@$@sap%argO%$@$@ap%argO-% PO$@%@@% O8l%X \%i]O%A :%@%@% ~8%@B&@%7fd}O &!X iOT& P&@&@r&fdO&buf&";&"d &#O86'# T'retr' $x '@'@'ZfdO'buf'";("d '(#O8_(# }(ret(r '@$(@(fd~O("d ~)" ~O])#O8)yf0(@y(@) fdeO)Hee#Og8*/oH(@)@=*fdGOi*"HG*"G*#OI8+#/Q/+k 8)@)@M+%fdO& ': O )@*@y++o O+(! l 4,fdO],#O%8,)Paf 8,*@ *@|f8,*hf8,+:,- :O*@*@5-99( 0l@ ( 3Op@.R 68.b78.N88. YOI] +@-@sh"intXI5Lf7e~t]f(e 'e(e)e(e{)eU*e+e,3c-e.e0syE 4`\a#xb#c#"d# e#Gf#4g#i#k# rl#$+m#(<n#,o#0o.Z%1p id2#3p# pid4#.5# 7#8z#>9z#:A#4]4|  0 43+@+@a- 3 3  / C3+@+@- OB3 B  3 +@*+@-N  ޾ J 30+@:+@-   P   @+@J+@.  q 3P+@g+@=.  ̾@ R3p+@1,@i.DfQD.& QJ.posSs.   W 3@,@,@.O3/& J0/fDr/ E y3,@F-@/ x/& xJ0d z3K0O{Dt0,@F-@dir 0 | k 3P-@-@00& J13T1fDr1-@-@buf}6 (t@ Y3 -@0@h"intXf7Z~t]f(Z 'Z'(#)o# *o y )  pid*|#w + #d ,3#l BCCpidA|iC3 DC  nvpidm|io3 pC |-@.@1&pid|1d &C2 3c2 Cw2.@+.@#.27I.@.@Va2j 3 |.@/@2Xd & T /@/@2pidS|)3 VCoutf/@8/@T/@V#.T37 /@0@r3qpid}|3}O}o3z~z 4 C+4 K#.I47!# .\47" 90@0@z4# 0x@ $Y3VV0@$1@h"2>intXf7e~t]orpc"0@0@4pid!Z4 #ZP  2>0@$1@4Dpid0Z5 c0ZH5 0Zh5len1Z5 z1z5 33P :Th ZT DY V01@<1@ph"intXf~t]o 01@<1@5(G @1@:@h"intXf~t]f(Ooyo'(#)d#*  & u  i  < / 1& 2#" 3# 5&# o6 p pcwd}X v 3  p= pcwd}X v (3i)3 Fv DlenEd E" EX Gv or i@1@w3@5h*6 hpH6F h3g6 jugposk6 luh mulX nv6H` wd7 h!!!!"#~2@2@(!!!!"#2@3@[!!!!"$(3@w3@!!!!"l% }3@*4@7&7X v' p7(3@4@'} 8''d)8 @ pi35 3X v)d :d 9p;di<3X =v _ ]pH]}S ^ib3X cv%O }04@7@<8Z&h8X v* pud 3'd8' }8+64@4@r!C,N8"Y"d-|! ,9,09",N9,l9-`!, 9,)9,49+@6@6@!!R"^,j:"t.6@7@!!!,;:,O:/, }8@:@b:&:'}:* pul'd:'X v:-@+!R0"^,j ;"t.8@s9@-!!!`,T;,h;# V:@|:@vh"intXf7Z~t] 'Z(Zo 'o:@ :@{; pid(o; 8o:@#:@; pid7o 9o; Vo0:@Q:@;m TO uidTz T Uo pidWo%<  k`:@l:@8< zp:@|:@d< {<V:@:@h"intXf~t]o :@:@<]V:@:@Xh"intXf7Z~t]o)!:@:@<6 O]a:@;@ !0 :oh"intXI5hf7~t]f( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O :  O  O  :C   v# W#arg#{##fp$## k:4O:@:@<fp3#53ap3%5 tk6h;<O;@!;@'=fp;#5;ap=%P>OP/O0;@z;@S=%arg.%=.=n.O=  (O;@;@=arg'%c':!> ;@z@@h"intXI5Lf7e~t]f(e 'ey.Z%18id2#38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3 ;@;@@> Yo;@;@l>3<@ <@>  d3<@^<@>,c3>@<@V<@cs>u{#8`<@<@&?8R?pos3?c3?o3<@>=@?c3?  =@6=@cs>u{3@=@=@&@ neR@strY@}3=@ >@@7strYA/>@z@@8A~ 0dA1~~2zA>V>V)@R $@b%@N&@Y3 @@9#:A#4<#A=E#! z AO>]4K3pid4Z#5Z#"6#z7# k8a 7id8#9#q:#;Z# =<?Iid@#A#qB#CZ# zDI# AX ^EOyidP#QcUidV#W Kl  z(& zres {K# |#%H  V2%13E %@@@@Ac8@@@@A3@@@@B _3@@@@EB^3@@A@qB_ BH?C37C 5_ ?out8@@ =R3A@A@oC Q3M3A@B@C LHL?LG3 B@NB@C FHF?vPB@KC@CsrcD>Dq\D zDDDDB@C@zD  A  X3PC@C@E7 4EjE3C@1D@Eu E yp!3@D@D@E" F#ZLF%hsD@ZE@jF gF nposFwF pN3`E@E@Gd MBGd MsxG M3G$E@F@G F@vG@Gz(HHHqhH HI|83G@G@AI:%str7 7Q%3G@%H@mIc$3I $&ch&zu{W30H@H@Ic3I JE!H@J@PJ "|J"J"qJ" 0K#*K \' KK()' *(L,FLI@J@*i3YL+EF3J@BK@lL  EL,cGzL"]?PK@L@Lu \?M'\3PM \pM,i^3M,c^3M!K L@VN@M "JM"JN-L?up.msgR +SE*iW3ZN#~xN# N/+5_ z 0`N@|N@Nl3N@IP@ O +k8OkXO Hm _n^o,srcqO,dstxO/'O A 1!PP@gP%i@j@ oh"intXI5Sf7l~t]f(l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K 'i@j@p %p O%p %:q x&:Eq  % N8 VZ&j@k@ oh"intXI5Sf7l~8~t]f(l 'l0y.a/H%1`id2#3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %A&#A'#(s#.)#u*#+# %  -$!!#' l -%*:P )!j@+j@eqnC0j@`j@qB'q Dql w2`j@ij@qDPpj@j@'r?O'SrdirQ!srvj@j@Q)e2j@j@S >:j@j@r =!d = =:0j@k@r /!r5s 'Vk@%k@!h"intXf7Z~t]o/!k@%k@=s O O(0k@Kq@)"h"intXI5Lf7e~t]f(e 'eo 3 pid4Z# 5Z# "6z# z7# k8y 2HJE AKE# AL3#@ Mz#D mNU#H U? AdZ30k@k@isVres3sBs3k@k@sdevzuk@-l@sSؒt S>tz^tpos3t 30l@l@ttt3uppos3ull@m@u3Eusupret3  %C m@Wm@XuQABl`m@o@u;cmdku#k3upidmvpzuhq;drulhzRv[zevvJHxvFYdirvxRzvh J Y h wXo@Yp@vW3=YmsgZ1`p@q@*wA0=2msg3 @N q@Kq@VwpidM)Pq@q@#h"intXI5Lf7e~8wt]f(e 'ey.Z%1Cid2#3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#d Jl# K3# Ld Vl .Pq@q@w -w d -lw -3 v/d*Vq@r@i$h"intXf7Z~t](%zoOq@q@1xO idO]xzq@q@px idO ox r@r@x idOF+>V r@b?5Y0s@s@NzYppbzzzozd ozleno{oO{i3Ql|3s@s@m{ppbz{o{i3R3{t@jt@{+ppbz#|oN| +3 i3Qarg 3n|b3b`A`alenao ?co 5d3newe!"""!#$#3bshm3 opi3 p3 d z 3pt@v@|9 9|b|shm3}p9D}%&#%1 "a"V"K"B&8 'lm}#w#(u@ v@k"""&` #)x "& ##'}'}'}'}#?v@w@ ~*OŢ 95~shm3U~retȇh~+Y3=/.6 w@y@'Z4AAc3Aintj9Adc8A AcA*Ac)AHAcGArMAcLAd w@.w@{~vb%A0w@>w@~c$A@w@ow@~; ~/Apw@w@5ec.A%w@w@a7Hw@w@ZR>Aw@w@ c=ACAx@/x@ cBA00x@Dx@OPx@dx@{3zRApx@x@ cQAӀ {x@x@Sv 1 Hx@x@S &WAx@x@ cVA\Ax@x@= c[AiaAx@y@ c`A;0y@y@0(7@@intD0y@z@X(h"intXf~t]#]y@z@Ӂstr"""3P$]8%3l|&\'3à o Y30Bz@1~@(h"intXf~t]f(O'(#)d#(W##$o# *q vNz@{@ Ml  `Vd{@1{@77 Uc @{@{@ ф 53Rn3Z o{@{@  53υNݿo{@|@H .53d oN& %(Æ /o|@|@ #oYSB}@)}@w A 0}@}@·'  530 oh}@}@% 8h}@~@Ȉn g go6X m j6~@1~@V 7+@,3@I-@:2@~@~@)h"intXf~t]f(O&zy%d@~@~@s$$Ήs1* bit+o tbl,Lidx-3  o o2@K@*h"intXf~t]f(O%3@K@s1#Ks2#n$dom3P@@*h"intXf~t]f(O*P@@֊dst)src)Dn)d| d,Qs-R o  3!@@E+h"intXf~t]+@@p*ch*3c,Qoc4*@@+h"intXf~t]3*3@@(s1)Ts2)o4F @M@+h"intXf~t]?# @M@to":"z$o C5OP@@,h"intXf~t]f(OX&P@@+str%Wlen'd_( o  5d@@X,h"intXf~t]f(Om$d@@str#ԍs%R oMN6t@@,h"intXf~t]2@j@s111ώ}3tok3%c43Ysc43l @ o   `p@@ s__a@,7@ف@-h"intXf~t]f(O)@ف@s&׏c'3n(dQ p+R    A7@y@j-inth"Xf~t]f(O>A@y@p::':dܐdstB)srcC]tDd}@   o   5T8$6@@-h"intXf~t]f(O#d@@Bs"n"dlen$d  o /@B@ʒCn.Os.C.OB st0IKi1Omy;O t5O YY ]P@@ʓstr3]8'3a  c4@DŽ@str73Є@ل@1s1s2@@הɸend9˽] ̽_ͽ^neg3o3outb@ 2 C- @ @ end N @@@וKendEV@@@D/DD3ӖFV#negG3out@93@ӈ@ s1@@513y9>@m@3/h"intXI5Lf7e~t]f(e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K G&3@m@a %%3f)ژ0 dir-  V dY3:p@@ 0h"intXI5Lf7e~8wt]f(e 'e0~y.Z/A%1Yid2#3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> ^!t"S### _  DIR&l%"A&"#A'#(l#.)#u*#+# _2 -tp@@sdirssd s~ }i@É@BdirhsV]~Љ@@ndir\sNC'@w@'dirBsƙkD-JeP'8 w 253@@V_dir4s*s@@A) _;^@K@1h"intXI5Lf7e~t]f(eo 'ey.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  ZT[#%\#^z#A_#  av`dc%d#fz#Ag#  ah 63@@,ښ33?ul?}u@P zězכH  V  a  33 @K@1,1g243%j56ǝG?!H?Jߌ@E@@@K@mznzHorl  a Y3<L@s@p2int~]ohf"% ,?X>tNF7^ 2*low`#`#  s llv " M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0kT_L@s@Ȟn^d^h `A7- LWbmExџ t`@@B@s@kD>t@Ӑ@3int~]ohf"% ,?X>tNF7^ 2*low`#`#  s llv " M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0kmSt@Ӑ@uRvRwT VA7- LWbtPmʢx )vأ @@KD@Ӑ@i% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > I !I/ .? : ; ' I@: ; I: ; I 4: ; I 4: ; I 4: ; I!I/4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju32 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysmklost+found.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.ht@ 'K=l=K=ɽrysɵ= Z_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ9 strcat.c @"?G ../../includememset.cstddef.hbsdtypes.h @;fr<>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h0@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf 6 unlink.c@&?y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h#@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k  ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h-@i+t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h:@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c:@=gP ../../../include/arch/i386add_intr_handler.cstdint.h:@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h:@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h;@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h@Q@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hpR@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hi@&gI38 ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hj@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hk@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h0k@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.hq@?Dx ?Dx =3 puts.c r@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@r@ ic?9 fi='=% wait_for_rpc.cs@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h0s@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c w@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.c8 ../../includestrtol.cerrno.hy@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.hz@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@~@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.hP@)Xg[ye_; index.c@*\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@(JgKwp@8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V 16 ../includestring.cstddef.h@"zT ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hL@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.ht@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| ,4t@D  F AB D].| x@AB x@AB FIx`@AE Ex@?AB Fx@ @VAB Fx @3AB D| @ @<AB AD| t @AB F|   @vAB FIFp@AB  @AB AFFp@>AB | 4@dAB F4 @oAB F4@AB E| @:AB D@1AB @1AB P@0AB @AB @IAB F@AB A@AB ON@YAB X@YAB X `@AB IFF| @ AB @AB | <0@&AB <`@'AB <@AB F<@gAB AG<@AB <@AB MF<0@_AB L<@GAB FF<@AB L<@AB <@AB F<@AB F| @ AB | @IAB D@IAB D0@IAB D@AB E@_AB D@%AB  @%AB @ @aAB   @AB MFF!@WAB D!@qAB Dp"@AB "@"AB "@IAG | l#@AG l0#@AG lP#@yAB Cl#@ AB Cl$@AB Fl%@KAB l%@RAB AFlP&@AB Ol'@AB Ol'@tAB LFl0(@IAB l(@AB Ll)@ AB l )@AB El*@"AB | 0 +@AD 0 +@AD 0 +@ AG 0 0+@ AG 0 @+@ AG 0 P+@AB  0 p+@AB FHE0 @,@EAB D0 ,@AB FI 0 P-@AB IFF| X -@AB CX .@#AB X /@AB EX /@AB FX 0@&AB |  0@AD  0@DAB E| H 01@ AB | t @1@7AB Ct 3@AB Ft 04@AB Ft 8@AB F|  :@ AB  :@AB  0:@!AB D `:@ AB  p:@ AB |  :@AB |  :@AB |  :@;AB  ;@!AB  0;@JAB IF ;@"AB | l ;@$AB l ;@AB l <@ AB l <@NAB Dl `<@AB BFl <@NAB Dl @=@\AB Dl =@kAB Dl >@jAB H| x@@AD x@@AB x@@AB x@@ AB x@@AB DxA@+AB xA@-AB x B@.AB xPB@AB FKxPC@xAB DxC@aAB Dx@D@AB FFxD@AB Dx`E@zAB DxE@#AB  xF@fAB IFFxG@RAB FFxG@EAB Dx0H@UAB FFxH@UAB FxJ@RAB DxPK@AB IIx L@6AB Cx`N@AB xN@AB IxPP@AB F| l@Q@bAB ElQ@AB lQ@GAB l R@HAB B|  pR@dAB FLGR@AB FS@'AB S@AB FpT@EAB AT@0AB FX@uAB C| ph@6AB h@AB h@@AB FFi@AB | X0i@ AB DXPi@OAB GXi@!AB | i@?AB | j@AB 0j@0AB `j@ AB pj@0AB j@ AB j@`AB FF| k@AB | 0k@QAB Ak@*AB k@mAB F0l@mAB BCl@rAB FI m@7AB D`m@DAB Fo@AB D`p@AB PF q@+AB | Pq@fAB D| (q@AB (q@AB (r@AB |  r@AB | @r@AAB LFr@AB r@AB r@AB r@AB | Ds@ AB D s@ AB | 0s@lAB Cs@VAB Ct@jAB Fpt@`AB Fv@HAB L| < w@AD <0w@AD <@w@/AB <pw@AB <w@AB <w@AB <w@.AG <x@/AB <0x@AB <Px@AB <px@4AB <x@AD <x@AB <x@AB | y@AB F| z@AG {@!AB @{@yAB HF{@AB  {@AB FFF|@lAB FF}@)AB D0}@AB MF}@OAB D~@!AB | @~@AD F| 8@KAB DD| lP@QAB B| @.AB | @>AB A|  @-AB A| ,P@JAB FI| `@AD | @AB BDp@"AB | @9AB A| @AB F| <@9AB <@AG F<P@hAB B<@AB <Є@ AB <@AB F<@ AB < @ AB <@@oAB F<@#AB <@!AB | x@]AB D| p@"AB @#AB Љ@AB @AB IH@AB @ AB | T@dAB FT @+AB JI| L@'AB E| t@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutmklost+found.cst_inonlink_toff_tgid_tst_blocksst_uidblkcnt_tuid_tst_atimeGNU C 4.2.2st_mode/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscdev_ttime_tst_nlinkst_ctimest_rdevst_blksizest_gidstderrmode_tst_devblksize_tmainst_mtimeino_t/home/tyndur/tyndur/src/lib/stdlibcusagediffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountnextmajSizefirststrcat.cstrcatsave/home/tyndur/tyndur/src/lib/stringappendmemset.cdst0u_charu_intcaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexerrno/home/tyndur/tyndur/src/modules/lib/posixunlinkunlink.cSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementoffsetfdopenlseekpreadfd_list_elementF_GETFDnewfdfile_flagsorigin__builtin_va_listold_posio_resposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdumaskmkfifostat_buffchmodinode_numlost_statmknoddevicefstatstat.cstatuslstatmkdirrunningwaitoptionswait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidsend_messagemetadatayieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsretvalputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexsprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertiondirectory_closeio_direntry_type_tuint64_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigiterrno.cendptroverflowbasestrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrncpy.cstrncpystrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrmemcpy.csrc0donepositivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoiaccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSu Q u u t7qwt{#t{PPttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0Ptt<u<Q9S9<u ttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulSttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcutt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P*3*@&(&(*@&(*@*A$p\\(:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)03X_r02 0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@\'@-@5@\?@F@M@R@ X @ $ ] Afa@ue?X3 0 w( 0  @@@@@@@@@ @     @@(@;@H@^ @ m@ t@$@ @ @@@Ԑ@P@!@@ H@ X@ 'd@ 1P@ @`@ Jh@ V`@h@ t}@ @ @ u@y@@I@ %@ 1@g;DM`@  U@ ]p"@f@ @as@ ~@ l@ p@ %@K%@Rp+@t@ x@ /@ @1@7+<Naks@ ~PB@@ @ @ @ pT@E*9AIQZa@{@yr@ |@ @ @  **4T@0E<@NM @-T0k@Qb@kP@0}01@ @-@`N@pt@`@"{@!@h@@ Pi@O@@@0H@U}@O @%+@Y78@H@S0+@ YP@h^:@mPq@fv@}+@|@l@@ @pw@A@+`<@ @+3@s@V@d04@PK@ <@  s@ !@(r@1s@ >@@F @oUp@"];@$d*@"j0@&w=@k|0#@@:Px@x@@#v@HC@a@?@@ z@i@?0@@!@ @px@4@X@u@w@/'PC@x.{@Bp@Xj@g@nt@_x'@t~@IL@'A@-Q@i@+@0i@ x@/@_@ y@@9q@ N@ @ >@j* @31 k@*C @ J 0}@V }@)c 0(@Ii @n @,@Et ;@!| "@I `p@ 0j@0 @< :@ @ ph@6 +@  @G q@ @ `E@z& 0s@l3 @9: S@'G @ M .@#R 0@D_ @l @+@ r @@ y P-@ @@ @  !@W (@ Є@  0x@ @K @@ P@Q @  0@_ r@ `@' @=@\ @ @V :@ @1* `@D m@7U p@"\ @%g )@ n l@r{ w@ r@ @ H@U P@J ~@! pj@0 @@o p@> L@6 @ @ t@ D@ @ q@+( @@1 @D@8 0@&M ;@U @ ] x@e @ r w@.z w@ @r@A <@N @> R@ h@@ #@ 0:@! r@ @ 0l@m @ J@R i@! k@m @  Q@G$ @~@, @Y: @ A 0@IM `j@ ] @vr G@Ex pR@d '@ @ t@j /@ ,@ w@ F@f @] j@` @ `:@  D@ @r@E@#PP@%@1;@ P R@HUk@c@Im B@.tr@@#0w@0;@J;@"@$@@@Q@b@@@ )@x@ `m@D@.@d+G@R1j@ @@I ]{@i#@ oP+@u P&@P#@y:@ "@"Љ@:@;p:@ !@qo@@@S@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startmklost+found.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrcat.cmemset.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarunlink.csignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filestat.clost_statinode_numwait.cwait_listrpc_child_exitrpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexprintf.csprintf.cassert.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.cerrno.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrncpy.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cmemcpy.cstring.caccess.cposix_dir.clost_link.clibgcc2.cparse_pos_paramsputcharstrcpyinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileppb_from_argvstrtok_rlist_sizerpc_get_responseprintfstdoutvsprintflibrpc_rpc_handlerrpc_get_stringungetclist_pushsigemptysetrpc_get_intio_split_dirname__strtok_rmknodatolget_parent_pidlio_seekgetenvfchmodlist_poperrnostrtoldisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatinit_waitpidputsdup2rpc_send_string_responseislowertolowerrewinddirinit_execvfeofmallocremovelist_is_empty_assertrpcstrtoul__dso_handleitoaispunctreaddirjvprintfisspacefflushlist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddset__udivdi3setbufferabortprintf_putcchmodsprintf_putcisxdigitalarmmessage_handlerstrtolstrnlencreate_shared_memoryrenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroywriteatoffstatfprintfkillinit_service_registerdirectory_createstrcatadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infochdiropen_shared_memory__dtor_end__fseekppb_is_validmemchrjprintf_putcstdinwaitsend_messageinit_envvarsumask_startlstatferrorsyscall_psignalreadstrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getstrtoksigfillsetfdopeninit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullinit_messagingfopen__bss_startmemsetmainftell__dtor_start__init_service_get_nameclearerrfclosegetenv_name_by_indexgetcharopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnrpc_get_dwordstderrsigismemberdirectory_closelibrpc_c_rpc_handlerfputcdivmodpread__ctor_start__ppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_process_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenosyscall_v_exitregister_message_handlertimer_registerstrlenopentoupper__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClasseslist_removefcntlmkdir__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/mkfs.ext4dev0000755000175200017520000330671011517101521017232 0ustar tyndurtyndurELF@@4 4 (@@@@ QtdSN\U=@t8v$@ҡ$@ut hX@!@ÐUth@hX@@tt h@ЃÐQSP UWVS] ot&vsv+EE$D$Ry$ ]@D&")ċEt$|$ t$D$$R@=@s& @sBwҁ@rt$<$Bád@$$&s É$HǍ")čt$|$t$$HoUt1ҍvBu1҉ÐUt1ɍvAu1ɉÐU8uÍv5d@j!jh4]@ÍvU u hX]@5h@C fU 5(@h]@5h@ $%Uu e$uuh _@5h@ jc%vUWVSljUˉ EP貹ƃEu.GPVhjPRF@=WEVtY=VEWtRPujVtGZYPhPRGPV SuPRËWBwRP4$յu e[^_f SdPuh_@5h@  e[^_à Pd Phl_@5h@ WPUDPRhD_@A$7$vUWVSUMEtM1fFu1 G9t1EPjusho@58@EE tύe[^_ÃEPujuho@58@DE e[^_fUWVSHEȉ1QẼSuÈ8GEEEhfdPjEPS‹MfdE8ufuPSho@5h@y EvE؅M؉MԀ9j,uEUBU؃j=utÅtCuԿo@Eo@ uPjEPS‹MȉpE8uHPSh_@5h@ EE؅0E]ȋdftpȉ1ur ue[^_ÍvEMԉMfEo@ u4 p@uu(E]ԉ]QSha@5h@tEpS"ƃUȋRU9C]ȋKK u EȀx`E }ĉËEEF11MЍD1)Ɖ9~ȅ]ȋSLPUȃJ\f0p@uMȃ`}PShp@5h@E`UU=}܅Vuh`@5h@[u6$ 1p)EH1@E5h@j=jh `@E8p@uutHPjEPS[@EUԉU5h@j+jh_@l$p@qEܨq@"5h@j;jhL`@1UWVS ƉUP9P|!BF P6辶t_^ 1}QUVt,uPVBV1e[^_Íve[^_ÍvUSÅtQh@@RP.u]RSh8b@5h@$TUWVS$É֍}WQjRho@58@A t(fWuVPho@58@AC uڋEe[^_ÍvUWVS(hIp@"EExp@t 8u 1e[^_ÍvjPu ܽh}p@uhp@V;jVVu Vxm 3%`@4$v Vh\b@:<$1e[^_ÃEPh\p@jhop@ho@58@= P@Vhp@S5(@_؃ USÀ8t@ht]fQsdRS):XZ5d@CP]UWVSƉUjljPƾ@t e[^_fPPhp@V:F jOjP芾FcND0~dFh hp@/tFh5d@u$X5d@ e[^_ÐUWVSlE@E@MQ9tS)Php@5h@]QjPjS jExPS贷XZShp@85d@j jhq@#]CpH^_5d@Pr$*$  uvEphq@8 vUrh'q@8 v6hBq@m8N1RQ,$ v@F1RP,$$Qhb@@8vhXq@08fftKMQ ^~`I 4Ep EeEVhb@7MA&Phmq@7Q]s$s h c@7XZs(hq@7u~ hr@PhVr@-V$Shcr@Ph|r@V$UWVS@\?hr@jjPCuyEPjj hr@jWx uw1۾fGÁ?v9suW duF uԍe[^_Qhr@Phr@oU$7Vhr@PhVr@RU$Shr@Ph@5U$UVSþf 9s jjVS=FCPLtދ@T9rKe[^UVSÉփjp,BjjjSf=VS\Kue[^Qhs@Ph%s@T$aL$qUWVSQ,I(EEhjh(k@s$wh8@h8@*Y[5L@58@'@t@@\@t d@ @tS9Dd`a@dtOL@tFd @9ddHddf5X@L HlL@ LHhxm@j5(@VE j 5D@(B@5@P載@t,;5@uk(@;UQhi@j5(@D @EP5 @jjhR K|UԋJ|9R|Rhg@| @YuOT 9ct@& u@5h@jjhj@$fj@qt@]E\@ u虑@3tcu P| tIEVhq@hvt@3ho@58@]!E tƀ8t\@xEu뮹q@t@@E'5d@j%jhk@@t7Pht@jt5d@jjhq@uɃ5d@j A@ hڙ@֟@@Džtt@@b`a@ `t@:1it@8ؙ @hWVRPUJ RPhLm@sfWhl@j#UgE7t@J t@@h9| |hE4ptet?j/VԚ1 X`ʪt[^ËFtX؅uu[^a{UVSƅt+t PC{Cu V-{e[^ÍvUE E EEvUWVSƉUMj$<~Ãt& 1 VCuue[^_ËMt uCt`ʪE1e[^_ÍvUWVSÉ׉΁8`ʪt`ʪȍe[^_Ë@t`ʪCEEUBU܅tzEWUr~ڍMuES BP `EXU܉P UPtB u܅t*EU܉B]WEUJE떋ECEUVSv SwuFte[^USÊu vCt PUwu؋]ÍvUWVSÉBPu ;[u f;u 1҉Ѝe[^_1эD 9sP t uH9rXNJu[t}tj=W;Åu:`ʪ늋Ft*tF@FN1j`ʪ`FH9t?"LG}܉CNJ"dtmj*u詆Åt FVR1ɋU]ƒtFHFV8{`ʪ{,j*u FURًUEH1҃BX봋V~x `ʪ%1GMjU8t@{8L} FURًU61҃GDE؃j]PBDžE؀8"O Ptt;}wE؀8F E8`ʪt `ʪHEXt*E؅tusuCth[uփ FP1ɋU؋EuƒG*u FHGp`ʪ@ESCu^[tE؅tus_uCt[uUWVS,Ë@ u{t1e[^_ÍvU׫M1Ҹz@DžuP@hL@styC nuxVhPtYUƅt@t QuVsЃ -=P@fEC KvUWVSEUM8u `ʪ؍e[^_Á? `ʪuGE܅W ӅM܅M܋A;GgG$EG 1ۅtvwSt%[t>tVs~uGuԨtCtЋEM[uG$M܋AE܉GG _ EuE܅pG fEÅt WJM܉O믁:`ʪt`ʪvC5G$SW EtUEtCME'CU1GE܉‹@GRG EOM؋t^Zt&E0VsHuCt[uߋU܋RU܉WCtOEڋM؋E utˋMGRӉW ?E-8`ʪ`ʪE܋@G uBEt UEt MEtE1i1b uOfUWVS(u MEP1ҋEÃt:U 1QpttguP+}tFUtZ 1Q3tUuJt# 6p؍e[^_Ð؍e[^_ÐE؍e[^_ÃuPiUVS UMUUEuVjURPÃt ؍e[^Ív EP11҉Ãu EtU  V|؍e[^û`ʪUW}tnEPuMU W5Uv[u9}tX 1QrUt#uP~1҃Ћ}ÍvUU뵺Ћ}ËEE롋E1͍vUWVS]txEPuMU Ǎ5UvQuAuEm@1f{@Ct<VP*{uEfe[^_fUE1e[^_ø@1v${@CtVPzuU묿`ʪ륿 `ʪfUWVS]}u>t+EPuMU Í5Uvt؍e[^_Ív>1ۉ؍e[^_ËU:u`ʪP@Pj EPRpƒu P@uϋEE1}ыE܍|;}uUWVS]}u>t+EPuMU Í5Uvt؍e[^_Ív>1ۉ؍e[^_ËU:u`ʪP@Pj EPRTuv P@uɋEE1}ыE܍|;}ufUWVSuEEh+u;u| VUЃRurEQVuu{E0UEuoE̅tLE@EċÙzt<j uPzE̅u1}эqp1EEUB u]ká@tRuSUrЃ u/kUBOE뺐UWVSEUjFnÃ1߫`ʪ}֋E8~tqE VnǃMuPyXZE@PWx{5<{@WKyuLM1e[^_Ívx/u hz@mEu1эt^ƅt(fe[^_ÐPVuWy`5P@nvUWVSx]jmEE@`ʪU:E]E uEEEE u=pXt)f Pgu -t_u_Guۃ 1ً}҉ىэ PlÃVuhz@P,XZEPSPxE%p= t ShAU9U~EU@E'E MPun5Eċ}t"h>@juu,rME u衮UUutsM]}UƃtEUECuыMYƃttEMEEEt E8UZ Re[^_Ë5P@6 taUZ5<{@Suu%}\ u蚭E뿋E u5e[^_ËEX}e[^_EE]ԋGP;fEPujVuWV uMO(U WP)ȍX1ʉU9UЉUrNEO0Mf]SujVuW =H++uuJE_$UMHU܅Jw+N1v fL N f`QWfE EG$ULNG$]L?8G$]LGpNNGpNFGpNSujVuW SujVuWܩ 7UVSuFt$1C9^vPv0SVte[^1UVSE8+t [^ËPtX E 9tJU 9u1؅~ωt9t19}19t9t;U t9U rىfUu uvfUvUVS]Ku e[^u SUTًBI9M|zG _,EӐUvUWVS(ƉUMj\]Ã1߫+t{sECt*1w SYF+e[^_Ív P\EtʉC u܅t9KNjuE1e[^_f |vF+e[^_ËK{ 1UVS]u K SCVuCBȍe[^ÐUvUE 11UE 11US] UxCEP3qt&CPjuu9EU ]ð]ÐK;K}KCUACREp0*>uӋUBPsjuPRtC렍EPjju-uUWVS} utKUB;Hre[^_Ð;Hrx-SjQuge[^_Ð1e[^_Ë] C 9C}U BӋR @C벃 C SUPR ^EuE h @F+eC먍vUWVS];+s0EEEE j(TZqE܋M1 s+ZEQsjP!hEXZuVha@jjjS#ǃ }E tQVu 0ǃVha@jjjSǃu}PTVjSYǃugC`d\`uC``EؙRPVSAECX VjSVǃvF+ uUE^uUe[^_ÍvF+e[^_ÿ+ݿ(+փ jJ jYUSU] CEU [vUWVS,E܉U؉Mԋ]pCtp1CttCk+e[^_U܋usS e[^_Ðu Q;Bs;Bs4C5+e[^_ÐQs(uujjuPSǃ sRsPQ @Ct됋CEC_EEECS ;uQs(EPU2s sEP3S E tÃCUtt3Ck+}tRsE03/?CtCCCU됅EEEfECS ;utăEEtQs(uU2s sP3S E  EdPs(uujju3S ǃ DE1UWVSm(+e[^_ø+U+KvUWVS} ]ut@1e[^_ÐEPj5@uLtU Be[^_Ã|~~wEPjjuXuϋE Vuuuu u=EE jPu\E @8Nvw Ur@uE @F+ESUrjPNUBPujuPR ^UEf8 u Hf9HwU 9}w+ÍB9|1ÐUWVS];+t+[^_Ív 1} sCEt7H ts+M EPM Q@A )Ѝ@AE pCU BBBB B$B(B,1[^_Ë} 땐UVSPu4HQZLuRp pQ7e[^ÍvRXfHt @@X4jvPSe[^UVSu]>+F@Nt}VҋL to;Vt*SA1fACfA 41[^fCSA1fACtC=w)-fAC=wfA뱸+본+문+른+UWVS,E8+UJJE EREE؃Efҍ<} t0}t*} tP}tJ}P} v^+e[^_ÐE9PlGaGE } uEP;P]GRE 듐E$X@UBϋGG G W G 6p BG w GPMAUB;BF1҉¸N1ڋMQEH@ G GF )ȋUBGtMI}}MQ;QEHUB;B|+EB@G G G*G uE G E܅UB;B_$G$u Bp7<EG$E܋HUB@ P;Vpj3JMA3ApV=ZYNKK FCG E܋@ CC} I4s C UB;B}C$G eE ?GH9G E )vF1҉¸N1ڋMQAA FAA=-AAw 1fEP;PGUBHMA$w } t }-G!G W B;Wpw W MA;AGw 7 PB3jQRPE+e[^_à s CHC CGWCS+|+E+}+~+F+vUVS u>+F@VFS C uVBC CHCt-‹fPKu VtOvaÉ؍e[^fC Ft&E tH1Q@PB PRBBK f1Ff@륻+맻+렻+PEPj VÃuu VV NA )BAXLu,Pv vQ/à juvn/@XUWVS0ẺUȋu} EPjuEЃ7ŰB;EU+B;Eu5M]9PEPjuPEЄ+fEЍe[^_ÐPEPju)=|+t;M]11 t!9w3r9w-PURjuuuSEPj uu^ŰBKvr9WE19aw9WPURju=|+uEЄ+EЍe[^_ÉEЋEЍe[^_EЁ+EЍe[^_=|+vUEU MUM 1nfUWVS,Eȁ8+'UȋB@MȋQAC PEPjQu}UȋBCH9C tyM]11 Eȋ@EЋUȋRŰE)Eu}RMQjuuBEEȋ@~8M̍ɋMЋDH;D u$QMQj urfe[^_PWVue[^_ø+e[^_ø+θ+ǍvUWVSÁ8+%@@"sQEPjSƃt e[^_fEPS~XZuUM)ʉUE܋UptsJSDžxDž|1щMA t}UUfBfEEE}+EEt u0E3 u0e[^_Ív+e[^_þ++fz CHP3L}EK ɍ HljE: Cp3E| xu=CpCH1v(NJtt !~ ~xDž|EPuxs~ƃ}uEufFCP fV uvuF+E@D VRPQ,?E@ dC@PujuPRƃ GCEU)B)B MAufFƅdhDžlEPURjSƃhlE܉UUUEC@+E܉EWMQjSƃtpUƃlS KA BAPLPs sQ)ƃ3fF+zS D;D}DžxDž|PURj Sƃ&EԋU؉x|ƅtpUƃSs 'KA }uUSBBHB C@CMfAuuUVuVj Sd+})} VjS%ƃhlU܉MMME}QuVjSƃ*@XifUVSu>+F@VFC;C|KE t+؍e[^ÍvaÅtjV؍e[^ËF^ C E t K S C xQD@PRB P8 C C@CfAPujVÃumÅdF+<+2Q 눻+#vUWVSE UX\]uPTu>+aUB@e]SMuNECx|T PuDuFuɋDoSE؉+t e[^fN9tt BRP Nt AQP F t F E P\!EF Ft FE P5!EFFTt FTE P!EFTF$t F$E P EF$F0t PVuF,t POuFHt PFHFLt PtiCHCu^tE PZ EKt CE P4 ECC S  V e[^ÐUu +f-+w1UE@ÐUE@ ÐUUE 9tÐE9BrEtB MEB 1ÍvEÍvUWVSMy _AQU9w(9s$)ƋI9sCF;]vZ[^_ÍvUWVSu} EE9~w>D;F w5E~%1ۉ+NىV C;]uY[^_ÍvFE} E.+[[^_fsfUWVSu} EE9~w:D;F w1E~#1ۉ+NىVC;]uX[^_ÐFE} E-+X[^_rfUSME Ut9u9Qw ]D;Av G+]ÐQ؃QPuR-1]ÐUSME Ut9u9Qw ]D;Av G+]Ð؃QSPRug-1]ÐUS]uC+C@RPjs.]ÐUWVSE]tU9t e[^_fz ;} rxBEU9UUB)EmuFU)‰X9t+UBESP#EUB9r}U EP UP1e[^_ËURUu 9wI9vEH+X؃ NK9rU9UTU EP 1e[^_É9r*)QSjV-mF+UWS}j<~Ã8E CECEC EC+ +tOC=+}tQ 1}QE SF+e[_ÍvC0+}ufCC+Cx WEueCE P_EC$IF+e[_fC-+@F+e[_ÉCuP1*|CM tRWu P*E$17PWjs9,UEu pppp pp0oÐUujuuu ujh +IÍvUMU At Puh@QRjf Ðuh@QRjMUME Q9w;A vRPjQ1Ív)ЋI ÍvUWVS u} 9~w8UD;Fw,~D1C;]t:;PVt1e[^_QvWh/+En1e[^_øe[^_ÍvUME Q9w;A vRPjQ1҃Ð)ЉA҉fUME Q9w;A vRPjQ1҃Ð)ЉA҉fUS]u`Ct CE PECKt CE PEC S]fUWVS]Mt U;Et Ee[^_Åt;uB;Ct E e[^_ÉыR ;S u)lj}qC9ɉuЃe+u9r,vVuEXZVS9EuFE9p s1xUSjQRP9#xPjEPSP]Ð1]ÐUWVSdjuPǃ#EPWWuE%p= EEEEvEUEUEUUM9uݐEU9U|[~Q11ɉEUE RPuuAM1f WI؃e[^_f9EsvEUEUӉ1ډt ]uVf]uIP@e[^_û끋Eؙ} U1nUju(OxU  P?I1áP@ÐUWVSU] u}B@dtC"uB C1[^_ÍvCtEEEU¸EUC1EUu}USEU1fCt1[^_UWVSU] u}B@dtC"uB )C1[^_ÍvCtEEEU¸EUC1EU)u}USEU1fCt1[^_UWVSU} ]uB@dtG"uB G1[^_Ð_1f_t1[^_ÐUE@ t1Ð@Puju PRÐUE@ t!P;tRpju%1ÐPBuju RPÐUWVS|u EE@ h:EPhju,%U+BB\@ RPuMQẼt uE̍e[^_ÍvuFp\ 1}QEF uPH"$lÃFPhjS^$fC8SfC:UBCBCBCMfA6ffC6uFUSEt(A ~11ҋAC„9Y A1[fUEt8+tËU P8UP+t+ [^_Ð~}G,u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS uM ]EEUU>+t+ [^_Ð~}G0u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS E8+t+e[^_ÐM UBP$ 1} QEu uM9tx] tM?tFj&SDžtGj=S…tBPMARSQP$ƃt u e[^_þF+"1ھG+1 UWVSTEPux6u Ep 1hL@hř@^ƃRPhS]PVhSw]j Stj StuSt&tEPS5uEpu9}u VUE uhљ@u1e[^_à VUE 1e[^_Ë}Ujju uÐUE U|#~P@Ív=wRuPu+ÐUU:+t+ËEEEEEEEEPh@uju RM uċUuL+UVSu]F9Ct 1e[^ÍvQPFP3uSC e[^ÐUWVSuE>+t+؍e[^_ÍvEEuB EPjhAu V7Cà t"fEt P(؍e[^_ÍvEPjjVAÃuɍEPu uV ÃuE ;EPdPu V?ÃuPhjWF\%@ffDžfDžjjWVU艕 fDžFuRV=HÃSWuVÃMtuEPj1}IQuu V u&O+PhjdP>=L+uc juuu VK uHE ;Etf~RdPu Vu!PjuVjjuV$ 4-UEU v Ív=v9w=v5w=v1w=v,w=w@fÐÐø fUWVS u E@u: UBP £@MAWPjR]1+ vqÃRvjPhFfCE uE1e[^ÐF@`u?U fCC.V fC C fPUS fH@.@ .몐뿸+e[^øF+e[^UUM B tt B9t1ø\+Ð1fUUE B t tB1f\+ÐUUE B tBB5߉B1ø\+ÐUWVS uVJ`t E9vU MD e[^_ËzxQ ؉љ]SVЛNQq ;U t0;Qs뫍vUWVSLu>+D hÃRPhjSt+ECC\1}щ $7EC uPY_j?s nU EEE@tPCPRs Vǃup} tu sǃuRCX\ hEt*CE ut~MVG+F+Et"U e[^_Ív+e[^_Ð Se[^_fF+e[^_Å @E CPhPR$EiCTEECPshQPRǃ8CTtRhsPC@P+ hLaECXCPQhjPRǃCX8+t1+CPuPRUUCTу8EEcsf~8St +f~Lv +VEuNV`MЩFdt}tt D+fEuu}NA whCFLt FX~LNSN(M̋FLtUVXNU̍D C(Et7E9Ct/"+<+C+xЃ5먋CPsPRsF`tCU HN MtC(EЋVU܋FL,Mљ)9UaF+F1CVU~` HEEMeEE1AK st19| Q‰E`C$E؅u C@E؋s tvEQuuS\SJVjPRQ uDCEԋM9K v=C s1|*H1u@VXSdCP}~*Bdt$C$St1f`f@B 9SwKcE fU uuuuu ju%ÐUVS];+t+e[^fU t3EEEPhD@jjjS襌 uŋEe[^PpPjSxuMC@du>S ȉ1A1w.2Pu ȃdU lEu=PvиɐUUxU MQ;Br;Br1fPE 06U Bt߸ÐUSEt[v[ÐUWVS}tE8+t +e[^_ËU2tf u }<utSu hWCt^Qj jWÃUtUJ;Ar";AsPE0ktzvEtuWSuUz1e[^_Ãj R]R8U$EEh@EPuu uÐUWVSE8+tDž4+4e[^_ÐUR8MA=v+Dž4F+ <4e[^_f P,t404% jXa/ jFaUWVS<ÉUЉM̋PBE;+FCBdEE̅Zr sIu؉VshPuMЅ(Cp( sFERshP3CEEEUUuJvEȉEEEMЅt!}C$UDuuEԃE E9C u̅t}t C$UDuUȉUWRus0&uCCH;EC$U mCPWjQPRT+F+e[^_fuuVus,j&u݋C$UL>CPujQPR#+멍vKA+A1q хXC9JƉȃ:A9w.+e[^_ËU̅u1EЅu1B+8c u1c߃ WE1UEP,t;P҃H0t"H уutf111UE1UE1ɺUWVSlÉUM@P UP(UsPUā;+C<@@dEӃ { 1уOQQẼ uẺEEC0t PY&@}fs u C0PuSq%ǃhEEC0E PoEC0Eut uA]t u,Mt ue[^_fEEEC,t P{%@}̥fs u/ C,PuS$ǃuE PuE ujC CEEEEEUډUvRuhusuuus0"ǃzEEċEtZEC$p}t @4PuhuuuVus,"ǃuEE U9SMtEC$0}t @-CPuuVPR%+EZvuEG PXAuEEEEdF+EEDEdC,E PEC,?fSJuEPVRQ+E떍vuS萎%uSti\+e[^_ÿF+e[^_ËSXK(y sE;1uEvCu9vRus0 ǃu>C)E}E)ƋM܋QU܋PujQPRǃtESX$CEK1EI1uEHvCu9vRus, ǃuCE)EUE)ƋM؋QU؋PujQPRǃtTCC-F+&Et uEt u1m1ffUEP,t H0t11Ƀx0UE1UE1ɺUE@1ÐUE@E UVSu>+uP^X;+t +e[^ÐS t-Bu RPSuU SU V e[^Ív1߸+빐UVSEu ]M8+u=@X8+t +[^ÍvP tBM]u UH[^f1[^ø+̍vUE8+u*@X8+t+ËP t BUH1ø+ÐUWVSE8+usXX;+t +e[^_ÿ@u uPEt;PjEPu4ƒE8uCt CS1e[^_øG+띸+떋S tB@$tWuu RЃp@u u-utQjEPuƒE8uSC1*fUWVSEEEEEEEE|xXGE#|H M|Q UEGWEUċ_VSuuVEEptUMptVStpuK1ۃfU;Ur.MMEQuuwTQt%EU;Us҃ wm؍e[^_f_EEEE؋U+GWEU|B EMuuuuÉ$xRSjP@؋|y t؋_ sxPuuuuPSVÃ=$+m@E̋GWEЉUԋ|r _uRG_GEEd@EMMEjuuuuS\ t|_EЋU)EU܉RVuuZYxMẺEjuuuuS[\à tK x EWU S"`+n|I MK ws.Xxb+؍e[^_à wJ.F+؍e[^_ىM1ۉ؍e[^_à xd^w .vUWVS<}E EԋUUЋEÉ?+WXU:+t+Ѝe[^_ÐEԉEEUBREUG EؙU܋]؋u܃EЙuuuuIuuVS豽uuuu蛽ى‰…hEH ZAp LỦUEЉEUԉU Me[^_+!UWVS EU Uu}8+uKXX;+t + [^_ÉUuS tB}uMM UH [^_+fUu@%F+fUWVS<DžDž}?+uLGX8+tDž+e[^_ËGHG~$Dže[^_Dž+ËR@ P ‹@hRPPPhjR TDžw@Dž]jVSX @(Dž@Dž]jVS^X BRPP t BRP Bt P3.GXE PEGXGt GE P~EG WdBRP 8`+ UWVSE j`NÃIPj`jSF+$ $Eơ`@C 1}QECuPsXC CCC1+@PF Pu uRǃuQ hjtjj5@U>UB UB @@E1e[^_fF+1V t BRP  V$e[^_ÍvF+e[^_ÐF+봐F V=P@럿:+UE8+u'@X8+t+ËU t U 1ø+UWVSEӉΉƒE11fEt@At'B tB1 t>tB;G}܉Auڐ]u1҉Ѓ[^_ÉU뻋Mt!UEދMA @A BЃ[^_É}ڍvUWVSE׋EU EU}E]UZ ]J EșMȋ]eÉ_wjVSw11 t_P@t*1ɋ]StVPQuuuuS҃ e[^_ÐE+ϐUR Uk]ۉ]EH XPuuw9Et %+1UWVS EUωӃE1 vFt>C ttc C t3jC1RPUEtEFuÐEe[^_Àc 뫍vUE8+uPX:+t+1\+ÐUWVS lj։ˋEU EUA <t'C C USF @F Ce[^_Ív1jA1RPvUWVS,u }E8+PXU؁:+tE+E܍e[^_f}EXEE~̋UUE7vPUr u3C E׈C UB MtEEPEXu]WVًU؋E뛹U؋EE܅;uuWVU؋EE܃E+uuWVU؋EE܃ UuuE 1RPuÍvUWVSE׋EU EUEUEP UEUB Mȋ]eÉ_wjVSw11 thP@uKE+11ҋE)UWPjRUBtQSVuuuuRЉÃ ؍e[^_f붋UډUMvPuuw9Etx Ɖ»$+넻$+v1UWVS,E UEȉŰU:+MIXMЁ9+t +e[^_Ã}huSEE4QMq 0uKMEUE@ EԃEURUȋM̋E[u}>]ȋũEvE؃M9MtU؍DPډEZtuuuuȋUЋE"E؅eEȋUEfM܋\Ɖ׃RPًUЋE Ep u3NUR UE܃M9MuEUEH1EŰE)EE1e[^_1ɋUЋEquuuuȋUЋER+HEfUuuE 1RPuÍvUWVSE8+umXX;+uU@u u/Et(WjEPuщƒE8u SKy G+e[^_1v+e[^_ø+UVSE8+ugXX;+t+e[^ÍvƅuPjCE u sx%Puus 9Et%+멾+뢋5P@fUVS@ X1fCCc tE P苷EFue[^UWVSB Z1vCCc w |tEFu1e[^_øF+e[^_ÍvUWVS ]} ;+uSsX>+t+ [^_Ð9{ t+1ɉ4u{ ؃ [^_:f1 [^_ø+붍vUWVSu>+u3^X;+t+e[^_fFHF~1e[^_ÿ+1ɉډǃ sfx_LFXE P EFXFt FE PEF VȵX=P@UWVSUc j`Ã5Pj`jS+$ƃ @C 1}Q蓸ECuPFsXC CCC hjVW+džvǃubE E t PsFx\Ee[^_fF+ S膴e[^_ÐF+t V_fF+e[^_Ë=P@ο:+뷐UUt:+tËEt ME ÍvUWVS }uE8+t+e[^_Ðu p0] tiMQ] MuM MuGfE vMQM ;BvZRWSV臙u&C;]uָH+e[^_ÍGENjEPZ땋E1e[^_ø(+TUWVS,ƉU؉MԋPBdtM܋@$Due[^_Ëz ZjEPEPEPuV~kF @`V щMH EǍ10v9Xt_@9wF(9wQSuQGF9x vQC;]t2EtUt 9wE9wEt9t EF$9uvSu輘GF9x wN$M܋Ef`uVpe[^_ËU6UWVS } uE8+t+e[^_ÐuUr0uwEHy+A1q EgEH%SVNtICUJ;YrY9t+A1q uΉEH+e[^_ËUJ;yr낋E1e[^_ø(+DUWVS}u wNE܉PwjVBtqEPE 1RPWщÃt"fu܅t u誰؍e[^_ÐEEGPVjuPRÃuPjuWLEU먋G0t9EPju WRÃu뭍vF+؍e[^_ÐE6 WÃRUWVS E8+t+e[^_ÍvE]E EHY(EAL ;Uv ATEvu쐍F1EujAdtdEUB$UDtNt*EÍX1vSuGCUB9x(wE@$EUfbEP0MVuؔt-FUJ;1v ALu ;utY(QqT;uuVu蘔u@E01e[^_ËQTUJY(E H1@EE I+e[^_ËUR,U'+rUWVS$}] jEPEPEPSWfEG @`EuttpEtEWftE9G0tw~,1C9t#WE;BsPuZC9ufEtPu=Ee[^_ÍvPu |w b_$fcyUuuu h+uhfUuuu h +uHfUuuu h+uЎfUuuu h +u谎fUu uh9+h +aÍvUu uh8+h+AÍvUuu uh+7ÐUuu uh +ÐUێvUώvUuu h3+h+u莌Uuu h4+h +unUS];+t +]C<@SJuju CB DPBHPQSh+蚏 ]fUM9+t+A<@Quju AB(P2jQh +O fUvU韐vUovUcUEt Pu h@ujA] u h@uj*]ÐUVSUu ]t1Ɋ11 @1A9u[^UWVS }uGPVju PRÃu2t>9s%vfAQfu,vА9wމ؍e[^_û#+҃vu9sʉл#+Ujuu uZUEPJEEEUIfUjuu uUVSu]MU BEEEM] u [^vUWVSEU| ЃERU rM 1uAu FEEEE@E܋M9MvU Ju1Cf}E49uC9uE @Eبu V Fu9unPQuuSVE 0҃ }Et$SfKMy;E3u vu؋E4MIM܋E9EEt[C 9tM}9sBU RUff9~$ECfujUzv^99t9rɉuM9M1ۋUtPu vE 0uFut|e[^_Ѓ~uC9fE49u\U B#+e[^_Ëu‰U[1념UVS u>+t+؍e[^Ívu V蘪ÃuߋE EEEMuk v1tOEEEEEEEPh@jju V+VÃu螦s]kF+aEEEEEEEEPh@jju VUà U EEEEEPh@uuu uÐUWS]U;+CtqU܅tf1эAEEEEEECECEEPh@jju SZ u Mu&+e[_1맸+e[_R\Wu Sۨuы|tƀ|PWu S聥뭸+릐UWVS E }_ MQfu uMM E9}EE8f1ɋEtA@P 9|#MfQEf@)fpȍe[^_Ív9|GUGfBSP7ЃP誯G@`tG Mf AGȍe[^_Ë@fE9ENfEЋUfB6EUE@,ÐUEP,1;@t @ u @Ë@ÐUS]u }t @t'1]ÐKuStC, ]ËEu-}t'C,uuuu sh @jS C,뙍vUSËuCt 1]Ív jjjRjSP @tǃ1]Phh@jSC,뫍vUSËu 1]f jjjjjSP uǃ]ÍvUu1à jjjjRQP ÐUSÅt t1t 9PuAuIt1]à jjjjRSP ]fUWVSƉt31ۍv%   щ C9u҉[^_ÍvUu@1ÐUu@ÍvUVS SjQRPe[^fUWVSuE Ft0NT9sC9t1DtE [^_EVT9s}EuCVT9vЉ؉1Ut벍vUWVSÉ׋E puEjPWS֍e[^_fEjPWS֍e[^_UWVSÉ׉΋ RjQWS t'F=&t=uR jPSR e[^_C, WPh@jSC, UWVS,ÉUЉ΍E܉E󥋃 pu}jWuS֍e[^_fE܍vUVSEu XT9s'LuB fAuB9u[^ÍvUUE 9B r1B,U1ÐU1ÐUSPt#Hv9JsB Ëu[û[fUWVSÉ׉΋ RjQWS @t4F=&td=fu0W jRSP u e[^_Ðe[^_C, Wvh @jSC, 뽃 Wh&h̝@jSFfك jVWSP@tF_UWVSƉ׉M໨ӍMډb@tUt9uMډe[^_Wh<@jVF,e[^_fUSӋQUMT[UVSuy)E]ٺ0Eٺ0k[^USÀx]Ðjjjjj0PA u SXZjjjjj0S ]ÍvUEfUE@ÐUEfUEM0EEfUE@TÐUE@ ÐUEfUEfUWVS]CEUB) )щ )ȋUB<Mt/]11ۋEE1e}F;uuڍ W)ЍǍǍG90[^_ÍvUÍvUU EÍvUME @UEfUVSƋ@u.^u'%9F uFtv"HF1e[^fF,e[^Åx& VTRjjjhVP uFF 1뽋 5P@ Ph3@jVӸ UE1>fUE+vUEvUWVS Ɖϋ@u,Fu%ӁFt*9^ u@F1e[^_ÍvF,e[^_Ëux$ VTRjQShVP uF^ 1e[^_Ãt릋 5P@PhN@jVӸ zfUE1UE1UEfUEfUEfUVS@]u 9s sBuBEPsQ;uw<-tyEC 31e[^ËEt;C,e[^ËEuC, uVh@jS C, s Vhl@jS C,fUWVS }mrtBJ1e[^_ËBG Zt*fB s$Zu؋_taW$~/11ۃjjjjG(PWF 9w$LJG$G(t PxG(@ jjjjhW {t R* P LJ1e[^_ÃGTPjjjhWG Ph@jWUWVSÉUMpt(%;C tEEe[^_fu}|VE;CT}NC$~#{(U9tiw 1 v M9tUB9uQhg@jSEEe[^_à sTuh@jSE Ee[^_ÅtWtv%BGE@C,E-U jjjjMPSRE C$~4@s( }襋C$HC$uC(t P9C(EPh @jSEUS]E P1sT1ɉ6]ÐUS]E P1sT ]fUS]E P1sT]fUVS]t SCt  PICt P0Ctv PVƃC(t PC(@t9uC9tDuPh jS&$输e[^Éj1딺@fUVS@uuduFt+Sh8@jV Ve[^Ðt'Rhh@jVɉv1e[^É` v9PjP6F@t! jjjjjVP @EPvuoE;uE;MPh<@jV 5P@Ph@jVӃ Ph@jV0 5P@jPh@jVӃ 5P@CPh@jVӃ sPh@jV\UVSu@u 1t't St۸e[^1e[^fUWVS } ]EPu@tE@, e[^_PhjBPzu h)tcށvWVPEp'9tЋE 5P@)$Vhh@juӸ e[^_1e[^_ÍvUWVSEEu UUMMEE܋U苊Y t}vC9s S 9r0[uAU܉UMMUUu MMe[^_9MM9vB)UM)щM)sPuVu諟]܅Mu1e[^_ËUUE uuEEPWu tlj uVh@juEUB,@ e[^_É) uWuVu uE)E}<CS UE2vUWVS u}t%FuFt!F, e[^_Ív1e[^_P jM RVP uFtE SWuPZ1봸u Wuv9tF, 5P@ZYPWu h@jVF, WfUWVS}u ] j3RWP u7Gt@RSPu距Eu 1e[^_ÍvڋEe[^_ÍvVSuwE9tG,EG E 5P@uPuSVh@jWUG,0vUWVSE֍EjP0Ã@ m&p$Eu}VjjUr@tIEE0QhSP褜@ߥf uSUr;Etv S谌e[^_ÍvUP X0WhSPGEu 1e[^_úh1溨XTv1닋UB,농vUWVS]tf} f]tXډ@t]؁}uߋUg@uлN؃,[^_û؃,[^_1ҐUWVSLÉUME1sT@ME1sT @U1} UUt$@}ЭuFUUu;fuVuUME‰ƅuJAPuVjuUMue[^_ɉ ƅtfE1sTtPhȨ@jSe[^_1;:U+E1sTtUS]E P$U M@]ÍvUWVSƉӉϋRKM;HT1ECECEu'K U4@SC1vTM@t]EvS@t8S9CFuŋNutCK Sye[^_ÉűErSz@tCS^K S"ECEMAMK9NTv]S uVPCE;FTPh@jV6'Ce[^_F,1/Ph@jVvUWVS,u] tH@L@Ve[^_ǃǃǃM܍~}䋓EЋuEЉ~e[^_Ph8@jS؍vUWVSLEEEEljUMUEfMMEP^ƅ]UŰEH P/Eȉu]č]ỦUEt!uuuuuWU  VlM؋UiÅ_UxMEȍe[^_ËUJ Ru#EPtRhl@jWUEEȍe[^_à VkUՋEPu]ȃ VkTPh@jWfUWVS]u11҉Ste[^_C VMU Ke[^_ÍvUWVS]د@ߥExuptQuu udƃe[^_úEtރ SMU EwƋE UWVS|]}uCuCtC, e[^_à E PE1sT@C}U MMEPuEtUD29E>C,{,u }wC, uU M EP7mEIQuu uy.ExE1sTM@UEԉEfUԉUM@}u;}wӋUUEE܉uEEE&M-@ uVuURSP@tc1Et uhE1sT! uU MC,EE@tދtU@}@>PUEUE|M캨@UqE1EEEԉE3Ut9v=UU;ENjEEUUԉUMԉ@t:E9EvUP us SPEUUE}ԋE1sT@oEE܉uEEE&U@F uVuURSP@$ME1sT@C,@P jC @PSR K TU!)ʉUEȉC %PslC1|EES +UM@fUUE(MU@UUЋM MЋE E̋u `} 1wT*ŰEMЉHEe[^_u 5P@芤PhЩ@jVӡH@L@}W } M܉}@tMME :Åt5EM9ɉމu$ S^U 1ۋE Et+ S|^u tVt SM^H@L@}WSh@jWWh@jVE ǀ,QfUWVS,u;Åt ؍e[^_ÍvM-@uhȜ@"M1ۍ}9E=fE܋M RPPQhD@]܋M؉M t] RjWQV @ug؍e[^_ùG؍e[^_1PSSh@jÃ؍e[^_ÃPh$@<؍e[^_ÐUWVS,Ɖ׋XTte[^_ÐM1ɺ@t ]uv~e[^_ÃWhߜ@]tf RjURSV @tm uuuuuuSWh̪@TE؃0Mډ0@tNE؃U9tQPRhX@]ԉ]vASh@E#Sh4@]ԃ뼐UVSuFTt1ۍvډC9^Tw h@te[^wvUWVS\]EwzBuMrOruSt1US]jKFƒtL(XBBB Ћ]ÍvUWVS Eue[^_ÍvE8L(uE tދEt׃ ً} 1QEً}1щ $EÃtptVu VjQY_uS_QUBt P)B}G t PBEpX 1I VA3& PAUVS]tHCBsC9t PC9uCt PA]e[^xAe[^ÐUj4jQIt‰B@BB f1҉ÐU1ÐUEfUS]jCK1҉]fUWVS }u u 1ۉ؍e[^_Ðt9u$9VsOuEtƒSWÃt@(t7E9tF(SFPR:OS,UtF,tPROumC0EtF0tPuNuIEF,t7MV0t%VWt@(u PfU9E%Eu1EÅ@$ VC{G_;COF,uQF0uWUWVS Nj0t!v^ 6?4$?ރue[^_UWVS u} tIt1 GP)BÃtPWVSJ;؍e[^_f1эy뼐1ۉ؍e[^_UjufUWVSƉjAÃt VtCe[^_à S9>UWVSXuƃ 1}I VƒZ1򮋅)=ẁz.uBt<.vSuhz@PY[URP9~xE%puU 9UtZUi=@^EPR~@E%p=@-U PsU V薃e[^_Àz,UWVSEEE@t1ۍvU(@Cu}uf]tGCEVWu3GX3s<$k<EuEuƋEEE]uEEe[^_UDH tu9s19w)@ÍvU1ÐUWVSׅ~GtAq 1 v t.1ȉƒ3 @ƒ3 @Fu;KuC E̍S!MͿfBF!tA@DDt-ABF!uj&EPhI@Ep1e[^_ËEEƉ]EfUjE(PhC@EpM1ÐUS]( PShC@Ep1]fUS]jjhI@sjjhC@s1]ÐUEP0x0tjRhC@Ep1Ív1UEPxtjRhC@Ep1Ív1US8j(EP]SIDj(ShI@EpR1]ÍvUWVSHE։R(t e[^_Ív}WV/)tj%WSue[^_ûI@fUVS]uj@PhC@sPC1s1e[^fUVS]sЉ9Ct e[^C9Su)C9uݍt-jPhC@EpOMA111ϐUVSuEx$t+X$PF1jShC@v1e[^f1USMA, u ]Ë] C1;A w,U B@2<v#1jShC@]s1뾸뷀ydu1ۍQTMA1-ōYdfUVSu]{lt+Clj PhC@vHS F11e[^f1UWVS E׉ˀyxuJ1jPhC@uSh1ɋEC\uJ7Bt@t C`te[^_ÍAx볍vjhBt@h@ue[^_Ð Vi%u@E7돐UMA`u fUBU *1fUMA\tAduA`uUBU 1fUM`tA\tAduA`uUBU 1ÐUVSu]jh SPEt hSPDopnqwaEUPEPhC@v6srPPh@v UF11e[^Ðjh@h@v농vjh@h@vgUWVS ljUM]1΃~EE;GvPw:tGEGjuu7"y=1e[^_Ð|wG tT;D3 wMA= 9}jWhC@Ep1ow0q Ѓ?Ȁ)Pq ?Ȁ)Ѓ?Ȁ)OUVSƊtv\uF>tFue[^Ð PutFUSÊu vCt Puu؋]ÍvUWS1эA;t$< GO;t GP%u؍e[_ÐUWVSlEtJjEpVƃx1EPV^xEU;BtBt VPe[^_ÃhL@VVÃtՍPShPi0t*vw>PS)PP0t1эQ\tNJq<#id@Rj>PZ+ƅ1@x>]j<'t5l@ ut G +PƃyPjVu Vj=\*ƅMF8"8t @v@u?Wjj0A b S|UbEBi|@ucVjj #G@j"Ph)OW0 Wv@u!QjjS/A$1IQ`j VUWVS\ME9@PU\EPu^ZƃWyEh@ucE EEE9u }19]ttKtC8/us$s h@uoC{s9twwh@umo?9uPsh@uSo19]ux Ub uyE9EtYo 1}уQÃt-Wuh@P$EZYSu3V$kEt' uVe[^_Ã=P@1e[^_þe[^_ÃjuSxӋE%p= ` 1}уQ/E>Ruh@PBXu_Ãxyh@PPE_XhSV]UU RPh@um6EY@5P@ uDhPYVUSjQRP!xPjEPSiO]Ð1]ÐUWVSd}EPW*WuE%p= EEEEfEUEUEUUMQuݐEU9U|~EUe[^_Ð9EsvEUEUӉ1ډt ]u땐]u댋Eؙe[^_UE U|#~P@)Ív=wRuPuKMÐUVSjuVWt u1 [^_]Ít&$u$h)ƉfUWVS u} &}$7ÍGE$$9u>uӃ 1[^_]Ð$$ )É[^_]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$tt$|$$5؋u]}]ÐU1M9t :u)]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]W&UWVS ]} &$ju+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$u<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$HAEEs{xC{$EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]tt&]Eu}]t&FED$$W1 f?[D$E`@D$U$ uɍFD$ ED$E<$D$Uh@FD$ ED$E<$D$@v'UUE @U]<UW V`@S1ۃED$D$$D$ED$E$t&߃ t;>t[`@D$ED$$ u˃1[^_]Í& tED$`@D$$ E h@[^_]Ív'U;$@@;`@&@ =@uÐUWVS }1 v@t$$t&9{u@t$$$0ƍ [^_]UWVS }1 v9{t+@t$$菃u [^_]}t&@t$$臃$ [^_]QUVS@$ƋE@F@1&@;Fw@\$$u@\$t$$CE D$F$t^[^]@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$.\$D$D$ E D$E$ ,[]ÍUED$E D$ D$D$E$+ UED$E D$ D$D$E$+ UED$D$ED$ E D$E$R+U襃@@@Ít&UWVS,EUM=@G@@ Eu&)ċE\$#D$D$$oED$ED$C$E\$t$ |$D$$*t&1 &@\$$ttF;~u@\$$xE;uL;~t)&k{&떍#vދE;u֍ e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$&\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$K$C]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEJ@t`$É0E{C<$|$ƋE4$D$*s \$@$]u}]t&뙐U]Ít&'UV1SiM֍&9ws [^]fÍ&9Ív鐐t&֍UV1SiM@B$@։L$t&k9w)&s1[^]Í&9Ív9xƐU 0]Ít&U j0]ÐU(0]ÐUED$@$|1tÍv'UED$@$|1tBÉ'UWVS }1Mv<$D$zt&@t$$2|uԃ [^_] $fC$[$S@t$$|UWVS 1t&<$D$t.@t$${u [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$9E r݉4$t$$D$&$4$E $w맍vUE]utoU1u ]u]ÍvE $$*ƋE $m4$D$E D$wE tC$1s롸$tE$$E $$҉CthtdE$D$ED$$E $D$E D$C$@\$${@1$C$$U]]u$9*\$D$$@o4$؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&P@eU@$wÍt&'UWVS,EEE E6EEE}&$EF$]]x;D$E$EED$D$EE$|$FD$]$EEEED$@$wlED$ ED$E܉D$E$EE,[^_]'UWVSyD$0@$@@$-u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$<$D$tt$<$4$UDNjB B9r[^_]ÐUU]Љ%   Ív'UE]fÍvUU]Љ%   Ív'UE]fÍvU1UwL@]Ív'UWVS @}t; @1f t$D$<$uv @[^_]f 1[^_]ÍUWVS @} tA0@1t&D$E$ut)C<$D$juuʃ 1[^_] @[^_] UEuE $lUÐP@Í&UE$lU Ð&UWVS,@t)t# t$@uE$Jl@ty$D$á@$@@@E@@@@@@@@e[^_]ÍvUEeD$@$T$K-D$L@E$=NjE$<$D$D$6<$S6<$Y7C)čt$|$ 4$\$D$9<$54$D$p@w1Et_f$4$j|$@$U@UD$p@$vuU@e1&UUuu}}]uLU $kÉ$M9r>t$\$<$$]u}]Í&P@1f$`1P@'fUSE$nkD$$@ÉD$d$@[]ÐUEt;8t6 @1҃wL@T$ D$D$@h@$-)Ív@1҃wL@T$D$z@h@$(ÐU]0UU S]G) ʃ)1[]Ðt&P@獴&UU S]G) ʃ) 1[]Ðt&P@獴&UU SG,Ћ] ʃ)[]ÍP@䍴&UVSUMu t@@B@Bt\1ۅt.P@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US @]uu% @1[]Í&$ti@B$@@D$ @1[]ÐUED$ D$$o1Ít&'UED$ D$$?1Ít&'UD$D$$@@D$ D$$@@@t&`@=@u$@ U=$@]]uu}} G~&P@&]u}]Ív tՅt4@@D@CH@CL@C P@C1t@@GD@GH@G L@GP@1rfKUS]=$@t=G( t#M @@ @@[]Í&[]Ív[뼉'US]=$@t=GH\$$@u@@t$Ѓ1[]Ð1[]v빍P@ U$nÍUEwE]e;t&]Í&'UU ~ÍD$D$ D$D$E$1ÐUP@]ÍUP@]ÍUWVS1ۃ }9~t3@\$$GkuP@ [^_]f@\$$7k$]-uȉ4$Q 1[^_]Í&UWVS1ۃ}9~t3@\$$juP@[^_]f} tr} t} ft"P@[^_]ËF [^_]Ë]F 9t!tD$h@\$ D$@$!^ 1[^_]Ít&]F9tD$h@\$ D$\@$!^1[^_]ËE cF[^_]ÍUWVS }@1 f9>tl@\$$iu$.Ƹt>@t$$rk@>@F@FF t&F [^_]uP@fU @tÍSk@`@$d@$h@$Ðt&UVS@t519pt#@\$$hu[^]Ít&[^]bf&'U(Eu]}t;$++D$4$NjED$+t.]Ћu}]fP@ލ&Et$ D$D$E $,D$|$4$<+څt떍t&U(Eu]}t;${*D$4$NjED$*t.]Ћu}]fP@ލ&Et$ D$D$E $-D$|$4$*څt떍t&UE]uu}} #tEt$|$$M*t]u}]Í&]u]}])t&P@ÍUEt&D$ ED$D$E $*ÍP@Í&UE]u\tVD$ ED$D$E $,t]u]Í$'uP@ӍvP@ UE]t&UVS u ]00 D$L@$/0$'ft^ErtDaDED$$Q/t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$L@$.@P@됍&15D$L@$.uLvEwfvEwE+D$@$P.v$[&P@UE D$RD$E$0ÐUS]D$L@$-t$%1[]f$ t$l 1[]P@ːUS @u@tr@B@@:#@8@U::@D$ѹ@D$h@$?[]Ð@E @;] @}A@-t@q@[]QA@-@ta7D$-U@q@$Lt@-1&?[]Ív@t&y@D$E$x:t,@@8u@@[]Ív@8uh@9E@PE:@q@8:@D@D$@D$h@$?U @@q@bC@U$ÍU]UP@]ÍUE]uD$ @$*t;D$ ED$D$E $-'$"]u]Í&P@ UE D$D$E$ ÐU]ÍU1]É'UP@]ÍUP@]ÍUE D$@D$E$01ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$O<É'U}׉$]ÉuD$4D$G!$!D$D$$<"$!D$t$$G"G1G,w, O0tAG0G]G@u@G}1] US] D$L@E$t[]vP@[]Ít&'Uuu]}} D$L@4$ (t%$ ]u}]Ðt&4$MtI$1*ND$4D$<$2GAGG@@GP@농v'U(]]}} u$|$t]u}]Í&$D$ @ 'tԋG G\$ D$D$$[#G0G$두UE@1]ÐU1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG@\$$ \uP@ [^_]$@IٍEt1~t01t&ȍ<$t&kt ~t&uދE tFU 1f@\$$l[nU;uݡ@\$$l[ [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$Zu$ pD$_D$"@$)@1D$ I3CC@\$$\[^]~&'UWVSE}}Et[^_]19&;8t @\$$"Zuމ<$1ۍt&;>tV@\$$Yu1D$ D$D$"@$)@HUFF[^_]f뿐U[D$ @$<@@,ÐUP@]ÐUED$E@D$@$@D$ 7I@UE D$D$E$IÍ&'UED$D$$IÍ'U$[@F1Ív'UEu1}]$dItL$f$fw7D$F|$$QƆ<$肹]u}]Ív‰'UE$HɃÍU]'HUWVS }<$4s/|X4t&B)E4$ v@UWVSM1ɉ‰EE#E$KËE$kJStdfuC.C E\$$L11vD$xE$JtXC$赻ƋCt+rǍ&CC뗐t&$@tƉ떍F$ EE$IuE#&tcu :F/<$脫mED$E$Jt8_4$\$y$ƋGu/볍&|E$KE[^_]Í&$E$HD$E$I8$&@@E$H\$D$E$JaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE@EEEEED$E D$E$WÐt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$ȸҍUUE $T$ ÐU]]uu KSA9t BC]Ћu]Í CD$$'t΋S뷍&U8uu]}u؋u]}]Í}}EE@$@耫t‰EEE@ED$E D$E܉$D$<$tE;Er EtD$E$ZE␍t&UED$E D$E$!ÐUP@$@D$ED$3ÍU`@$Ít&'U]&US$d@]t$D$ $É[]Í&]ED$$?؃$[]fUWV1S }'`@$st4$ t7`@$t7 [^_]f`@$u`@$t1fʍ&'US$d@]tE $D$ $É[]Ít&]ED$$>؃$[]fUSd@]U u$T$>؃[]Í\$D$ D$$ []Ít&US]$.\$$td@t$ 2[]Ðt&D$p@$>ؐt&UVSD$L@$ʺ@ wD$ D$D$4$5 Ƅw`@D$D$م@4$$`@D$ D$D$$D$L@$ٺ@[ )wD$ D$D$4$ Ƅwd@ZD$D$O@4$6$d@D$ D$D$@$D$L@$@ wD$ D$D$4$ Ƅwh@D$D$O@4$h@D$ D$D$$$cĠ[^]Ð`@d@@h@Ġ[^]Ít&D$O@4$ h@vD$م@4$ `@*D$O@4$ d@U1]É'U]Ít&'UE@1] U]g&US]U taҋCu@CC{%t't#9t$t&31C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$Ut$u\$ D$@F$GƉ]u}]Íu \$KS<$8C $8U|$T$$\$ D$D$@F$ԿƋC $8뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$ @F$Z4$耞딍US$]u$[]Í&Ct$ELED$ D$D$@C$ڼD$Ë@ D$E$辭C $$E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$31҄u뱍vC!C$n뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$G?$wt&tyvC!C$>:vK9Crt$ED$ $ϫsY&{Cft$ED$CC$蒫sv'U]]u$IU $D$T$ D$^$$]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$ctӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$2@$2@@EED$ D$D$@G$貸Ë@ <9}sE<D$@D$E$聩C $趙$讙,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$ß_utRu4ttG!9u܍f]v֍ovɍt͉$vӘG!9uIvvE<$ED$ D$D$@G$GË@<9}sE<D$C $ 1t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$菦 )čt$<$u9s@a<w%$@@vЃ|+uf<$59rE1ۉ$$UT$D$F$+E$t$ D$&@$D$U$4w t Nun1ۉ<$e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$-$ҘFU$T$萤$&贘ËFCFCF C FCFCFCFCF C F$C%C$$gD$ D$$D$C%4$v'UD$/@$3@Ít&UWVS] D$L@E$~C$# D$@$N84$t$ D$D$<$uNh@D$D$@$q4$ $P@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$1[^_]áh@D$̻@$P@eh@D$@$P@11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$~8$t 1҃[]f[]Ít&'UWVS$軑1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|X@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UE]@ÍvUE]@ÍvU]uo5@D$5qD$ Ӊ $\$ w]u @]Í&'U]UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA +@ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@$Ðt&UED$@$Ðt&U@]ÍU@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$hD$$FFF D$D$$uta$sEԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأP@EE؃<[^_]ÍvEEP@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$t\$UT$M܉ $s\$E$FU F$E] UMV~HU1fC D$CD$EE$rMC K9}MƋVT$D$U$VrF D$$ 4$ubUE ]u$tD$E$~$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx@t9t)ȉ vt̅u@@@뵋5@9|͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$`k9@u,@9|Qu!@vWu1]u}]Í&tq $`뛐@ȍ&'U]]u1t#1tr$T`k9@t]u]Ít&@t@ݐt&@̍t&US]$xu][]_&U$]]ucۉƋEFtM u:3C9@t؋u]]Ít&@9E @܍t&U ؃t21빉'US]t$$bU PC9@t؃[]Í؃@[]ÐU$>b@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐUS@t1ېЋ@uX[臣Ungueltiger PPB! done Bad block %u out of range; ignored. Usage: %s [-c|-l filename] [-b block-size] [-f fragment-size] [-i bytes-per-inode] [-I inode-size] [-J journal-options] [-G meta group size] [-N number-of-inodes] [-m reserved-blocks-percentage] [-o creator-os] [-g blocks-per-group] [-L volume-label] [-M last-mounted-directory] [-O feature[,...]] [-r fs-revision] [-E extended-option[,...]] [-T fs-type] [-jnqvFSV] device [blocks-count] Syntax error in mke2fs config file (%s, line #%d) %s Out of memory erasing sectors %d-%d Warning: could not read block 0: %s Warning: could not erase sector %d: %s Couldn't allocate memory to parse options! Invalid stripe-width parameter: %s The resize maximum must be greater than the filesystem size. On-line resizing not supported with revision 0 filesystems Bad option(s) specified: %s Extended options are separated by commas, and may take an argument which is set off by an equals ('=') sign. Valid extended options are: stride= stripe-width= resize= lazy_itable_init=<0 to disable, 1 to enable> test_fs Warning: RAID stripe-width %u not an even multiple of stride %u. Invalid filesystem option set: %s Overwriting existing filesystem; this can be undone using the command: e2undo %s %s %u blocks (%2.2f%%) reserved for the super user Maximum filesystem blocks=%lu %u blocks per group, %u fragments per group Superblock backups stored on blocks: while initializing journal superblockwhile zeroing journal device (block %u, count %d)while writing journal superblockwhile reading in list of bad blocks from file Could not write %d blocks in inode table starting at %u: %s Block %d in primary superblock/group descriptor area bad. Blocks %u through %u must be good in order to build a filesystem. Warning: the backup superblock/group descriptors at block %u contain bad blocks. while marking bad blocks as usedext2fs_badblocks_list_iterate_beginwhile setting root inode ownershipWarning: blocksize %d not usable on most systems. Warning: fragments not supported. Ignoring -f option Illegal number for blocks per groupblocks per group must be multiple of 8Illegal number for flex_bg sizeflex_bg size must be a power of 2invalid inode ratio %s (min %d/max %d)in malloc for bad_blocks_filenameinvalid reserved blocks percent - %sb:cf:g:G:i:jl:m:no:qr:s:t:vE:FI:J:L:M:N:O:R:ST:Vwhile trying to open journal device %s Journal dev blocksize (%d) smaller than minimum blocksize %d Using journal device's blocksize: %d %d-byte blocks too big for system (max %d)Warning: %d-byte blocks too big for system (max %d), forced to continue %s: Size of device %s too big to be expressed in 32 bits using a blocksize of %d. while trying to determine filesystem sizeCouldn't determine device size; you must specify the size of the filesystem Device size reported to be zero. Invalid partition specified, or partition table wasn't reread after running fdisk, due to a modified partition being busy and in use. You may need to reboot to re-read your partition table. Filesystem larger than apparent device size. Warning! Your mke2fs.conf file does not define the %s filesystem type. You probably need to install an updated mke2fs.conf file. Failed to parse fs types list sparse_super,filetype,resize_inode,dir_indexfs_types for mke2fs.conf resolution: Filesystem features not supported with revision 0 filesystems Sparse superblocks not supported with revision 0 filesystems Journals not supported with revision 0 filesystems The resize_inode and meta_bg features are not compatible. They can not be both enabled simultaneously. while trying to determine hardware sector sizereserved online resize blocks not supported on non-sparse filesystemblocks per group count out of rangeFlex_bg feature not enabled, so flex_bg size may not be specifiedinvalid inode size %d (min %d/max %d)too many inodes (%llu), raise inode ratio?too many inodes (%llu), specify < 2^32 inodesinode_size (%u) * inodes_count (%u) too big for a filesystem with %lu blocks, specify higher inode_ratio (-i) or lower inode count (-N). while trying to allocate filesystem tableswhile zeroing block %u at end of filesystemwhile reserving blocks for online resize while trying to add journal to device %sCreating journal (%u blocks): while trying to create journalWriting superblocks and filesystem accounting information: Warning, had trouble writing out superblocks./packages/e2fsprogs///etc/mke2fs.conffs_typesdefaultsstrideInvalid stride parameter: %s stripe-widthstripe_widthresizeInvalid resize parameter: %s test_fslazy_itable_initE2FSPROGS_UNDO_DIR/var/lib/e2fsprogsundo_dirnoneFIXME%s/mke2fs-%s.e2undowhile trying to delete %s%%%dd/%%%dldMKE2FS_SKIP_PROGRESSwarning: %u blocks unused. Filesystem label=%s OS type: Block size=%u (log=%u) Fragment size=%u (log=%u) %u inodes, %u blocks First data block=%u %u block groups %u block group %u inodes per group , %ucreate_journal_devZeroing journal device: while trying to open %sread_bad_blocks_fileext2fs_read_bb_FILEWriting inode tables: Aborting.... while creating root dirext2fs_mkdirwhile reading root inodeext2fs_read_inodeext2fs_write_inodewhile creating /lost+foundwhile looking up /lost+foundwhile expanding /lost+foundext2fs_expand_dirwhile setting bad block inodeext2fs_update_bb_inodePATHPATH=/sbinMKE2FS_SYNCMKE2FS_CONFIGmkfs.ext3invalid block size - %sinvalid fragment size - %sbad revision level - %sinvalid inode size - %sbad num inodes - %s12-Oct-2008mke2fs %s (%s) Using %s invalid blocks count - %sfilesystemGNUhurdmkfs.ext2fs_typeext4ext4devfloppysmalldefaultbase_featuresdefault_features'%s'MKE2FS_FIRST_META_BGMKE2FS_DEVICE_SECTSIZEblocksizeinode_ratiooptionsinode_sizeflex_bg_sizeforce_undowhile setting up superblocktdb_data_size=%dhalf_md4hash_alglinuxfreebsdlitesunknown os - %sext2fs_create_resize_inodeAdding journal to device %s: donedone MKE2FS_SKIP_CHECK_MSGmke2fs@|@/@@@@@@@@@@@@{@j@@_@@@@@@@@@@@@@@@@@k@@/@@@@@u@f@@W@&@ @@@@B@HBThis filesystem will be automatically checked every %d mounts or %g days, whichever comes first. Use tune2fs -c or -i to override. Filesystem too small for a journal The requested journal size is %d blocks; it must be between 1024 and 10240000 blocks. Aborting. Journal size too big for filesystem. Couldn't allocate memory to parse journal options! Bad journal options specified. Journal options are separated by commas, and may take an argument which is set off by an equals ('=') sign. Valid journal options are: size= device= The journal size must be between 1024 and 10240000 filesystem blocks. while determining whether %s is mounted.mke2fs forced anyway. Hope /etc/mtab is incorrect. %s is apparently in use by the system; The device apparently does not exist; did you specify it correctly? %s is not a block special device. v1_superblockext2fs_check_if_mount%s is mounted; will not make a %s here! mke2fs forced anyway. Proceed anyway? (y,n) yYCould not stat %s --- %s G(root)HOME%s/%syestruenofalseniloffm@z@z@b|@@E@@z@z@z@{@{@u@`{@`ʪ{@|@{@|@}@D}@t}@}@}@}@~@0~@\~@~@~@~@~@)|@G|@@<@t@d|@@u|@@|@|@|@|@@Profile version 0.0Profile section not foundProfile relation not foundMissing open brace in profileBad magic value in profile_tNo more sectionsNo profile file openCouldn't open profile fileSection already existsInvalid boolean valueInvalid integer valueBad magic value in profile_nodeAttempt to add a relation to node which is not a sectionA profile section header has a non-zero valueBad linked list in profile structuresBad group level in profile strcturesBad parent pointer in profile strcturesBad magic value in profile iteratorCan't set value on section nodeInvalid argument passed to profile libraryAttempt to modify read-only profileProfile section header not at top levelSyntax error in profile section headerSyntax error in profile relationExtra closing brace in profileBad magic value in profile_section_tIteration through all top level section not supportedInvalid profile_section objectBad nameset passed to query routineBad magic value in profile_file_tBad magic value in profile_file_data_t[defaults] base_features = sparse_super,filetype,resize_inode,dir_index,ext_attr blocksize = 4096 inode_size = 256 inode_ratio = 16384 [fs_types] ext3 = { features = has_journal } ext4 = { features = has_journal,extents,huge_file,flex_bg,uninit_bg,dir_nlink,extra_isize inode_size = 256 } ext4dev = { features = has_journal,extents,huge_file,flex_bg,uninit_bg,dir_nlink,extra_isize inode_size = 256 options = test_fs=1 } small = { blocksize = 1024 inode_size = 128 inode_ratio = 4096 } floppy = { blocksize = 1024 inode_size = 128 inode_ratio = 8192 } news = { inode_ratio = 4096 } largefile = { inode_ratio = 1048576 blocksize = -1 } largefile4 = { inode_ratio = 4194304 blocksize = -1 } hurd = { blocksize = 4096 inode_size = 128 } `@+@P@@@@@<@p@@̋@@,@`@@@@$@P@@@@Ѝ@@܅@@8@p@@@1@M@h@@@@@̎@ @L@̆@@@@l@@@@4@l@@@@P@&@@@Б@@@4@\@|@@@@@h@@̓@@$@C@P@x@@\@z@@@Д@ɇ@@@@@@@@,@h@H@Z@@@u@@@@@@̈@ڈ@@@<@@*@E@\@@Ȗ@@@@@d@@@З@@@<@^@t@@@@ω@@@@@`@@@%@̘@6@@EXT2FS Library version 1.41.3Filesystem revision too highCan't read group descriptorsCan't write group descriptorsCan't write an inode bitmapCan't read an inode bitmapCan't write an block bitmapCan't read an block bitmapCan't write an inode tableCan't read an inode tableCan't read next inodeEXT2 directory corruptedInode bitmap not loadedBlock bitmap not loadedIllegal inode numberIllegal block numberIllegal indirect block foundMemory allocation failedExt2 inode is not a directoryToo many references in tableFile not found by ext2_lookupFile open read-onlyExt2 directory already existsUser cancel requestedExt2 file too bigJournal superblock not foundUnsupported journal versionJournal not foundDirectory hash unsupportedE2image snapshot not in useResize inode is corruptTDB: SuccessTDB: Corrupt databaseTDB: IO ErrorTDB: Locking errorTDB: Out of memoryTDB: Record existsTDB: Invalid parameterTDB: Record does not existTDB: Write not permittedCorrupt extent headerCorrupt extent indexCorrupt extentNo free space in extent mapInode does not use extentsNo 'next' extentNo 'previous' extentNo 'up' extentNo 'down' extentNo current nodeExtent not foundExtent length is invalidWrong magic number for ext2_filsys structureWrong magic number for badblocks_list structureWrong magic number for badblocks_iterate structureWrong magic number for inode_scan structureWrong magic number for io_channel structureWrong magic number for unix io_channel structureWrong magic number for io_manager structureWrong magic number for block_bitmap structureWrong magic number for inode_bitmap structureWrong magic number for generic_bitmap structureWrong magic number for test io_channel structureWrong magic number for directory block list structureWrong magic number for icount structureWrong magic number for Powerquest io_channel structureWrong magic number for ext2 file structureWrong magic number for Ext2 Image HeaderWrong magic number for inode io_channel structureWrong magic number for ext4 extent handleBad magic number in super-blockAttempt to write to filesystem opened read-onlyCorrupt group descriptor: bad block for block bitmapCorrupt group descriptor: bad block for inode bitmapCorrupt group descriptor: bad block for inode tableFilesystem has unexpected block sizeAttempt to read block from filesystem resulted in short readAttempt to write block from filesystem resulted in short writeNo free space in the directoryInternal error in ext2fs_expand_dirNot enough space to build proposed filesystemIllegal block number passed to ext2fs_mark_block_bitmapIllegal block number passed to ext2fs_unmark_block_bitmapIllegal block number passed to ext2fs_test_block_bitmapIllegal inode number passed to ext2fs_mark_inode_bitmapIllegal inode number passed to ext2fs_unmark_inode_bitmapIllegal inode number passed to ext2fs_test_inode_bitmapAttempt to fudge end of block bitmap past the real endAttempt to fudge end of inode bitmap past the real endIllegal doubly indirect block foundIllegal triply indirect block foundBlock bitmaps are not the sameInode bitmaps are not the sameIllegal or malformed device nameA block group is missing an inode tableThe ext2 superblock is corruptIllegal generic bit number passed to ext2fs_mark_generic_bitmapIllegal generic bit number passed to ext2fs_unmark_generic_bitmapIllegal generic bit number passed to ext2fs_test_generic_bitmapToo many symbolic links encountered.The callback function will not handle this caseThe inode is from a bad block in the inode tableFilesystem has unsupported feature(s)Filesystem has unsupported read-only feature(s)IO Channel failed to seek on read or writeInvalid argument passed to ext2 libraryCould not allocate block in ext2 filesystemCould not allocate inode in ext2 filesystemExt2 directory block not foundUnimplemented ext2 library functionSupplied journal device not a block deviceJournal must be at least 1024 blocksError loading external journalIllegal extended attribute block numberCannot create filesystem with requested number of inodesToo many reserved group descriptor blocksMissing indirect block not presentTDB: Lock exists on other keysExt2fs directory block list is emptyAttempt to modify a block mapping via a read-only block iteratorWrong magic number for ext4 extent saved pathWrong magic number --- RESERVED_10Wrong magic number --- RESERVED_11Wrong magic number --- RESERVED_12Wrong magic number --- RESERVED_13Wrong magic number --- RESERVED_14Wrong magic number --- RESERVED_15Wrong magic number --- RESERVED_16Wrong magic number --- RESERVED_17Wrong magic number --- RESERVED_18Wrong magic number --- RESERVED_19Ext2fs operation not supportedNo room to insert extent in nodeSplitting would result in empty nodeOperation not supported for inodes containing extentsI/O Channel does not support 64-bit block numberscsum.coffset == sizeof(*desc)@@6@@@@@6@6@6@6@@Ā@Ā@#%lu for %s#%lublock bitmap for inode bitmap for /proc/swaps/.journaltdb_data_sizeoffsetUndo I/O ManagerUnix I/O Manager@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@Invalid error codetdb_unlockall failed (%s) tdb_lockall failed (%s) tdb_unlock: count is 0 tdb_reopen: open failed (%s) TDB file lock failed in tdb_expand flvalfreelist top=[0x%08x] hash=%d freelist:Lock exists on other keyswrite not permittedtdb_brlock failed (fd=%d) at offset %d rw_type=%d lck_type=%d len=%d tdb_transaction_lock: failed to get transaction lock tdb_rec_read bad magic 0x%x at offset=%d tdb_rec_free_read non-free magic 0x%x at offset=%d - fixing tdb_rec_free_read bad magic 0x%x at offset=%d remove_from_freelist: not on list at off=%d tdb_oob len %d beyond internal malloc size %d tdb_oob len %d beyond eof at %d tdb_transaction_cancel: no transaction tdb_unlock: list %d invalid (%d) tdb_unlock: An error occurred unlocking! tdb_reopen: reopen not allowed with locks held tdb_reopen: reopen not allowed inside a transaction tdb_reopen: munmap failed (%s) tdb_reopen: WARNING closing tdb->fd failed! tdb_reopen: failed to obtain active lock tdb_reopen: fstat failed (%s) tdb_reopen: file dev/inode has changed! expand_file write of %d failed (%s) transaction_read: failed at off=%d len=%d tdb_write failed at %d len=%d (%s) tdb_read failed at %d len=%d ret=%d (%s) map_size=%d tdb_transaction_recover: failed to read recovery head tdb_transaction_recover: failed to read recovery record tdb_transaction_recover: attempt to recover read only database tdb_transaction_recover: failed to allocate recovery data tdb_transaction_recover: failed to read recovery data tdb_transaction_recover: failed to recover %d bytes at offset %d tdb_transaction_recover: failed to sync recovery tdb_transaction_recover: failed to remove recovery head tdb_transaction_recover: failed to remove recovery magic tdb_transaction_recover: failed to sync2 recovery tdb_transaction_recover: recovered %d byte database tdb_open_ex: can't open tdb %s write-only tdb_open_ex: tdb_new_database failed!tdb_open_ex: could not open file %s: %s tdb_open_ex: failed to get global lock on %s: %s tdb_open_ex: spinlocks no longer supported tdb_open_ex: %s (%d,%d) is already open in this process tdb_open_ex: failed to take ACTIVE_LOCK on %s: %s tdb_open_ex: failed to close tdb->fd on error! tdb_alloc_read malloc failed len=%d (%s) transaction_write: failed at off=%d len=%d tdb_transaction_start: cannot start a transaction on a read-only or internal db tdb_transaction_start: nesting %d tdb_transaction_start: cannot start a transaction with locks held tdb_transaction_start: cannot start a transaction within a traverse tdb_transaction_start: failed to get hash locks tdb_transaction_start: failed to read hash heads tdb_transaction_start: failed to prime hash table tdb_lock: invalid list %d for ltype=%d tdb_lock: lck->count == 0 for list %dtdb_lock failed on list %d ltype=%d (%s) tdb_free: update_tailer failed! tdb_free: right read failed at %u tdb_free: right free failed at %u tdb_free: left offset read failed at %u tdb_free: left read failed at %u (%u) tdb_free: left free failed at %u tdb_free: update_tailer failed at %u tdb_free record write failed at offset=%d tdb_delete: WARNING tdb_unlock failed! tdb_next_lock: loop detected. tdb_next_lock: On error unlock failed! tdb_firstkey: error occurred while tdb_unlocking! tdb_traverse: key.dptr == NULL and unlock_record failed! tdb_traverse: unlock_record failed! tdb_nextkey: lock_record failed (%s)! tdb_nextkey: WARNING tdb_unlock failed! bad magic 0x%08x in free list entry offset=[0x%08x], rec.rec_len = [0x%08x (%d)] (end = 0x%08x) total rec_len = [0x%08x (%d)] ERROR: failed to read record at %u rec: hash=%d offset=0x%08x next=0x%08x rec_len=%d key_len=%d data_len=%d full_hash=0x%x magic=0x%x ERROR: failed to read tailer at %u ERROR: tailer does not match record! tailer=%u totalsize=%u tdb_transaction_commit: no transaction tdb_transaction_commit: transaction error pending tdb_transaction_commit: locks pending on commit tdb_brlock_upgrade failed at offset %d tdb_transaction_start: failed to upgrade hash locks tdb_transaction_commit: failed to get global lock tdb_recovery_allocate: failed to read recovery head tdb_recovery_allocate: failed to read recovery record tdb_recovery_allocate: failed to free previous recovery area tdb_recovery_allocate: failed to create recovery area tdb_recovery_allocate: failed to write recovery head tdb_transaction_setup_recovery: transaction data over new region boundary tdb_transaction_setup_recovery: failed to write recovery data tdb_transaction_setup_recovery: failed to write recovery magic tdb_transaction_commit: failed to setup recovery data tdb_transaction_commit: expansion failed tdb_transaction_commit: write failed during commit tdb_transaction_commit: write failed tdb_transaction_commit: failed to remove recovery magic +@*@@ @x(@ @D)@H9@P@@4?@@@@ш@߈@@@@ @/@ @COMERR_DEBUGCOMERR_DEBUG_FILE/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ LABELUUIDBLKID_FILE/etc/blkid.tab/devices/devfs/devLABELONEEXT_JOURNALSEC_TYPEocfs1ntocfsMOUNTNSR0SWAPSPACE2H+HX%016llXmsdos%02X%02X-%02X%02XJFS HPFS /proc/filesystemsmdraid+NN+BDoracleasmORCLDISKntfsNTFS jbdSreiserfsReIsErFsReIsEr2FsReIsEr3Fsreiser4ReIsEr4gfs2pgfsvfatMSWINFAT32 MSDOSFAT16 FAT12 Uminixh$x$vxfsXFSBromfs-rom1fs-bfs{cramfsE=(qnx4QNX4FSudfBEA01BOOT2CD001CDW02NSR02NSR03TEA01iso9660CDROMjfsJFS1zfshfsplusufshpfsIsysv~swapSWAP-SPACEswsuspendS1SUSPENDS2SUSPENDOracleCFSocfs2OCFSV2crypt_LUKSLUKSsquashfssqshhsqslvm2pvLVM2 001NO NAME  Td n;0&AvQkkXaMDEVNOPRITIME%s-XXXXXX PRI="%d" %s="%s">%s %s.old %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c lrtyndurwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert 1qay2wsx3edc4rfv5tgb6zhn7ujm8ik9ol0pIO_ULINKlwIO_LINK ..:/%s: errno=%d console:/stdinconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/create$@@#@@#@$@@#@@#@@#@@#@@#@@#@@#@#@@#@@#@@#@@#@@#@(#@@#@@#@@#@@#@#@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZe.@`-@`-@`-@`-@`-@`-@`-@`-@`-@`-@`-@`-@`-@S.@S.@`-@`-@`-@`-@`-@`-@`-@e.@e.@`-@`-@X-@`-@e.@`-@`-@e.@ 6@2@2@2@2@2@2@2@2@2@2@5@5@2@3@3@2@5@2@2@2@2@2@ 6@ 6@2@2@g0@2@ 6@2@2@ 6@s<@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@s<@r7@r7@r7@r7@r7@r7@r7@r7@r7@r7@{;@r7@ ;@r7@r7@<@__PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M%H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 yE@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@UB@gE@UE@UB@AE@UB@UB@UB@6E@D@UB@UB@UB@D@UB@UB@UB@UB@B@D@D@D@UB@WD@UB@;D@UB@UB@UB@UB@UB@UB@UB@)D@D@UB@D@C@UB@UB@D@UB@C@UB@UB@C@C@UB@C@UB@NC@UB@DC@UB@UB@C@UB@B@@@þ@Ⱦ@̾@о@Ծ@ؾ@ܾ@@@@@@@@̾@@ @@@"@*@3@<@?@B@E@H@K@N@Q@Y@`@i@r@}@@@f@@@\@@@@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d wdDEV_LISTDEV_REG SERV_GET;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK REGDRV tcpip%02x:%02x:%02x:%02x:%02x:%02x%d.%d.%d.%dzR| pAB E<AB E\'AB E|_AB E@u@o@u@<Z{@@filesystem BLKSIZEfilesystem MTIMEfilesystem UUID+@@D@@H@@@@@@@+@(@T@@@@@@@l@@h@8k@h@q@x@@ &@@/@4@@=@8A@@Tt@8A@@Ot@8A@T@ks@8A@(@Bt@8A@@D@4M@L@D@@4 V@L@D@@4 `@L@D@@4M@L@D@M@L@j@@r@ @z@@@(@@@@@@R@$@@R@$@@6@$@@6@$@@6@$@@@@@@@@@@@@@IJ@@Dz@@ʲ@Ͳ@Ҳ@β@ײ@Ђ@ܲ@@@@@@@\@@@ @ @@ @ @@ @ @@ @ "@@ @ (@@ @ .@@ @ 4@@:@ @@:@ B@@H@ L@@Q@@H~@Q@ @H~@Q@@H~@Q@ @H~@U@@@U@@@U@@@ѳ@@X@]@\@a@f@k@p@u@ z@(@u@ @@@ @@@ @@u@ z@(@u@ @@@ @@@ @@u@? z@(@u@? @@@? @@@? @@u@ z@(@u@ @@@ @@@ @@u@ z@(@u@ @@@ @@@ @@@ @l@@@P@@@P@@@P@@@P@@ų@@̳@ճ@̳@ڳ@߳@@~@߳@@~@߳@@~@߳@@~@@@@"@(@.@4@@@յ@@@@@ @su@@$@,@9@D@N@X@ f@@p@|@@@q@@@@lj@@@@L@/u@S@d@j@o@u@}@@`@@h@P@@p@@@x@ @@@@@q@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2@@1jt@4(T7@< <@DrQdS@ymSS@yU\T@gV@;{@\@a@8d@F  q@w@`z@-|@K@@@ 5 @8@79@^IP@sYĥ@ m@p@֔@WX@Gϙ@L@/|@# @d@gl@" @)@ /T@k F@ Yl@: Sk@| @h @@?@4@@@M@nP)Xf@`j@9j@0$l@Q"m@*t@!0Lv@V+5x@9z@w>}@bt@|@@4T@G2<@@ N0@V@n@2@ʖ@P@.H@g@l@P@'x@_@8й@3@@8@K @Q@)@@0P@<@.@>d@-'0@J@@ƾ@@ο@@`@@@g@@!@ O@M@6P@ g`@y6@s@]d0@;p@)g@p@6@@@7P@d @l@@05p@9@+`@d@ p@  @3@@|@~@@}@QP@  @s-'@(^/)@M9?@:?@ A0F@=CF@REG@?(GG@IH@pMI@NI@8SP@f;UP@6W`R@STXR@YR@m[S@\S@aW@A|e[@f[@g\@9|j|& main$journal_size$journal_flags$journal_device%program_name%device_name)%cflag;%verboseM%quiet_%super_onlyq%force%noaction%lazy_itable_init%bad_blocks_filename%fs_stride%fs_param%creator_os%volume_label&mount_dir&sync_kludge%&fs_types7&profileI&sys_page_size[&linux_version_code(=print_check_messageffigure_journal_sizeparse_journal_opts8check_mountproceed_questioncheck_plausibilityget_progname<profile_set_syntax_err_cb5profile_iterator_createprofile_iterator_freefprofile_release profile_iterator profile_get_stringprofile_get_booleanprofile_get_uintVprofile_get_integerprofile_set_default$profile_inithrQinitialize_prof_error_table_rBinitialize_prof_error_tableet_prof_error_table)#SJ%mke2fs_default_profilehmSinitialize_ext2_error_table_rBinitialize_ext2_error_tableet_ext2_error_tableUext2fs_set_block_alloc_stats_callback/ext2fs_inode_alloc_stats2ext2fs_inode_alloc_statsext2fs_block_alloc_statsIgext2fs_allocate_group_tableext2fs_allocate_tablesR{Iext2fs_u32_list_findext2fs_u32_list_testext2fs_badblocks_list_test#ext2fs_u32_list_delzext2fs_badblocks_list_delext2fs_u32_list_iterateext2fs_badblocks_list_iterate9ext2fs_u32_list_countfext2fs_u32_list_equalext2fs_badblocks_equalext2fs_u32_list_iterate_end2ext2fs_badblocks_list_iterate_end\ext2fs_u32_list_iterate_beginext2fs_badblocks_list_iterate_beginext2fs_u32_list_addext2fs_badblocks_list_addext2fs_u32_copyBext2fs_badblocks_copyext2fs_badblocks_list_createext2fs_u32_list_create)eext2fs_update_bb_inodeA8ext2fs_block_iterate2Qext2fs_block_iterate ext2fs_bg_has_super<ext2fs_super_and_bgd_locQext2fs_update_dynamic_rev<ext2fs_flushext2fs_closegext2fs_group_desc_csum_setdext2fs_set_gdt_csum]ext2fs_group_desc_csum_verify$Nxext2fs_expand_dir |Xext2fs_extent_header_verifyext2fs_extent_get_infoaext2fs_extent_replaceext2fs_extent_getext2fs_extent_delete ext2fs_extent_gotoext2fs_extent_insert7ext2fs_extent_set_bmap~ext2fs_extent_freeYext2fs_extent_openmKext2fs_free_dblistLext2fs_u32_list_freeext2fs_badblocks_list_free&ext2fs_freeext2fs_get_generic_bitmap_startext2fs_get_generic_bitmap_endext2fs_fudge_generic_bitmap_endext2fs_set_generic_bitmap_paddingGext2fs_unmark_block_bitmap_rangeext2fs_mark_block_bitmap_rangeext2fs_set_generic_bitmap_rangeext2fs_get_generic_bitmap_range_ext2fs_clear_generic_bitmapext2fs_resize_generic_bitmapext2fs_make_generic_bitmapext2fs_copy_generic_bitmapext2fs_allocate_generic_bitmap:ext2fs_warn_bitmap2ext2fs_test_generic_bitmapext2fs_test_block_bitmap_rangeext2fs_mark_generic_bitmapext2fs_unmark_generic_bitmapkext2fs_free_generic_bitmapext2fs_compare_generic_bitmap)5 *ext2fs_get_device_size-8ext2fs_get_device_sectsizeX9+ext2fs_iblk_add_blocksext2fs_iblk_sub_blocksext2fs_iblk_setCI+ext2fs_write_ind_blocksext2fs_read_ind_block$Yext2fs_initializemO!ext2fs_flush_icacheext2fs_set_inode_callback1ext2fs_inode_scan_flagsext2fs_inode_scan_goto_blockgroupzext2fs_get_next_inode_fullbext2fs_get_next_inodeext2fs_write_inode_fullext2fs_write_new_inodeext2fs_write_inodeext2fs_read_inode_fullext2fs_read_inodeFext2fs_check_directoryext2fs_get_blocks ext2fs_close_inode_scanext2fs_open_inode_scanxIio_channel_write_byteio_channel_read_blk64io_channel_write_blk64Wio_channel_set_optionsG֔#ext2fs_check_mount_pointext2fs_check_if_mounted ext2fs_llseek ϙext2fs_lookupAUext2fs_mkdir#ext2fs_default_journal_sizeext2fs_zero_blockscext2fs_create_journal_superblockAext2fs_add_journal_inodedext2fs_add_journal_device'ext2fs_new_dir_blockOext2fs_get_data_ioext2fs_set_data_ioext2fs_rewrite_to_io ext2fs_descriptor_block_locext2fs_open2`ext2fs_open'gijext2fs_read_bb_inode? ext2fs_read_bb_FILE2iext2fs_read_bb_FILE-1ext2fs_create_resize_inode /gEext2fs_write_bitmapsext2fs_write_block_bitmapext2fs_write_inode_bitmapext2fs_read_bitmapsext2fs_read_block_bitmap=ext2fs_read_inode_bitmap^FW set_undo_io_backing_managerset_undo_io_backup_fileDundo_io_manager"Yubunix_io_managerSkjext2fs_set_alloc_block_callbackVext2fs_get_free_blocksext2fs_new_blockext2fs_alloc_blockAext2fs_new_inode/KWext2fs_reserve_super_and_bgdE 6ext2fs_get_block_bitmap_rangeext2fs_get_inode_bitmap_rangeext2fs_set_block_bitmap_range7ext2fs_set_inode_bitmap_rangeext2fs_compare_inode_bitmapext2fs_compare_block_bitmapext2fs_resize_block_bitmapHext2fs_resize_inode_bitmapext2fs_clear_block_bitmapext2fs_clear_inode_bitmapext2fs_fudge_block_bitmap_end(ext2fs_fudge_inode_bitmap_endvext2fs_allocate_block_bitmapext2fs_allocate_inode_bitmapXext2fs_set_bitmap_paddingext2fs_copy_bitmapext2fs_free_block_bitmapext2fs_free_inode_bitmap%ext2fs_warn_bitmapext2fs_crc16zext2fs_read_dir_block2.ext2fs_read_dir_blockuext2fs_write_dir_block2ext2fs_write_dir_blockZAext2fs_process_dir_blockext2fs_dir_iterate2ext2fs_dir_iterateQext2fs_linkM6a ext2fs_tdb_error ext2fs_tdb_errorstrext2fs_tdb_increment_seqnum_nonblockext2fs_tdb_name<ext2fs_tdb_fdjext2fs_tdb_log_fnext2fs_tdb_get_seqnumext2fs_tdb_hash_sizeext2fs_tdb_map_size1ext2fs_tdb_get_flags_ext2fs_tdb_enable_seqnumext2fs_tdb_set_max_deadVext2fs_tdb_set_logging_functionext2fs_tdb_get_logging_privateext2fs_tdb_unlockall_readDext2fs_tdb_unlockallrext2fs_tdb_lockall_unmarkext2fs_tdb_lockall_read_nonblock'ext2fs_tdb_lockall_readUext2fs_tdb_lockall_nonblockext2fs_tdb_lockall_markext2fs_tdb_lockall<ext2fs_tdb_transaction_cancel$ext2fs_tdb_chainunlock_readaext2fs_tdb_chainunlockext2fs_tdb_chainlock_unmarkext2fs_tdb_close.ext2fs_tdb_reopenxext2fs_tdb_reopen_allAext2fs_tdb_transaction_recover>ext2fs_tdb_open_exext2fs_tdb_openi ext2fs_tdb_transaction_startr!ext2fs_tdb_lock_nonblock!ext2fs_tdb_chainlock_nonblock4#ext2fs_tdb_exists#ext2fs_tdb_parse_record$ext2fs_tdb_fetch(ext2fs_tdb_delete(ext2fs_tdb_firstkey)ext2fs_tdb_traverse_readQ*ext2fs_tdb_traverse,ext2fs_tdb_store.ext2fs_tdb_append/ext2fs_tdb_validate_freelistq0ext2fs_tdb_chainlock_read0ext2fs_tdb_chainlock_mark0ext2fs_tdb_chainlocku1ext2fs_tdb_nextkey1ext2fs_tdb_printfreelistU3ext2fs_tdb_dump_all4ext2fs_tdb_transaction_commit6tdb_null)het_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#Perror_table_namef_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hook<oKblkid_get_devnameblkid_get_tag_valueQ"blkid_tag_nextblkid_find_tag_dev1blkid_dev_has_tagblkid_find_dev_with_tagJblkid_tag_iterate_endublkid_free_tagblkid_tag_iterate_beginKblkid_parse_tag_string2blkid_set_tag^*6fblkid_gc_cacheblkid_get_cachepblkid_put_cache#blkid_debug_mask!0 blkid_dev_devnameblkid_dev_iterate_end1blkid_dev_next~blkid_dev_iterate_beginblkid_dev_set_searchNblkid_free_devblkid_new_devL+5Ublkid_probe_all_newblkid_probe_allblkid_get_dev`9`Iblkid_strndupblkid_strdupblkid__scan_dirblkid_devno_to_devname6w>o6Ublkid_known_fstypeS/blkid_verify#t"blkid_read_cache$|blkid_flush_cache%blkid_get_dev_sizeTblkid_llseek2_ uuid__generate_randomuuid_generate_randomuuid__generate_timeuuid_generate_timeuuid_generatenuuid_is_nullNWuuid_packYuuid_unpackM4huuid_unparseuuid_unparse_upperuuid_unparse_lower2e2p_jrnl_string2featureLe2p_string2featuree2p_edit_feature2e2p_edit_feature]e2p_jrnl_feature2stringe2p_feature2string6ʖe2p_string2hash e2p_hash2string#P{parse_num_blocks2.9{e2p_string2ose2p_os2stringg=__divdi3G__moddi3__udivdi3__umoddi3 isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper?%errnoQ8init_memory_managerfreeZmallocrealloccallocdstrtoloqsort8ostrncmpostrncpydstrrchr-^strncasecmp strcasecmpomemmove0dstrcatdstrchrdstrcmpddstrcpy'ostrdupostrlenomemcpyƾmemsetο9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoullibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses#msleepsleep*nsyscall_psyscall_v!get_tick_countOagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarshtonlhtons$ntohlQntohs~hstrerrorgetprotobynamegetservbyname3inet_ptoninet_atongethostbynameinet_ntop]inet_ntoaherrorh_errnorunlinkg7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill6=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatsoaccessRdPlgetoptoptargoptindoptopt+opterr=optreset%getppidgetpid0giolinkreadlink!symlinkKfgetpagesizeisattyforkpipegethostnamei6chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstatgettimeofday<getuidgeteuidgetgidgetegidGvwaitpid,waitXwait_child_addqinit_waitpiddutimelxstrerrorY5=seekdiryrewinddirtelldirreaddir3closedir_opendir%_vmktempmkstemp'+Zrpcsend_message4 io_remove_linkio_create_link nyieldR ,io_split_filenameio_get_absolute_pathZio_split_dirnamed3get_pidget_parent_pidcreate_processmdestroy_processget_cmdline"nset_rpc_handler#~yadd_intr_handlerJa)vfprintffprintffprintf_putsn+fprintf_putc;}g]asprintf_putcvasprintfasprintf}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#  Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6s-_exit2abortGatexit{exiti^/ 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf8M97srandsrandomrand random{: gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF A0vprintfcprintfprintf_putsnprintf_putc8=Csprintf_putcQvsprintfsprintfREa_assert;(G~]snprintf_putcvsnprintf!snprintfIPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read pMysyscall_timerNdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name8Slio_seekW;Ustring_to_ip)register_netcardmac_to_stringip_to_stringV6Wcreate_shared_memoryopen_shared_memoryclose_shared_memory TXysyscall_putsnqYmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6m[nwait_for_rpcv_and_wait_for_rpcc\ppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvalist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_create|estrcspn(fQd__strtok_r strtokgomemchrfQ@@q@h"intXI5Lf7e~t](e 'eoy.Z%1H id2# }{3# pid4# .5# 7# 8z# >9z# :A# 4l14N ,/{ f0} {GP@q@-#FZ,ppbFLFzzH߄I3}c-vl3d@@k@@q<]7IY+,x&3-t@Q7@oh"intXI5Sf7l~t](l 'l0zy.a%1Jid2#}{3J#pid4#.5# 7#8#>9#:H#4<#A=P#! % HO>l1 4V r %) Sr Z ,3 8l J:s bs  R #D # # #  #Y # #I R# # # b b u b PM Q# SY T# O Ru U ]@ ^# _#9 `#2 a# b# d ew#s fw# g# h# i#. j# \ c kY C D#A E# F# G# H#  I#/ J# K# L#j M# N#  V#$# W#( X#d Y#h Z#lx [#p l#t  b  7 #\ #k #` # , # # # # # 3 #$t #(| #,E #0 #4_ #6Z #8 #: #< #>e #@ #D #H #L& #P #RM #T #X #ZH #\ #` #d# #h #x !# "# 'w#3 (w# )# -#} .#Lb /#& 0# 1#: 2w# 3w#. 4# 5# 6# 7# 8# 9#o :# ;#x <# =#E ># ?#d @#T A# B# Cw# Dw# E#! F # w b % b % b?  b  b  b z  `  ` #>B z# :# f lB CDA E   t y _ C #I Dl#s# ?s# y ::   y : :    z b  l: y   < y ,  W y : B  | y : ]  y :   y ll   y  1    y s:   , y s:  zB b8_M S 1__ #ioy #r:# J# ^ˆ#!l#:# Ō #Ƥ# ǎ#$l :#( "#,-#0?*˴#4n+#82#<* #@^) #DG 8#Hqq#L Ԙ#PՈ#Tc#Xcט#\nowؙ#`O #d#O,3#y #Y#"u# a fg pC I  U wCxOl| 5   B k  v  B k  B  B k   ?  - bH  - SB  S  9uB  : _* l,"[-#W.#max/#d0:#h % b % bO n7o7#nump:#maxq:# J%QleaPlbPlI%:fs$B blk$v F 5:$3-4v F fsB  J:$H"^ Ik ]u:t@@2< argt:^!lv:| :@@u argl!l:"y X@@#WD $@@W%fsB %blkv &f@,@" Y,@]@4'KXl(errXz' X:" `@@)fsB #k]:;#':Z*bufJ+ :+_ l,- J@"@#a  7)opt l# l-retJtp.i:!"$@ @?# k#"l*bufJ/bJ/MJm.pJ.argJ/JQ*len:/:q0/.bpg3+t+ ++l+!l/ :\1=0 M2Z2P3=@@ l2Z2P4=H2Z2P,  @% @)sl)strlH+7 "afc( @l @s)strbl#4 b ,f:l @ @}#a 7 )optlF #:d -ret:tp*cpp7, : @ @w #Il #& /  5Jtp5c w+ J/NJ  %6b"P @` @> W#Oj )valO "5` @ @ #3 #mb4l )max4% .i6:N "S @@a C)fsRB -sTt-bufU.osVJ /Wv .iX /Y: / Y: "~@H@/ )fsB [ 5~/   { .buf!J .blk"v /"v  .c#:" /T#:@ /#:i $H@@} K fsB 7K 7El !fQ8  Y [ a"_@F@w)fs^B #^:/ ` .blkav .ib *.numc:L*ipbc:5d~$sH@@l fsB 7[!i !jv !8 l?!blkv h8 f|8  8v 9):8 :3e@@22x:e@v@%22"@@@)fsB %/  N5^ ~-uidP.gid"U@@)fsB / l /  ).inok h+Il.i:|"@@)fsB .ik :@@2"@_@d)fsB ##[L/  u:@@22;PRS6߄5:}57*b7:*c7:+058:*tmp9J*cpp97+!::+W;:+ <:+X=+>+]b?:+h@:+As+ B + CJ+DJ+[El+ Fl+1cGv +Q Kz+L:+YL:+MJ+N:+OJ+& P:< )=*jfsRB +&S >*nsg?U7[l l J+X l+7 J+$J*cpJ*tJ+- l+*meg+:?Nu slt@7*cpp7?(:8a '7opt'l':*ret):*cpp*7? :Il+  +4y +Z+^+4 +{:+ :<<?=:sbosJA  BfsB CKDD$:`@Q7@##߄#:#}#7/ % .fs&B 5'[th/ (l.i)l.val*:/*:/&+ 5,#/-JE$ 1@1d`5 #2~2r0FGFGGGGZG3GoGHt\G G#G"_G."G:OFFFRG^FjGv/GkGFGFI3(@G)@ "2J(@G)@G5 3"@"@TK"222J"@"@G G+f!1X"K.!2"K!2 0G:u"FFGR-#G^#Gih$FsHG<%Gp%:@F@2L("G;&FJ)@*@G&18H?o#KJ='0`GV'Gb(FnHzwFFG(M4@M4@1v#2K(L#.jfsB ?)0*rsvl/#()/*/v #* %# b'5u Be@@ l$ b5` $0@ l?$ b53/$8@N] 7QN 8QN& $JN':NDY:N t N w N)$O) PR:@P S:@@P/\J @N '$PqHl(@P IlD@P L: @P M:@PN:@P O:0@P[ P:(@P Q:,@PT:@P_UJ$@P V<@P X@PYJ4@PS]ZJ@P[J@P']:@Pa ^7@P=`{8@Pb:,@Pc:@Q|2li-T7@<@ oh"intXI5Sf7l~t](l 'lSR(l1)l+(l)l*l+lG,:-l.l0zy.a%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>l14 %u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0 z  % % ) Sr Z ,3 8l J:s bs   #D # # #  #Y # #I # # #   PM Q# SY T# O R U ]O@ ^# _#9 `#2 a# b# d e#s f# g# h# i#. j# \ c kOY C D#A E# F# G# H#  I#/ J# K# L#j M# N#  V#$# W#( X#d Y#h Z#lx [#p l#t     7 #\ #k #` # , # # # # # 3 #$t #(| #,E #0 #4_ #6Z #8 #: #< #>e #@ #D #H #L& #P #RM #T #X #ZH #\ #` #d#  #h  #x ! # "# '#3 (# )# - #} .#Lb /#& 0# 1 #: 2# 3#. 4# 5# 6# 7# 8/ # 9#o :# ;#x <# =#E ># ?#d @#T A# B# C# D# E#! F? #   %  % ? /  ?  O  B C DA E   t ] _ C#I D#s# ?s# ] :: k  ] : :    z   : ]   ]  ; ] : & ` ] : A  ] : f  ]    ]     ] s:  ] s:  z& 8 _1 7 1 __ #io ] #r :# # ^ J#! l# :# p # #  P#$l :#( #, #0?* v#4n+ ̑#82 ͧ#<* #@^) #DG #Hq 3#L  #P J#Tc #Xc #\now #`O #d #O, # ] # #" 7# a f g p' - l > D5  p&O p Z V&O |& &O   ?   H  &e  e 7&e : !T7@7@*ffs&l7@K8@*05:*fs&H+z:+ JL8@ :@+8" ,!bufb+,M,"p,"arg,!len:|:,  :@:@,g!,[ :I-#g -f:-$S:@ B:@j;@-%bufC}&rD 7Pl;@;@-g!O."valQ:M.%sW@7;@<@`.V6.!cp8'6c ']7c'8c'DY:' :' :'/q- <@dS@ h"intXI5Lf7e~t](e 'eSR(e1)e+(e)e*e+eG,3-e.e0syo.Z%1id2#}{3#pid4#.5# 7#8z#>9z#:A#4l14 %u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0 8 ! "S#K ##  DIR & s   *    *5_t\#u# -@ F\s3Rs X_Y\#Z#>^#r_3# ?`3#\au#Mb{# $au_#I##3#  e#e#pu#u#Mu#u#  ge{ 3#3# 3#<u# cu#(_\#=#r3#K# I##3#43#/u# num3#$=f5 <@3<@.*Ke5oldg5.Hz34<@S<@.chy"/T<@<@@/5strl/toP/<@Y=@/=/K,0r3L0 43l0  !!\=@=@0 0 "t=@>@1</u:1uuX1Mu1[>@=>@1fprfZ1!l@>@>@1=k 2pmL2Mmj2"I>@>@}2#2$cp %e3>@>@22&m12&m22$s1$s2 8'<>@a?@2I:*3:S3/;r3new=u3 u#|d?@P@@3O kzu3Iz%4{Y4/{4 }4p~u51~u\5new~u5(?@?@)cmp3P@@@@5| cp~5s@@@@6 cpr?6*i +b)p,3 +ku+I++3++/)pub@@xD@]6` b6` 6cp7chF8tag8Z9p9 %:/u: 3 - @@%A@! . ( A@%A@/ ;0 . . . . . 1 &;2/( R; * xD@E@{; prf;  ;f ;<buf o3X   4S6E@nH@]< 4</4<5<5< 7k8uA=p8uj=cpp9= :>|;3>5aF@}pH@oI@?* |K?|k?|?3I~tp~@ '@pI@I@|@ =@I@p@m@  A3l3tp3K X52I@   I@J@aA=AIAp*BmnBBB "C,xN6sM+M)pO 3hJ@zK@KC=fwCIfCpfCmg4Dg3glDiD jD0@x.1D2X7W|K@8L@ EP=7EIbEpEmEe FPzFF F G!J<{@>I5@  3B{@x  3hG {@?D Y3  -dS@S@Th"intXf~t] + ,#>B-]# .3#o0M1#:2#d CdS@S@&P< B<RP etDP endD<P =S@S@P gg3{`{@Wv8@4 6@{@F 0-S@S@|7L@=Bo BS@YT@h"intXf~t]  #>B]# 3#oM#:#d S@CT@Q< <>Q etQ end<Q DT@YT@Q gg3{`@Wv@)@@ {B\T@V@,oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd% tz t K _ CS#I D^#]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:.:Vfs- ino-' J:$H ^ I'Q:$O ^ P'fs F fs S\T@T@Q)fsL *RDO%oldR)IR%T@RU@iRfs Rino'R ki:R :S!):"+T@T@#I#>"VT@T@#u#i$!4$'"U@#U@1#%|##"U@U@G#%U@V@@##KBV@?\@oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd% tz t K _ CS#I D^#]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:262Vfs5 )5H?2fs> )>HF 5:$3 42I%:fs$ blk$2'2V@4W@CTfs$ oT)$HT$2T4#% TH%:(U05%:TUn&:tU (:!b(:U!)2U")2tp!)*HU#+iV@oV@?$I$>%VC$t$i&SS4W@\@VfsQ >V)QHtV4#R V! TSV"xU2tP!U27W!U2cW!ZU2W'blkU2X!)VH2X'jW:X!W:X!bW:X#+@W@TW@Y$I$>(VZ$t$i)02 z:%VP$t$i*+W@W@@$I$>#GX@UX@P$$+qX@X@,grH-qX@X@$$)h :%V$t$i*+X@X@@$I$>) :%V$t$i*+cY@iY@@$I$>#Y@Y@,$$+Y@Z@^,grH-Y@Y@$$#[@[@|$$.3[@h[@,grH-3[@B[@$$/S\@?\@Xfs Y! SLY'iHuYSMB@\@a@xoh"intXf~t]y8V Ctd p p _:# num:# 05:# _# =:#q  qC _:# bbC# ptr:#s,tt  ptrk pk M05m ptrk ppk m05m ptrk pk ITm05m ptrk:@\@\@YbbCYblktYlow: Z:UZmid:~Z:\@\@ZbbCblkt%:\@\@Z#bb͘blk͂:\@4]@ [zbbC6[blktl[:[i:[\4]@=]@[bbCblkt:@]@]@[ N+\blk_bb CJ\Y:]@]@s\9 blkYwE:]@]@\fbbDC2:]@^@\bb11C\bb21CP]?:^@ ^@o]bb1>bb2>W#^@1^@]2 "N]e,^@1^@(x ,^@1^@,4^@=^@]\ +@^@^@^bbCJ^ret! N ^"#N^@^@^bbretl^@_@^bbkC$_blkkt_ m_in:`jn:`!om"v# $`v_@_@abbblk%?"_@`@>a&05 :janum :a& _aret!'bb#C $a(@&#X(p-3',`@I`@ <`@I`@$'b)e`@!`@/x `@!`@C/P`@`@SbBsrcOCb&hOb Qb\`@`@b|srcZ*h[|G`@`@*cretF|*05F:+@?`@a@Vcret>*05>: Ba@d@Roh"intXf~t](V0dy%) HrO,38VJ:s b]GsA v#D###  #Y ##Iv###    P M Q# S YT#ORU ]2 @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck2Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t    7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F"#   %  % ?   "  2 B CDA EGdz%  t a _ Ci#I Dt#]# ?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* 8_5 ; 1_ _i#ioa #r:# # ^e#!V#:# S#ƃ# k#$l :#(  #,#0?*ˑ#4n+̬#82#<*#@^)#DG  #HqN#L Ա#Pe#Tc#Xcױ#\nowx#`O #dv#O,#a #6#"R#a f g  p+1 qBHlY_5i* 2=qi* 2i* i* 2?  H  i0* H0HR* H:< ! "7#s#:#Q$#M%:# &:#\':#(#err)i#Mi 05ptrvppvC:8$AB= :a@a@cfs* c>ы5^+=: vc!rec" iKd#blk=d$ )% ka@za@&+&Xi<05ptrvpv:a@b@dfs* d >e5^+=: vge!rec' i'(&%&& )*1ei;T05ptrv++,ieptrvpv-:ib@d@efs9* e 9 8f" ;ipf.rec e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F"#   %  % ?   "  2 B CDA EGdz% ta _Ci#IDt#]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* 8_5 ; 1_ _i#ioa #r:# # ^N#!V#:# S#ƃ# T#$l :#(  #,#0?*z#4n+̕#82ͫ#<*#@^)#DG  #Hq7#L Ա#PN#Tc#Xcױ#\nowx#`O #dv#O,#a ##";#a f g  p+1 lBH5it* 2t=Zi* 2i* i* 2?  H i* HH;* H:% 6 S!7H# @8H# mV9# t:#=G,;fs* #Dd#v^#U:#r:#Z i#!#"# ##$$v#(:d* t^=:v; D# {v#:* t:vMi05ptrvppvi3T05ptrvi]ptrvpv :d@d@f!fs* "t"5^"+=":"vxlj#=:d@g@(g$(;tTg$+;=sg$<:g%ctx<g&ret>:h'8>:Ih&i?:h'r?:h'}?:i'H?:Ti'>@ti#:g@`i@ik$kti$+=j$:"j%ctxAj&ret:j'8:j&i:k'r:ak'}:k'H:k'>tl(:)-t)+=):*ctxإ+ret:,8:+i:,r:,}:,H:,>t-1i`i@q@-lQ.fs&* Yl.ino'2yl/r(:l/)l/D/d-m/0vem0i2:m0r3:m0ret3:&n1^ 4~2 5in3ctx62}7:o4pk@4b=o@4ik@5j@Sj@RO6667-j@Sj@668?j@Sj@982"jo1 kAD25l^p0blkm=p2Zm=q0opn:{qjoV:kp+6666|;<q<%r<r<s<5s<s<s73Wo@jo@6F8Wo@jo@R=iq@q@[t!fs * !ino 2"r :"  "D"v3xljprsBq@w@uoh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^#!V#:# H#ƃ# #$l :#(  #, #0?*B#4n+]#82s#<*ϙ#@^)љ#DG  #Hqӥ#L Ա#P#Tc֥#Xcױ#\nowx#`O ܫ#dv#O,#K #B#"^# a f g  p pn_ :#num :#05 :# d# = :# ino'#blk2#5:#l5_ $:#fs % #05 &'#T ''# $ (:# )j#S< '<2"S] 'HSs cS 'y?  {H H Bv# C2#+ D:# E:#  F:#N G#S< =<="^ =:Hn Gino K'#^ L#p262fs5 )5HW:q@$r@ta:tb:t$:$r@ur@t<fs# &u#:FuC:xr@%t@fuKfs= u)>Hu?<u@<u:A<*vKBKVv D2td!D2v!D2v!>D2v"OEV"EV!PF2w!F2!w!G:Aw#r@r@I$$:%6(t@Nt@awfs w&sbP'S(fs ))H)2)a"nH'S6(fs )^"Z6"6"0:" :"05:" SSPt@lw@wfs w*iH&x! S{x"݃ ޱtH"a!3y"}!:Sy+Nu@+igxu@,f-%2y-%2y->%2y-O&:z.v@v@,$$$$/v@v@01`$$2(003 "z000*4sSlw@w@Yz5fsr z- tSz,Bw@]z@h"intXf~t](O0]y) ArH,,8OJ3s bV ^#D###  #Y ##I^###n n  P M Q# S YT# ORqU ] @^# _# 9 `# 2a# b# d~ e# sf# g# h# i# . j# \ckY C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l~#t n  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F# n no n? n n! nB CDA E]d tz t K _ CS#I D^#V# ?V#S K |3od3SY S K |3 d3S  ] n S ^3 K  S K  S) K 3 SN K |3o/ Ss K |3 T S K ^^y S K    S K V3o S K V3  ] n8_ % 1_ _S#ioK #r3# !# ^8#!O#3# H#|# >#$l 3#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ԥ#P8#Tc#Xcפ#\nowq#`O #do#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '? nH S ==% =3~3W$| ^ }' w@|x@{fs ={)Hq{crc!{">{ X!H'3"N|x@x@{fsM |#)MH$WI%$U %dV%VH&iX'!X'!X''(d)fs *sgSx@z@.|]fsf Z|+sbh8t`bgi>z|j3|ikH|,pK!u3!v3!w3-~./|. 0(11|0<2+Yy@ey@^/J}/>0}-I.X3+C3z@]z@D}fsB p}#)BHJIB`z@|@H!oh"intXf~t](V0dy%) HrO,38VJ:s b]GsA v#D###  #Y ##Iv###    P M Q# S YT#ORU ]2 @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck2Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t    7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F"#   %  % ?   "  2 B CDA EGdz% ta _Ci#IDt#]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* 8_5 ; 1_ _i#ioa #r:# # ^N#!V#:# S#ƃ# T#$l :#(  #,#0?*z#4n+̕#82ͫ#<*#@^)#DG  #Hq7#L Ա#PN#Tc#Xcױ#\nowx#`O #dv#O,#a ##";#a f g  p+1 lBH5it* 2t=Zi* 2i* i* 2?  H i* HH;* H:%e x:#:#erri#wRi`z@Y{@}fsQ* }dirQ2+~ Si~esTA`^ U~Mi05 ptrv!ppvi? ptrv!pv"U!:\{@|@~Gfs* #t;#5^$+=$:$ v%es"GZ#=3%k &i&{@|@F'(({@|@)4*:5''+) $=@Ax w"B|@?@"oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' { %7 { !|""# ###z!$#u#%#" ,#-# .#A#0#/!1# " 7 9!8#) 9#L#:#w ;# <#7|B CDA Edc % s y  t J _ CR #I D] #]# ?]#R J :vk:R X R J : k:R   d { R ] : J  R J  R ( J : R M J :v. R r J : S R J ] ] x R J    R J ]:v R J ]:  d {8_ $ 1__R #ioJ #r:# # ^#!V#:# G #ƃ# #$l :#( #,#0?*A#4n+\#82r#<*Ϙ#@^)ј#DG  #HqӤ#L Ա#P#Tc#Xcױ#\nowx#`O #dv#O,9#J #_#"{#a fg p pm_ :#num :#05 :# # = :# ino& #blk1 #5:#l5_ $:#fs % #05 && #T '& # $ (:# )#R ; & ;1 !R \ & GR r bR  & x?L! #" #" # '#TH" #t/" #x #|# #! #! 9#a! # #~# #I 9# !# "#S# ##! $## %9#  {H 9H Bv# C1 #+ D:# E:#  F:#N G3#R Y < Y< ?{ < :e 6 S!7< # @8< # mV9# t:#=G =Z_4R #fs5 #ino6& #^ 7# g8:#!9:#!::#}{;#!0f X"g:# #h:# Ci:# n!j:# !k:# c#l:# m< # "n< # !o#( p#,m G3ino K& #^ L#  I {$'buf(#, ):#n!*:# +:# #,:#r-:#'!.< #r"/v# IMR 05ptrvppv.:.fs- ino-& R XptrvpvR |@|@ ptrv!05:9"L#:R#":$eh %!`R |@}@Y&"^&`_ҁ'}{atlZ(k R }@~@a&"blk< ' R P)ix <% R ~@~@O&"{*r:& +}{ix ex %"R ~@@&" &r :3&  ,}{߃,)eh s)ix ex , R )blk1 ''!< PR+ :)op:- ). //0 1%4 #R @@&""J&r":,}{$cp%)eh& , 'R 2@ @|ix< 00 ' FX(!VR @@i &"T&!U:3blkU< ӈ' WT, XR 4c"@%!R @@I*"3blk< *("R @@O&"{' :P,< ,}{ي' T4·@(R @6@ &"9, R ,L!1 ,9"< O,B!< ,"< , :,2' L,}{{,ώ)eh H,o# ,k":ۏ,# :$'`!Z4@5.@@/A6@@7M5K@l@`>//6a@l@72‰@@,)G m,&"8‰@Ӊ@/!/6@-@,"%R 8@]@ݐ7&" &r:V& ,}{)ix eh , R 4i6@%"#SR `@@~&"Qڒ&9#R< &R< :&rR:z)ecTR ʓ, TR ,Z!U:P, V:,#W:, X:,!Y:,B!Z< +}{[' \P' ]'`^Z4M@4?@6ܒ@i@+ 9X  @@4Y!"`:i:;.>@a@/A6>@a@"u#"? R Z?*::i::eh 4iؕ@@H //0` 7;Z@w@G//6c@w@10=@A@//61@A@1\=$$B@@@(oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^!#!V#:# H#ƃ# '#$l :#(  #, #0?*M#4n+h#82~#<*Ϥ#@^)Ѥ#DG  #HqӰ#L Ա#P!#Tcְ#Xcױ#\nowx#`O ܶ#dv#O,'#K #M#"i# a f g  p pn_ :#num :#05 :# o# = :#s ino'#blk2#5:#l5!_ $:#fs % #05 &'#T ''# $ (:# )u#SG 'G2-Sh 'SS~ nS '?  {H 'H Bv# C2#+ D:# E:#  F:#N G#SG =G=-i =:Sy Gino K'#^ L#{Sptrvpv"$d@@@|Lqcc@@i' c@@!tx"@@n @@##P@@$bbOn!ח@@U ח@@!tx"@ @W @ @##[@@c%bbZ & $A&'O,@'()#()#))#*#@@$fs u@@"t u@@!tt@@$ @@!ttØ@@& Ø@@!tt@ @( @ @!ttg@Й@6x@@E8 x@@!tt@@Gc @@!tt"ę@Й@I ę@Й@#"֙@@: ֙@@#B&5$B@ @*oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd% tz t K _ CS#I D^#]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^#!V#:# H#ƃ# #$l :#( Ƀ#,ʎ#0?*#4n+#82$#<*J#@^)J#DG ҙ#HqӰ#L Ա#P#TcV#Xcױ#\nowx#`O \#dv#O,r#K ##"#%e  <e_S#fs  #!#end!# -&"#$##$$#&'%S#O &\# a f g  p l5S '2S 'S$ SD 'D*?P l {H lS ==x =:D&a#  {cMS05ptrvppvSEptrvpv}&:xnrV qӻ !v&:"%:S@ @#$9 )$(% @@G%$ $c%@#@s%$ $`$S$@]@d#$σ˚#_S&neqS'end'N#n'dn'%:nrV qv!v&:(N&"`@@)map! ƛ*i#*j#+j@@),,|-@@./$AnrV qv!?&AH(%k@"@50$ia0j2)numj:*il:+@@t,*1 -@@25/%nrV qv!?&A($]$@@+0$[W0\2)num\:۝*i^:+W@k@f,1-W@k@23 &?S@@!04#; M0_<Sx0=Ş)num=4in>v3s'0S@C@_04#, 00_-S[0.)num.ǟ4out/v5 'D@w@#$ &:nrV qv!v&:S05ptrvpv$%Sx@@>#_Sj#&ޱ#)&ޱ#4# k! S605k6&k6&ݡ7x ,,,8 .Y9@@P@,,-@@P@.$&FS@ @#_BSϢ'fsB (#C`'endC#-&CУ#p&D^#6&Dd&retE!$G 6 HS605Ik7 K,,8 27 `,,8 .:!@2@b,.-!@2@2:7 jE,,8( . :r@@lq,.-r@@.:99@@m,.-@@2: $6'S @3@M&src %h$$~S4@Y@y:%y&endz%-&{%p&|^ &ret}5%/\@@#$- ѥ#.:&arg.$&:@@=#$ i#&29Eҟ@@,a1W-ҟ@@.l$k:$ij23&L:@]@0$JJ0K2)numK:*iM:4+@#@U, ,$H%:`@@R#$ ~#&9j@@,1|-@@.$Q':@@k#$ G#&2}9Ԡ@@,1-Ԡ@@.Ʃ5$@b@#$: @ @,.- @ @;:tx:1@G@,.-1@G@;:tx9Q@]@,.-Q@]@2:<B$ Sd@ @;0_Sg4neqS)bm1  )bm2  *i 2O=ܡ@@, ,+@@, ,)'B @@-oh"intXf~t]SR(V1)V+(V)V*V+VG,:-V.V0dy%u4`a#Rb#c#d# ek#fv#g#|i#"k# l#$]m#(n#,o#08V Cd %'A ': @K@x* fd: Hͫ ch%s'L@@   !:1'fd:rc:۬':']05low&out#$@@  stD@@mid H D Y:*'B@@?/oh"intXf~t]yd%'(u@@` ' (' fd):: DY:w+:(B@N@/oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:D(S@|@ʭfs ^ !f=cb]t`(1S|@@fs/ ^ /9f0={b2]t`*(BS@N@fsA &^ AEbA=,r(BP@å@/1oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:[(0SP@{@sfs/ blk/2buf/v~(S|@å@Wfs blk2bufv SűW.(Bĥ@@l2oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:%QVSaPVbPVMS05ptrvppvfs (CVfsB sbD8 bpgE!FV!(G!tH! IV""S.ptrvpvSoT05ptrv##$~ fs  F fs %(_Sĥ@@ر&I\^&r\:T& ]8&4^i̲'(^ fs` ( aS!^b8!(c: remdV((eVH)ipgfV)igH(Ph2&((i:D({j:b((k:)bufl cm%*2̭@+ )+)),SX r-r-f.p $~/S@@7-r-f0@@1~ʹ/S@Ѧ@d-r-f0Ʀ@Ѧ@$~20@\@}!*:/&@*@ؖ-/+U@g@޸-H3>/+@#@-H->4 3P-. 115$1^$$/+Ŭ@լ@P8-H->5+ Q-H->6ST@@f~-r-f0t@@$~6Q@\@v-0Q@\@$#6.e@@x-Y-M3A7S}@@-r-f0@@1~7@@- K!1#B@m@|5oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  M #   Y#~-  @# # 9 # 2# #  # s# # # # . # -*r s# A t# u# v# w# x# / y# z# {# j |# }#  #$ ##( #d #h #l x#p #t *# +# 1)# +# *# F+# ")# `,#  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d # #h   #x ! # "# '# 3(# )# - # }.# Lb/# & 0# 1 # : 2# 3# . 4# 5# 6# 7# 8 # 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F # { % { % {? { { { % {B CDA Ed? %O U  t& _C. #ID9 #]#?]#. b & :vk:. 4 . & : k:.  h d { . 9 : &  . &  . & : . )& :v . N& : /. n& 9 9 T. &  t. & ]:v. & ]:  d {8_1__. #io& #r:# # ^#!V#:# # #ƃ# #$l :#( #,#0?*(#4n+C#82Y#<*#@^)#DG #HqӋ#L Ա#P#Tc֩#Xcױ#\nowx#`O ܯ#dv#O, #& #F#"b#a fg p pI_ :#num :#05 :# # = :# w ino #blk #5:#l5_ $:#fs %#05 & #T ' # $ (:# )#. " " . C .. YI. y y_?L֩! #"  #"  #  #TH" #t/" #x  #|#  #! #! #a! # #~# #I # !# "#S# ##! $## %#  {H  H Bv# C #+ D:# E:#  F:#N G#. @ @ &b :L)tz/+`_ . #fs!#)" #+# # *$# #,% #[+& #+'# #,( # ))#$ *:#(ptr+#,*,:#0)-#4)1#8+2v#<",3:#@L)4:#DO 5#HT Gino K #^ L#  {. h# v : {M. H05ptrvppv. rptrvpv. T05ptrv <!m,<. @@"fs;#i=:>$ *@@Q1%)h}&)&+v!?): @K@%)hȶ&V,:%+:':(~+. L@ϰ@$%)hP#fsn)+. а@@*)h*):+)J. 8)Ih,fK , L. +). z)hf"blk bbI)j). @@\-)h.ino\-^ y1**: / . ]/*:0)@1 23 44+S180 e2V2J3H 4b|4n )*. @@ѹ*)h.ino\*^ y(H,J. @ƴ@"fsI)' K. s5` O202$3x 4<5 T9202$3 4<Ӻ6H @@Ve2[7 @@4g5H b2[3 4g6rj@@]2228j@@202$7w@@4<39H@@a:[_7@@4g})J*t. ȴ@@;fsrɻ;inor -^ syE-*s:,)u,u/>u/Hu8/ v. w<+w~/z*w=ptrx/y:C=iy:w/WZy:0i~@)k*. @@!;fsM;ino m-^ ybufy/05:,O+/ . &=tO)W). @;@o.fs.ino *^ y)) . <@Q@;fs ;ino  -^  y6-* :,) , /> /H &=ptrp/ . /:=i:F,+:/WZ:=io& )*m. T@o@F.fsk.inok *^ ly)g++. p@@(;fs*T;ino* <^ ,~/ -. )+. @@| ;fs;ino -#("P<^ ~=i:/ . $0,@@%)h=6H@˾@s2[7@˾@>gtx6HҾ@@2[7Ҿ@@>gtx9H@@2[7@@ g! *k. @m@H!"fsi%,i:&b*jH!?)lh' m. ':*n({5 Y 202$3 <5r  2228D@]@202$7P@]@4<6H@.@ 2[7@.@ g58  202$3P 4<6H@@#!2[7@@4g9H@@2[7@@ ghC4,Bp@@:oh"intXf~t](Vy%d% t _C# ID# ]# ?]#   x : v k :    x :  k :  d  ' : '  C 3 ^  :I   x : vd   x :       8   ] : v 3  ] : dI,=p@@4;1H;xgT<:4<,I@W@N4GzG]TH:4Hv,YX@@W4WW]TX:H4Xh,@@4"  Maptrl0argK5C-B@W@;oh"intXI5Sf7l~t](l 'lSR(l1)l+(l)l*l+lG,:-l.l0zy.a%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>l14 %u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0  z  % &-:fbuf cp:--ret: %-#@@@g!!f!5-" -": -$ %fd&:h ( wQ :,Q@@W@zPfP6V-BX@@k<h"intXf~t]yo':_-{rX@@fdz3Hzr O-z3 DY3[7-B@J@=oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {-r ^ # <# -# Ir# % {B CDA Ed% t _C#ID#]#?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {8_z  1_C_#io #r:# # ^“#!V#:# ţ#ƃ# Ǚ#$l :#( O#,Z#0?*˿#4n+#82#<*#@^)#DG e#Hq|#L Ա#PՓ#Tc"#Xcױ#\nowx#`O (#dv#O,># #d#"#Ia fCgC ppv l5o o o o ? 8 {H 8^o ^Do :jm-I#len:#^ #e:# {-3@@Qdfs1o }dir1I1-2:buf2^ 2? 4_ls5h-$:@J@}8H :!!: buf" #v!ls%'=9-BL@{@J>oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:SUptrvpv-#SL@{@-fs! Y!'Z!'I"^ $SZ -%~ ^ %}!ino&'3 -''d!blk(2S )td"2@#+@@$>%@@&J:b/B|@@?oh"intXf~t](VSR(V1)V+(V)V*V+VG,:-V.V0dy%%u4`a#Rb#c#d# ex#f#g#|i#"k# l#$]m#(n#,o#0 ) HrO,38VJ:s b]GsA #D###  #Y ##I###   P M Q# S YT#ORU ]X @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ckXY C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t     7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h   #x ! # "# '# 3(# )# -# }.# Lb/# & 0# 1( # : 2# 3# . 4# 5# 6# 7# 88 # 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !FH #   %  %( ? 8  H  X B CDA EG d %    t  _ C #I D #]# ?]#  :vk:    : k:   d   .  :.    J  :  e  :P   :vk   :          ?     ]:v  :  ]:  dP 8_[ a 1_$_ #io #r:# # ^t#!V#:# y ## z#$l :#( 0#,;#0?*ˠ#4n+̻#82#<*#@^)#DG F#Hq]#L #Pt#Tc#Xc#\now#`O  #dv#O,# #E#"a#*a f$g$ pQW lhn5  P X c  P X  P  P X ?  H  ?P n ?n %aP n :K. d. #! # w. #?/ #W. #- #. # H #$ #( #,# #0/ #@0. #D!/ #HG/ #L / Ц#P. Ӷ#. i:! j#3/ k#. l#. md  + n/ g/Af:#:#.c #.c # .:#buf#err͏ #M x05ptrvppv ptrvpvI%:fs$P blk$c fsP ;.y:|@@!#(x"- @ @#fsP #blkc #num:R$~$X/%j:&T:&  'buf@:(h.: @q@;]#fsP g$њ$5҄ )+c ):$vh*es]&Zc & ُ "// t@@.#fs,P Z$05-$r-:).. & 0 #*jsb1+A 6,`,T- .l//^ 0fs\P 1K\105]c 1r]:2 _ *buf`*fda:2.a:*ibc 3i44.5. AfsP /X 05c r:buf6)y 6y endy iy 6&"y 6  6^ es7in8844. . @@LS9fsP x!05c !r::  :/X W;sti@? ,,,,-0 @@...@!. A~A"HB-@Cz@@8,,?x o,- .Dy@@l,? @,3,(,,- .>@I`@T.^@iBr@+x,-0.EP, %d / @@9fsP &!P j;st:  ;bufSwjsb6:=i6/Eh,FD Y:q>0B@d@*Coh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {-r ^ # <# -# Ir# % {B CDA Ed% t _C#ID#]#?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {8_z  1_C_#io #r:# # ^“#!V#:# ţ#ƃ# Ǚ#$l :#( O#,Z#0?*˿#4n+#82#<*#@^)#DG e#Hq|#L Ա#PՓ#Tc"#Xcױ#\nowx#`O (#dv#O,># #d#"#Ia fCgC ppv l5o o o o ? 8 {H 8^o ^Do :jM05ptrvppv0@d@xfso ?/ / x !dir~"  #buf!"<": $0#:%'&&'('`@`0Bd@i@Doh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' { %7 {B CDA Edt% t[ _Cc#IDn#]#?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {8_/ 5 1_ _c#io[ #r:# # ^H#!V#:# X#ƃ# N#$l :#( #,#0?*t#4n+̏#82ͥ#<*#@^)#DG #Hq1#L Ա#PH#Tc#Xcױ#\nowx#`O #dv#O,#[ #7#"S# a f g  p%+ l<B5cn$ 7nBTc$ 7zc$ c$ 7?L! #" #" # '#TH" #t/" #x #|# #! #! Y#a! # #~# #I Y# !# "#S# ##! $## %Y#  {H  c1$ M1MS$ M:= i {Mc05ptrvppv26Bfs5$ )5X%QVaPVbPVc4T05ptrv Ofs$ !M0Wcd@@"fsV$ J#90V i!0ac@@"fs`$ #0`[ !0ic@@ "fsh$ L#0h[ k$0!B@@%fs $ & B&%i Xj'bg":(#:)$:*T@]@-++$@0Tc@F@Z&IPn&i0Pn$&rQ:&/Q:&XRVD&4Ry,(SZ'fsU$ ) Vcb-iW%)x Xt((0Y:(r Y:)(Y:)ZB-blkZB6)h[I'cp[.2I@/ic++|01i@ @m++|2@ @3}1i@@8++|2@@31iE@u@i++|2Q@u@31i@@++|2@@3 4+5E6@1@++67@k@*+++7iL@k@++|2Z@k@3c2@5@8gd<N741@5@C+C$ 9t0@cH@i@,I=n,r=:,/=:,X>V ,4>y,(?ZeLC0Bl@@/Goh"intXf~t](V0dy%) HrO,38VJ:s b]GsA v#D###  #Y ##Iv###    P M Q# S YT#ORU ]2 @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck2Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t    7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F"#   %  % ?   "  2 B CDA EGdz% ta _Ci#IDt#]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* 8_5 ; 1_ _i#ioa #r:# # ^N#!V#:# S#ƃ# T#$l :#(  #,#0?*z#4n+̕#82ͫ#<*#@^)#DG  #Hq7#L Ա#PN#Tc#Xcױ#\nowx#`O #dv#O,#a ##";#a f g  p+1 lBH5it* 2t=Zi* 2i* i* 2?  H i* HH;* H:%0j #erri#0Ail@C@fs@* @S BisrbCAh^ D~PE= 0-:D@@bfs(* >(t? 5)^ +*= +:,vw!rb.bADN1B@@Hoh"intXI5Sf7l~t](l 'l0zy.a%1Jid2#}{3J#pid4#.5# 7#8#>9#:H#4<#A=P#! % HO>l14V) SrZ,38lJ:s bs  G #D # # w#  w#Y w# w#I G# w# w# W W  PsM Q# SY T# O RZ Us ]@ ^w# _w#9 `w#2 aw# b# dg el#s fl# gw# hw# iw#. j# \ c kY C Dw#A Ew# F# G# H#  I#/ J# Kw# Lw#j M# N#  V#$# W#( X#d Y#h Z#lx [#p lg#t  W  7 #\ #k #` # , # # # # # 3 #$t #(| #,E #0 w#4_ #6Z w#8 w#: w#< w#>e #@ #D #H #L& w#P w#RM #T w#X w#ZH #\ #` #d# #h #x !# "# 'l#3 (l# )w# -#} .#Lb /#& 0# 1#: 2l# 3l#. 4w# 5# 6# 7# 8# 9#o :# ;#x <w# =w#E ># ?w#d @w#T A# B# Cl# Dl# Ew#! F# l W % W % W?  W  W  W B C DA E z @ % P V t ' _ C/ #I D: #s# ?s#/ c ' ::/ 5 / ' : :/   i z W / : : '  / '  /  ' :  / * ' :  / O ' : 0 / o ' : : U / '   u / ' s:  / ' s:  z W8 _  1 __ / #io ' #r :# J# ^ #! l# :# $ # Ƥ#  #$l :#( #, #0?* @#4n+ [#82 q#<* ϗ#@^) ї#DG #Hq #L  ԍ#P #Tc ֣#Xc ׍#\now ؙ#`O ܩ#d #O, # ' # #" # a f g p  l  5  / :  :   / [  F/ q a/     w?   WH  /       :  @1L"11M3#3  "%1S@@fsP blkP 91QJRstT 1'/ @@, fs % f ,E!2q" 11&S! (/ !1) "buf+Y~ a S  J 8 %i W#]1b/ @@fs_ f_,`211a3 "stctFy1B@R@Joh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:MSb05ptrvppvST05ptrvV1V fs !1!12!2"min#1:"retVVS1ptrvpv$1>S@R@F%fs= r& ?S&1?S'sb@8t~(^ A~&1B#q1B)apbC]& C]9&1D2a&1D2&2D2&)2D2&1E:4&1E:c*62@*1S@*1;@+bK,,,u-+0@N@,J,>.A@N@V/@ @ػ,.@ @&0q&1}V&12}V&2}V)grp~VD#1~V&2:+0[,,,,1P22T1p&121#.^2c-I3BT@@Koh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' { %7 {B CDA Edt%  t [ _ Cc#I Dn#]# ?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {8_/ 5 1_ _c#io[ #r:# # ^H#!V#:# X#ƃ# N#$l :#( #,#0?*t#4n+̏#82ͥ#<*#@^)#DG #Hq1#L Ա#PH#Tc#Xcױ#\nowx#`O #dv#O,#[ #7#"S# a f g  p%+ l<B5cn$ 7nBTc$ 7zc$ c$ 7?L! #" #" # '#TH" #t/" #x #|# #! #! #a! # #~# #I # !# "#S# ##! $## %#  {H  c1$ M1MS$ M:=D&sas#  {c  {Mc05ptrvppv%:nrV qv!v&:c'ptrvpv"2cT@@#fs$ $.3:$3:0%i XO%j!V&3":&3":! 3#V& $c&%&L3%!{&:%blk'B'2(Bt`&2)7t(2dP@(y3bJ@(?2yu@)@@7d**+@@,)@@?**+@@,-*.,)@@Y**+@@/0@@*+@@,73:&fs$ 2:Efs$ 12Pc@T@2fsO$ 3.3Q:C33R:l1V3CcT@g@4fsB$ 12>ch@{@4fs=$ "3c|@f@#fs$ $.3:c$3:%iX&b2&{2B%buf& c&3:a&3:!{:&p3: %cntV-%blkB'2BtD&&3Bd&27&27 52!h@52.@-L**.,6/m*. ,7b@x@#*+b@x@/^7@@+*+@@,7@@-*+@@,-@*8~.X,)k@v@=*+k@v@,)@@n*8+@@,7)@?@'*+)@?@/6p*.,95@C@*+5@C@,13Hch@@2fsG$ 1V29c@@H=4fs8$ :o24c@@t4fs3$ S.L3B@k@Ooh"intXf~t](Vy%y4>B?#64@k#Hy4A4 3 %) HrO,38VJ:s b]   7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !.# "# '# 3(# )# -# }.# Lb/# & 0# 1># : 2# 3# . 4# 5# 6# 7# 8N# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F^#%.%>?N^nd'A tf_Cn#ID#]#?]#nfx:vk:ntnfx:k:nd n : fn)fnDf:/nifx:vJnfx:onfnfnf]:vn f]:d/ 4 : _;:#tdb< #c=#g5@f# '5B:#5C:#HFy#Mn 05xptrvppv4mn@@ 4l 4Ln@@ 4EfFxTG:4Hv 05Ik4J:=>Kn4n@G@ 4f$4:4 q n/ (4nH@@o 4fx<T:bufv n:4 c3n@@ 4f n4 # 5"n@@LK 4 fx5 arg! #nL4$ tmp%xend& @5n !tdb "X:# n#4#4$4n@@d %4f%x%T:&05:'sz:>&4xQ#l5x& n}&Hy&4 (4ɴt(4ɴt#5ʮ&5x) |@@ * * +@@, -K (.g .\ /,r 0} t0 t3n@@A4fmHx05:buf4  n.Zym1t5x1Tx5n@@4fxT:2buf4  na4vn @B@ 45u F4n"4f!tdb # n#^ #4#4#4 #4f#X:2nptrvpv55nD@@?  4fk 4  n 34.P *E/,[0fw0qtw4|8 ,4 4 5@),@I@*+,@I@4 )S@s@*+S@s@4 6s@@*+s@@,7Q5R'4Qf4Wn@k@ IV0 rV:4V ioXf4Y h  Zn 82@3 (^* * /@, ) @@c* * +@@, 3 Xh'* * /p4  ) @@A*)@ @j*+@ @,6 @+@*+ @+@,(3V@(4d@(ce@(5f:@H(<4hw@H(3id@H&(|5j@9D Y::c`@q+Of6Bl@@Roh"intXf~t](V}6"dSR(V1)V+(V)V*V+VG,:-V.V0dy%%u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0 d %'A t_C#ID##4:#r5:#O 6D# 47#X 8#\k d <:#O =:#>]#?]#   : k :  7  : 7 k : =  dT n  : nT  z   :   :    : 7     *  * U  ] : 6 z  ] : 7[d6@bufA#B#5C:#DV# aEV# 5LY_M:#devN:#rO:#5P:# HQ#NRY#k S#iptrpM05ptrpp6l@@3 #4_ Z*   4# 5S@E@ 4P#K Q] p6R NT)6Ttp6TGiU:p6H@T@p44#]T:@buf7`05vZ4: 95@5T@@x4}4~#[6:N 41tpi:]87@@{I 44#  7p@e@1 4n]4n#Noo]7h@@!` 4M]mT:!buf74#3NSw6q cp56:6@@) "4U"T:#buf7 B6@@j 44#]T:Bbufb 05vZ4:l$5Z@6E@@2 4CC]TD:a!bufD4F#NGw6G2 X HFcpIiJ:jJ:B 6@@  "45"T:#buf  6@@e 45!arg.4#rtmp]end6@@ 4Ho05:!buf74# @4v *6:@x@49#N;i<:%iG@e@E&|'G@e@(ttO6&x@@ 4$94%#b 'N(i):%@@1&&'@@(tp'7,@Q@4+4+:u4-# . 6T@(@A 4m 4#   )i@@$&|'@@*!)i@@&&|'@@*7!%i@ @'&|'@ @+ 7(@@W!DI!r:!"4nio,4# !s:G"st2m@-&&.+-&&.+)@@&&'@@*Z")iQ@]@ &|'Q@]@+%ix@@ &|'x@@+/C7s@@0D Y:1 @fQiB@{ @0Voh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd% tz t K _ CS#I D^#]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:8_S$] ^28e{$c d27x$v ^ w'$k:$i j27@@"fs "D  old " 7:V$ 2num: h7S@@"!fs #"2=#"2i#!num:#!map ?$#ret^$b2$%X@a@&I&=&1'E8":@@$!fs  $!map ,%")!HK%$i#:%$blk$2%($2%($2%(>$2%(%:%)SG@V@E&n&b%+@@C&F&: W7S@@&P!fs /&".2O&!map &#ret^ $i2'%L@V@&&MS05ptrv*ppvSptrv*pv 7S@ @5'!fs a'".2'"(#ret^ ( SO((2($buf(+i8$ @,Pe&o&c-.{/}0new=X%+ @9 @&1+ @9 @.2n8P:3fsN 3mapN 4)OH5iQ:5inoR'6~:$| ^ }'7X:A$V ^ W' X8jS @{ @)c!fsg <)!dirg'\)7h:!mapi )#retic8;8k'$il')(7m'))V @ @*9)&&1V @ @:).%{ @ @[9*&) @ @H&&% @ @&4&('GT8B| @g @Xoh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd% tz t K _ CS#I D^#]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^8#!V#:# H#ƃ# >#$l :#(  #, #0?*d#4n+#82͕#<*ϻ#@^)ѻ#DG  #Hq!#L Ա#P8#Tc#Xcױ#\nowx#`O #dv#O,#K # #"%# a f g  p l,25S^ '^2DS 'jS S '?  {H S ==% =:F 5:W$3 428.:| @g @@*fs+ l*),H*4#- */2+/20+>/2P+j0:d+0:w+ f0:t`!+ @ @C"J">!+ @& @G/"J">#+4 @H @<"J"> hV3Bh @@Zoh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {B CDA Edd%tz tK _CS#ID^#]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {8_ % 1_ _S#ioK #r:# # ^C#!V#:# H#ƃ# I#$l :#(  #, #0?*o#4n+̊#82͠#<*#@^)#DG #Hq,#L Ա#PC#Tc#Xcױ#\nowx#`O #dv#O,#K ##"0#%e  a f g  p & l7=5Si 'i2OS 'uS S '?  {H S ==0 =::Sh @ @+4# 2numVoutv 9S @ @+4# 'numVoutv 8S @ @+74# 2numVinv 69S @ @$,4# 'numVinv +:S @ @P,bm1 bm2 9S @% @|,bm1 bm2 8S( @C @,H&~)&~4# n9ySD @_ @,&w)&w4#x G:s` @i @-$r 9nl @u @,-$m 9fSx @ @X-($d ende2n'eiz:\S @ @-p$Z end['n'[p':IS @@-fsF -p&G^retHJ.endJ -&J 86S@V@1.Rfs3 ].p&4^ret5R 7end7 -&7 T9/X@a@.map. 9*Sd@m@.src( h) a:$p@y@.$# !9|@@ /$ X:B@@[oh"intXf~t]yd%:G@@8/ ZEu argEk $Fd/X:B@@[h"intXf~t]yrH:O:<v@@/crc;v/H;/len;O0cp=   A k :  @ bY/;B@@a\oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {-r ^ # <# -# Ir# % {B CDA Ed% t _C#ID#]#?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {8_z  1_C_#io #r:# # ^“#!V#:# ţ#ƃ# Ǚ#$l :#( O#,Z#0?*˿#4n+#82#<*#@^)#DG e#Hq|#L Ա#PՓ#Tc"#Xcױ#\nowx#`O (#dv#O,># #d#"#Ia fCgC ppv l5o o o o ? 8 {H 8^o ^Do :j:@@G0(fso s00bufv0r:  0pQend 8( -V<V1':;?@@F1u!fs=o =!buf>vP;F@@r1!fsDo D);EvrE: ";p@@1!fsno n);ov[;B@@]oh"intXf~t](V0dy%) HrO,38VJ:s b]GsA v#D###  #Y ##Iv###    P M Q# S YT#ORU ]2 @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck2Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t    7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F"#   %  % ?   "  2 -} ^ # <# -# I}# % B CDA EGd% t _C#ID#]#?]#  :vk: ,  :, k:2  dI  c :c  I   o   :   :v   :,        t  J  ]:v+ o  ]:, P d 8_  1_Y_#io #r:# # ^‡#!V#:# Ů#ƃ# Ǎ#$l :#( e#,p#0?*˳#4n+#82#<* #@^) #DG {#Hq#L Ա#PՇ#Tc#Xcױ#\nowx#`O #dv#O,# ##"#_a fYgY p p_ :#num :#05 :# # = :# ino#blk#5:#l!'5_ $:#fs % #05 &#T '# $ (:# )#    ? , H H Bv# C#+ D:# E:#  F:#N G#,  :; /Bdir 0#r 1:#buf 2#D 9v#  :v#Z ;#:p:p::v2B Gino K#^ L#|^Dc#{dv#:p::vM505ptrvppv_ptrvpvk:@ @1dirgh:8ipHi: !j:bufjjv xll!;":A"fs "buf #H :#;!:$8#p$<$:%h;:@@1&fs "2'N2'5z2+:'v2 ctx(HV2);Vtd*ret:P)8:th(;:3(<:3(:3(05:4(8p\4+MĀ@,0$;V-H./4. .,`0*4054%;?@@ 5&fs3 75&dir4m5'r5:5'65'D=v5'>v5*ctx@X( A%61xNZ..,2)357@E@X.H47@E@2T5;{@@Y6fsq dirrrs:t Dyzv*xl|pM]rwB@@_oh"intXf~t](V0dy%) HrO,38VJ:s b] k#D###  #Y ##Ik### { {  P M Q# S YT#OR~U ]' @^# _# 9 `# 2a# b# d e# sf# g# h# i# . j# \ck'Y C D# A E# F# G# H# I# / J# K# L# j M# N# V#$ #W#( X#d Y#h Z#l x[#p l#t  {  7 # \# k# `# ,# # #  # # 3#$ t #( |#, E#0 #4 _ #6 Z#8 #: #< #> e#@ #D #H  #L & #P   #R M#T #X #Z H#\ #` #d ##h  #x !# "# '# 3(# )# -# }.# Lb/# & 0# 1# : 2# 3# . 4# 5# 6# 7# 8# 9# o :#  ;# x<# =# E># ?# d@# TA# B# C# D# E# !F#  { % { % {?  {  { ' {-r ^ # <# -# Ir# % {B CDA Ed% t _C#ID#]#?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {8_z  1_C_#io #r:# # ^“#!V#:# ţ#ƃ# Ǚ#$l :#( O#,Z#0?*˿#4n+#82#<*#@^)#DG e#Hq|#L Ա#PՓ#Tc"#Xcױ#\nowx#`O (#dv#O,># #d#"#Ia fCgC ppv l5o o o o ? 8 {H 8^o ^Do :j<I#-:#^ #r:# :#!V#sb# <h@@6fsfo 6dirf6IfB7inog7rg:7 i"8lsjT^ k~;$:@@a8D8D8H :8!!:8buf"9#v;9 ls%JM&D9<':9<':9,<':9!ret(:!:'6q_=B@Vf@`h"intXf~t](O}6"] 'OSR(O1)O+(O)O*O+OG,3-O.O0]9<1yo? = G!#@"#%u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0 >' 8@ E @ FE <m@Fz=G,#GH,#c=I#nJ#:CK|# C3 ?6 H > @F H G OE ? VG F F MB B; < ? C= <y4>"B?"#64@d#Ay4A 3 I#7Gz# fd3#<v# LG3#?3#sE#%F3#$)FD#(C#, W#0rO#=#M#g!#^ #logM#C 1#s 3#C> O#? J#m> #3#<3#Z<z#D3((z3M<!I17OGG(EvmB#Dz#AOGOy<M#<v#@Cv# Ev# nAO#_O#U>\H\#cO# @O#$Hځ#(rIہ#,>܁#0O o#4lllG 3#TO#EO#IM# offO#fO#*B3# ?bH#CB#?#F# !I#tB>#3zv3b3vO3333>333dP?i> ~=9#E<J#"xC[ #=C[ # `IH3#AM3#?GPv#YGB CC#FC#C,[ M-[ #-[ #H.#WZ/v# 40"# 2>>@@U: tdb=@@Q@@: tdbP:iRO:tBg3 @@:c tdbe; He!AAf3d;!Hf3;!&_f3;lenfd"flh'reti3;Ff3@@; tdbe'<!Ee3[<?x3@e@n< tdbw<rety3<B23h@@< tdb1 =off1+=<O3@@>=y tdbNj=offN=iP=#TQO=Gz@1@= bufz>!05O!>iO?>"pA34@K@R> tdb~>$`>L@a@>% tdbP<3d@@>q tdb>!H>dq ?$?@@"? tdbN?!??hO?%@@offO?B3@l@@4 tdbE@!Hn@dq @&offtpNH3l@@@ tdb@!H Arec 3AU=3@M@\A tdbA!HArec A&rT$EP@@A+tdbB!?EBhOpB[H!3@@Bxtdb Blen B &_ 3k=<3@@tdb Eoff ,E!M UE#G tE&i tp]D* 3L@p@Etdb( E!H( Erec) F'B+ txy<(KF p@@.Ftdb ZF'D tt$1E2 @ @Ftdb1 FH\ @@F<tdb[Cf3@#@GjtdbebBo$@2@=GtdbnHC34@V@iGtdb~'Dt|@3X@c@Gtdb<dd@o@G1tdb^E3p@~@G_tdb( D@@Htdbs@O@I@EHkeyGqH#OHiOH$Z?L@Q@Htdb !fmt(>T@e@HVtdb ?3(Dh@@Itdb pFEMAIz@@FItdbI3@H@rItdbI!E3I)EzI3H@V@IDtdbI3X@i@Jrtdb=3l@}@HJtdbC3@R @tJtdbJ!E3Jop3UK)Ez@3T @g @K'tdbkC3h @{ @KUtdbAD3| @ @ LtdbE3 @ @9LtdbC3 @ @eLtdbFc3 @!@L<tdbbLlenb M!&_b3WM&std=#A3!@3#@MtdbM*!@!@"el[ %"@r"@i3N=34#@$@2N$tdb^N!3N!E3Nret3Oi3pOlckDO)EzRA*3$@%@Oatdb)key)(B 3%@.%@Otdbkey(@30%@Z%@Ptdbkey(B3\%@J&@FP(tdbrPi(Pret3PI 3L&@'(@PxtdbQ&st =+i86&@-==3((@v(@]Q!T@<3Qtdb>Q!I3x(@A)@Q1tdbR!055R!GR&buf1w,"n+3"ret,3B-lxFZ3D)@*@RtdbX*SoffXJSbufXzTlenYv:TcvY3Tel[[ T+i8E*@,#E<_vUCB3*@+@OU>tdb{UoffUbufUlenvVH3+@,@UVtdbVoffVbufzWlenvSWcv3W%,@,@retoW2B3,@-@X;tdb0X!@3OX#2F;X)053ret3X+i8"-@Ax3-@0@Ytdbw-Y#Ay{Y#>yY)4z"pz"Y'.{Otl&rec|D,ofsOZlenOzZ.H /tdb0D3>1g!/ino"iE 0@ 7@Z!I[!@3[!H3b\!s3\!>]!pF ]!C &^tdb _&st =rev3`#E3`vp"a)e@O2i8+F2@30@0@T45n#}D3,a6 4@.4@7'Ua7sa%4@.4@83a1I 7@@7@a I @3 H3 s3 ?H"@7@7@amtdbb!H;blenvZbbuf"by>37@8@b tdbckey(Cc!H[clenvc! =%c!4zd#4(-d#3Ud3%((z IAI 8@G9@~dtdbG dkeyG (d!fG OdrH -e'CJ tlA3H9@s<@oei tdbeoffebufNflenvfel[ f#8F[ ,g+i8;@5(8 #E<v`g*:@:@R )?O,X#4"gDO3t<@1?@g tdbNg+i8=@<-34?@V?@6h tdb+ 05+ G,B3X?@A@bhr!tdbh!3h!E3hop3^i)>Di3i)EzG3A@!A@i!tdb 3 E3F3$A@NA@i!tdbkey(B3PA@A@jY"tdb,j!3Jj!E3ijret3j=d A@B@j"tdbb jkeyb (k!fb OXk!6/b 3xkrecc k#Ce Ok@ 3B@WB@l4#tdb :lkey (Xl!f Opl&rec \H? 3XB@B@l#tdb key (l#f Ol'H 3B@ C@l$tdb mkey (Qm = % 4 z#C em&rec Xret 3m#f Om@ ( C@C@m$tdb nkey (Cn#C Wn&rec T"ret (#f OunA6 3C@3F@nd%tdb5 n!H5 nrec5 n#\B7 %o# 7 Yo+i8 D@+ W C@+} D@5xP%&l[ P#A\ o,&rF P0><3%/tdb;/off;"i=0HI3%/tdbH/offH#E 34F@XG@#p&tdb Op!C xprec q#G  P3d%^F@F@ p&4%4v%%^F@{F@8%q6%F@F@ 4%4%C$ 3XG@H@q'tdb# q!f# Orres% 37r&rec& P#C' `r+i8A G@,#M2 r0#> 3j'/tdb 1f O"res 3)C "rec f?H 3H@I@r(tdbG rkeyG (r!fG Os#CI Ns&recJ LretK 3s9'W 49'4-',8E's8Q's:]'@| 3I@I@tm(tdb{ key{ (Bt#f} OVtAz 3I@K@it(tdbx t!@x trecy t'xA{ 3tp+i8 J@,)H >T (K@}L@1u2)tdbS ]u"keyU (&recV TF 3L@2N@u)tdb ufn  v!4 z*vtl Jv&key (t@'t< (t&rec Pret 3jv'T 3tH;out mM@v?% 34N@N@vQ*tdb# vfn$  4$ z&tl& \ret' 3"w=> 3N@O@@w*tdb< lwfn=  4= z&tl? \ret@ 3w0?t 3+/tdbs /keys (1fs O1t<s ("recu )Cv 0F c+/tdb 1f O/r 1WZ v)C 0^C ,/tdb 1WZ v/rec )C )G )C <  +C #G #< v#)C +2M 2i8 0B x,/tdb 1WZ v1C /rec 1G )A )C 0(G<3,/tdb;105;"rec=)H>2i8{=)3G^A 3O@U@w.tdb wkey (x t< ( !} 3[x&rec L#f Ox#C xp yret 3gy2i8"2 >*( -4*4*7*y4*,@:*8 +y3+7P@P@ .7J+y4@+44+4(+,X8V+#z9c+p4+4+4u+,8+sz?+?+?+@,Q@@,R@>, .4S,4G,4;,7/,z4#,,:_,8k,V{9x,0 7,{4,,p:,?,@,sR@,?,kD/3U@6W@|x/tdb.1|key.( p<.( 'f0OtX#t<1(Q|ret23|+=PV@,)B>"I- 38W@pW@|/!M>, |!C, }key. (%}'4. (l+?7 3pW@zX@=}k0tdb6 i}!C6 k0}#M>8 T~&rec9 P#C: ~)G: ret; 3~+i8n sX@3G%3|X@X@0tdb$key$( C3X@X@40tdbkey(D3X@X@`(1tdbkey(kHA 3X@Y@u1key@ (!4@ ( 4@ z.Dm ( Y@[@1tdbl  !{Hl (΀#&Dn O"keyo (&recp Tkq "/B 3[@W]@g2tdb ret 3B#G ])H #C &rec P0> 2/tdb 1f 31H "rec )I )dD A 3X]@^@U3tdb -i 3a'C tp"top 9g2 42424y2,:2L8282(C ^@^@Ӄ3tdb i 350F33/tdb1H/lend)T3="tv0kGs34/tdbq1Hrq "elt[ )*@uv)4v""pv")?wJ"recx )?y)Ey)?Gz)_{O)dD{O0H$34/tdb 1*@!41?"q 1E#4"rec%)?&J)A'v=3^@Vf@H^6tdbt#?J#H '.Otp>385434343,P83,p?355"el2[ 934343,84Dž84?48+485408A48M48Y48e418q48}494H44444444,:4?484dn6l '^#D6@^6'EP@'B@P@'>@ADY3BE (H@dbJ)JXf@j@noh"intXI5Sf7l~t](l 'ly.a%1?id2#}{3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>l14Kz   #>Bz# :#    % M#:#   l xJQ:Xf@_f@̊ J\:`f@gf@J?FargJhf@ag@$;1?Pfn?tmp?fd:r:): Jadg@;h@etelel2Iaj@j@pnum, chI iI p% % ? J@ % buf@[e/K)Jj@$l@ptK!0jK:oh"intXI5hf7~t]( 'y.v%1Tid2# }{3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>l14`  :SK,    v  %_K2j@k@ XK00vfmt0z1% %   %KE_k@$k@#_KDOxFn  KP_$k@8k@xQ>K8k@k@ˏXKv"fmtdz% K9k@$l@9XK67vfmt89K:%8F k"K.@kg!ML$l@m@poh"intXf~t]+(V0dy%LK4FK&#K'#L(F#K)#L*#K+:#L,k# L-v#$L.V#(L/#,L0#0~LQWM K]#L^#K_v#M`v#KaV#Kb#KM##K>:uL?#|K@#lLA#LB#dLC#KEEL?$l@Ym@ N=F& b= > dev@ cAFtp tBtl vBth retC̒ outcl@ %L\m@m@! NFM L iPe:C devl c Ftt ret!gNMLm@t@qh"intXf~t]+(O0]yoLK4FK&#K'#L(F#K)#L*#K+3#L,d# L-o#$L.O#(L/#,L0#0~LQWM K]#L^#K_o#M`o#KaO#Kb#MM _3# dev# p*#K*M*#*#K>uL?#|K@#lLA#LB#dLC#KE0 +M. add+* ,* M-* MX V* MW* e d* M.3m@Hn@\ ,g-\ -\(tag/bhMkHn@n@^NjFgjbXltmplpm*tNFn@n@91devEegEbpG*Җn@n@tmpMMX3n@Bo@devVEgVbWbtagYǗ6MNDo@p@JNKFgLb<Mb\XO|devPpriQ3ИpR*MS3Mqo@ p@tmpc.}M>p@p@Lu =x8N.p@)q@tag-ϙp@p@6 !p@p@f""$!p@p@7 !p@p@f"7"`eM,q@\q@sK#dev$ ON3\q@r@ʚbb%TM%GNI8wcp&iq@q@q@c*Nr@:r@ tag fNK2 addJ* XJ* N3UuL?#|K@#lLA#LB#dLC#KE`Nt@u@S Na p Nޟ st t@t@devJ&arg%NO3u@u@(MNNM KNTNPahaNx3pXwNtu@Lv@à# NsaS~du@u@devS d1 u@v@tagUS8 dE u@v@badUN"3 @k>OLLv@x@kuh"intXf~t]+(O0]yoLK4FK&#K'#L(F#K)#L*#K+3#L,d# L-o#$L.O#(L/#,L0#0~LQWM K]#L^#K_o#M`o#KaO#Kb#NO_k3#NlF#Om#On# poC#KCMC#C#K>uL?#|K@#lLA#LB#dLC#KEI MX VC MWC N9Lv@Wv@X dev8 LOXv@xv@1  &O3xv@v@ۡx DOx=dev Osv@w@sNrF t pO3w@x@ʢ OO65OO e1 dCNx3N XwCO x@ox@Vdev x@-x@)$%x@-x@fģ1P*B4x@=x@tag+bOpx@x@dev?mPLx@z@voh"intXf~t]+(V0dy%LK4IK&#K'#L(I#K)#L*#K+:#L,k# L-v#$L.V#(L/#,L0#0~LTZM K]#L^#K_v#M`v#KaV#Kb#KM## +M. add+ , M- Ok:x@x@]U NjIOj:RO:x@x@NIret:O:x@x@ȤNIret: fNK addJ XJP3x@z@N2I iP2Vr2:dev4ϥtmp4p5/N5hO\Ѧsz@z@Lvz@z@L %RPy\nPLz@}@woh"intXI5Sf7l~t](l 'lSR(l1)l+(l)l*l+lG,:-l.l0zy.a%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO> %u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0 8!"Z#K## % DIR& 4P I #M # MPRz@z@CQCDdpSmMS qP%z@L{@s$WZ$: ret&e %P7L{@^{@s6%P?`{@{@ŨI>>Cdp@=P_{@}@Cw]oL]]CǩiP^ dir`dpa2}{bwPc:std    %ZP}@}@|8LtptliPthdir8H  N P>@k6TpuaL}@@yoh"intXI5Sf7l~t](l}6"z 'lSR(l1)l+(l)l*l+lG,:-l.l0zy.a%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>$l14 %u4 ` a#R b# c# d#  e# f# g#| i#" k#  l#$] m#( n#, o#0) Sh\ ,r Z 8ls bsG sAL   K4 K &+#K '+#L (#K )#L *#K +:#L ,# L -#$L .l#(L /#,L 0#0~L   M  K ]+#L ^+#K _#M `#K al#K b#P M  % M K TM T# T# +RR,e Su u _fd:#N#dev#a# >Q#buf#`# SY" : x # V_%#[&z#q^'l#R(l# `)#^*# % 3!7 4#\5#k6#`7# ,8#9#:#U;!#Z<1#8=#:P>A#<H?#\@#` A#d#Be#h CQ#x Da#E#F#3G# H# Iq#}J#LbK#& L# M#: N# O#SP# Q# R# S#T#U#o V# W#xX# Y#EZ#[#d\#T]#^#!_# 1 u SA u Q u %a u %q u?  u  u  u  u ]i Xi #_#0R#N`#Ry #_e# P #0QU #lRy #x]#T#X# Sy u  u  u % u Wtl \#T[#5]#S# Kb#Q#Ul #]#,U| #.V #4Ul #@QYe#TWQ#d | u  u S u rR< _e#^T #Ue#ibe#$P#4  u [ Zi #U#S#{Z#U#\#}a#_#]#[ # ae#4Ze#Ue#  u T  Y #]y #[e# S u Za crcѾ#m\Ҿ##(Ӿ#Ծ# X@ _ #05̾#r;#RWξ# uUq#` # Iq#0  u QP W۾#@_ܾ#[ݾ#Dae# %RQ#VP #,U# S` utUU#T #_1# |S# <\#$`#^1#M_1#^S#q_#]#[#nQ#9V# NZ#$T#(V#*]#,`Y#0p[#2{^ #4\#@\i #C^#GV #R[X*#Z&U1# S u   u  u S* u S: uSvS#eQ #Zb1# eX# t` #i^ #+a 1#` 1#3\ S#W#Y#R#!Y#`# gZ#$Xi #'*\#+rZ #6_v#>\1# S ua 9I9#0U# R# Y#^ #]!#^"#a##Ma$#]%#05&# I u YW@;GQ<#b=#ES>#Q?# (]@#SA# B#!C#05D# PE#$bF#(`G#,VH#0,_I#4ZJ#86_K#<Q TESUi #bVi #uUW#X#VY1# S u % uN]\Z]#mb^a#0Y_1#pT`e#r`a1# S- u/\`muUn #]o#[p#5Zqa##re# S u S uO`@|bT}# ]~# R#( % u % u % u[`QQS# R#RS#rS#\#Q#( #HI[ #P[ #X S u S uW#Y#FZ#;[#[#P#ZOCU#S#V^\#c[#JT#;[# V#$;R#(P#,sV##0B[##@`##P Ya#`Xaa#ZUT^S#!Q#T#  #$[#(]#0Z#8S#@P#AX_#D#E^#H#P  u  u  uX _#T#T#lsn#>#8X#8`#r#a#Q#(TLg#len#W#-# X# r# 3W#W#NX#xY _#)[#^#Q# O #CX#id#+YfuU#a#Z#R# Z# V#ea#,b#p]#X#`#7b# `#"Y #$mb f#%Q #@V #DT #F'^#JZ#NX#R a#T7T#X|YL#\`#|^#~V# v uu\M##g # !# a"# O ## a&Fz '#\(#\)#`*# ]+#W,#%V/@C0#V1#gV2#Y3# uV6\7#w8#^P<^=#Z>#T?#  \@# ( uC^CuUD#cE#_F#lSG#O H# XI#PJ# bK#WL# aM# `N#$!O#(TP#,W[Q#0YR#4|]S#8aT#<RU#@`V#D5^W#H|YXL#P_Y#pE`Z# T[#kU\#-X]#R@e(idg#j`h#YYi#xQj#gk#3[m(# 8 uY(:}@}@Ȫmb'len':end)0 ST:}@}@NJR΄z[}@H~@dirT:׫i:7 Z(:H~@O~@UU &_&!id&!buf'"R :P~@~@R #id $5Ul%buf&05l#il#crcl'4(U6 @ ) W:~@@ &_idbuf;(iY:t@*mb gpq(Bd Dilblɭ+~@D@,-ܭ.~@D@/0/  %! u'H\:@@9Y! &_!id!buf#dlY! Y:@&@e! &_!id!buf#iso!*mb Tb:(@[@" &__!id`!bufa(QS:\@@Ю|" &_P!idQbufR#csbT|"*mbU2 a YQD:@@P" &_A!idBbufC|#rosE"*mbF  V7:@@ЯH# &_4!id5!buf6(Bd8 L1^Z@N@#dev(BdGtag{2str#G %# u$U:P@@$ &_!id!buf#osb$ -T:@ @۰n$ &_ !id buf#jsn$*mb=  S: @L@[$&_!idbuf#rs4$'mb  ^:L@΂@Q% &_idbuf?#rsQ%'!l*mb  a:Ђ@@̲%&_!idbuf.#xs%*mbd 1_@@&&devidͳbufes&&3mbi :a:@@& &_!idbuf#es&&Xz:@&@޴& &_x!idxbufy #es{&&^^`:(@k@5.' &_^!id^buf_a#esa&& [:l@@'&_!idbuf4ovhG|4ovl~*iGV6@@7 (pr4coff5 len5̶3Z75a8Z:@@ (&_Lidlbuf4j:thbs:(LW!tl#m( %Sk:@W@ʷ(&_hidibufjA#swsl(  XF:X@@aj) &_C!idDbufE#hfsGj)(ZHp)[*BdI  %) uC]g:@$@ո*&_d!idebuff9#nsh*#mfti*'0Uj*(Zkp)W(vTk*~cpkY*uWl:*1Sl:*X\m:Թ*Ym:'Vm:inl*anl=*]nlf'ao:*,`poffq Ǻ*Qr#valr    %+ u_:$@@^,&_!idbuf#vs,#ms,#dir(\,V'mb*_c#tmp*\ļ*Y:*pY:!*]bC'.a*O a*YR'_'a'uX*W*AT'`]*MM')Z'Y`6'hT'['R'T: ` : %, u W>:@)@4-&_;id<;buf=#ms?,3Y:,@@/-JR[2f-t2buf-cp{7t  %- uO S:@@-nowп(SS$@4ret:@@P:@T@I.now8SS(@2ret:D@@b7:T@@". &_5!id5buf6N#es8&&dR:@@. &_!idbuf#es&&9Ya:.,/-/96///%/?0/_$a0%valGQ:@(@O1&_!idbuf#sbdO1*mb@0@@41-0:+0Ӗ@ږ@-0X O\:(@@v1&_!idbuf#sbdO1*mb@05@<@1-0-+0S@Z@-0K$_2%valARV&q2%str$& X$:%buf%&Y%:#i':#j':#c(lR\:@@i5&_Y!idZbuf[( \]'p&^5*oa_5<key`5O'Ra5sbdbj)x'Xcl'Wdl'Pelofffl*!gl*']hl*QilH*2,F2-:2,.2,"2600R2/\2/f2 v  F ( %5u l6 u5(U6`@ -6 u(T6 @ #O6 uV(\?6@BDY:sbL@@Hoh"intXI5Sf7l~t](l 'lSR(l1)l+(l)l*l+lG,:-l.l0zy.a%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>l14 %u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0L   K4 JK &#K '#L (J#K )#L *#K +:#L ,# L -#$L .l#(L /#,L 0#0~L U [ M K ]#L ^#K _#M `#K al#K b# K M # #   bE@d@b' cpDchF% b>d@@R cp= iY@@5bXapZbX:NWJbWcpWdevYretZ: sb:DNJdevcpDtmpendIret: b:ocpDpb:cpDb1:N0Jdev0cp0DI23ret4:b:"IDDcpDend}b}@@N|J~buf_fd:b:sti=@ Hdev_endl!`"## x$%'&h]### %[%$!9# ## $!(c### @% %$"%-$8'o@@ӻ#(J@+@#[ %e )%*ubL@@oh"intXI5Sf7l~t](l 'lSR(l1)l+(l)l*l+lG,:-l.l0zy.a%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>l14 %u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0L   K4 JK &#K '#L (J#K )#L *#K +:#L ,# L -#$L .l#(L /#,L 0#0~L U [ M K ]#L ^#K _#M `#K al#K b# K M # #  K >>uL ?#|K @#lL A#L B#dL C#K EI  N x:l X w c: dev ptag.>  c::@@N9J?p;_tmp<c=K>?4fd@:pret@:stAix@devyl|}Q@Ӡ@'@x@W %D Y:zw'L@@Ȃh"intXf~t]SR(O1)O+(O)O*O+OG,3-O.O0]yoGs:P%u4`az#Rb#c#d# ed#fo#gz#|i#"k# l#$]m#(n#,o#0'>3@@fd=3 H= ch?s 'cL@@fdK3) 'M3 'QV 05R SklowS st@@midpxV-L@;@h"intXf~t]yoGs:Pr:c}@;@fd~3H~}O-~3 DY3[xdc<@@oh"intXI5Sf`d6e7w~dc8t](w 'w*wG,:09<1y.l%1id2#}{3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>l14 ?  G!#@"# RR , S  Bd 2=d 3l#c 4Z#c 5Z#d 6Z#/ 7=# HM d:<@@Xtvhi:c@!@ buf3:i:n:fd:tpd:'cp :c S e  cP$@@coutO numObufQ\uuRLiS:nS:tP :sdg@ҥ@outf numh:t|d:d Qc6:Ud4Gc4d5num5 tv<!d@~!cA"M#d7:D@#18<@#d9:H@#c:;8@#d;Z6@ l Zid:$fd:WZc ԥ@ɨ@/out num[uu P%c l&'%'' '(0)1`*<*H+T#d A0@#[c :,@d:op:out nummc$̨@@out# Gdv@@$;outu P  SQ ,D Y:U{ec@0@gh"intXf~t]y e'3@0@uu&cp(Ri)3Q AS{%ec0@@h"intXI5Lf`d6^7p~t]yBd2d3e#c4S#c5S#d6S#/7# A  e'0@@A uu&A ptr&P tmp(e  out)PGBdLU|#ec@@;h"intXI5Lf`d6^7p~t]yBd2d3e#c4S#c5S#d6S#/7# A  ,e'@@< in&< uu&G ptr(M tmp)e BL  SA0F}ec@@͇oh"intXI5Sf`d6e7w~t]y%Bd2d3l#c4Z#c5Z#d6Z#/7# H  Ue4@W@IR uu3Ru out3 fmt3] Bd5`XSc%deJX@j@uuIRoutIqeEl@@uuDRoutDBe@@@uu?Rout? e'@] 8e*.@]~ fe@@koh"intXf~t]y%8V%Uf  R:# !sV# j# Ef:@y@H: jrt f: !s@ fF1 wfrZnum::V fz:|@Y@ jyr fy:! !sy@e f{F wf|rnum}:rcprbrcpre:\@m@ str)4  ae e nf: f@AcprybufrMrneg:!sV6f:rc :8Ԭ@@`{]fR:p@@l]strQ4 Q eQ  f@@ R: !sVfF f%] |f:bufEH@ 2f[@@E RZ: !sZV(f\F f^% |f_:buf]E\@%Uxex%fU@x fOv`@fe@@oh"intXf~t]y%fnum:#j# % f0:@;@ j/r p1U wf2r~ num3:{ f <@@Tnum:p!buf"Tp@%dx{txfd@׀fe@F@h"intXf~t]yokfd@F@@argl3 prtx numV k5ogeH@@\h"intXf~t]yok"g-3H@@str,rcpp. i/3^ kgr@@| g3 osretr ' x0g@9&g7g@l@int~]ohf"g%g,gXgtgggg ggug%lglow`#`#  s llv g gM nL dL rpLnnNddOrrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkwwdgkm1km0kg$v@l@u#v3v#vSc%uu&tXvv'w(v &x1LB8Wbmx!k~'EctP@@!Cg7gl@N@Gint~]ohf"g%g,gXgtgggg ggug%lglow`#`#  s llv g gM nL dL rpLnnNddOrrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkwwdgkm1km0kg<vl@N@u;v v;v@c=uu>vv?w@v&HL&B8WbmtxFr I\4@7@'@N@g7gP@w@int~]ohf"g%g,gXgtgggg gglglow`#`#  s llv g gM nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww dgkm1km0kh_P@w@n^0d^P`A7-(LWbmx O(Ft`@@~@w@[g7gx@׷@int~]ohf"g%g,gXgtgggg gglglow`#`#  s llv g gM nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww dgkm1km0khSx@׷@uR%vRwT@VA7-XLWbtPmxEeH[@@H@׷@)h1h@Ź@,Uh4AAc3Ainteh9Adc8Ah AcA}h*Ac)AhHAcGAmhMAcLAd@@v]h%A@@ c$A@/@9; eh/A0@I@ec.A%P@d@7Hp@@ZMh>A@@ c=AKhCA@@j cBA@@@$@3uhRA0@d@  cQA9 ;@B@Sv 1 HH@b@S !hWAp@@X cVAh\A@@ c[AhaA@Ź@ c`A;hhȹ@ȹ@D7P@intihй@@h"intXf7Z~t"iyZ](ZiIJ#MK#^jLh#05Mh# Nh#A/OM#hOMYM#MZM#[#_\Z# 05]h#j^h#Cjs3,iz3 qi s cO nz i3  i ptr^j3 +j ^j3~ Yid s1 s2d nzhkjkq6xixjqoZ i s c3 nz i3iй@չ@9A@@eptrminMmajp-\h;S@ @`J@P@mp@@~p@@Yغ@@:jhpjh V@m@!i@(@lZ"05h#sth maj ܻ@@$%m~$&h>0@o@&'j=zRh?3r:j@apA"\BhKmajCminDMiEM<05FzO`N@Z@ZSc@h@P`Y@[@`@@p`\Dh`@@L @$@\h&p@@<ph'05zptr$minMi z\.hS@@0`@@m( qs.$$07BMX`S@X@i`@@^&i @@'Qj zH'05 zhi3p ~@@@@)R*Oib@*ic@+ieM,3*djf3@*ig:@*iih:@*jk:@*il:@*B"3 $]j%34 ~&`Wh'3 o DY3j1h@@ېh"intXf~t](Oj!@@>B num d 05 d7j Wj%  tmp& i'3  3 Ajj@@Bh"intXf~t](Oj%3@@s1#s2#$n$dZojj @q@h"intXf~t](Oj* @q@ydst)src)n)dHd,Qs-R o  yjj@@h"intXf~t] k+@@`p*ch*3k,c-o Z1kj@@>h"intXf~t](O*k#Ayk43@.@s12s22In3d`us17us28  o  o k%30@@s1$Bs2$bus1'us2(Fkj@I@Ēinth"Xf~t](O>kA@I@Pk:Uk:9WZ:dYdstBsrcCtDd/}p@   o   ,ZkjP@@Xh"intXf~t]ck#P@@s"vD" k$o qkj@@h"intXf~t]jk+@@5p*ach*3c,Qozkj@@ԓh"intXf~t]k*3@@s1)s2)o}kj@-@h"intXf~t]k#@-@-to"Y"xk$o kj0@z@Qh"intXf~t](OP&0@z@str%len'd:(  o  kj@@h"intXf~t](Ok$d@@ str#Ls%R okj@9@inth"Xf~t](ObiA@9@kPk:Uk:WZ:ddstB$srcCXtDd}`@   o   kj@@@h"intXf~t](O*k#Ak%Oyi<@@@=Pk:ic0:3WZ:d t=d c?ze dstA o5* l1h@@h"intXf~t](Ol#d@I@s"y."d len$d.   o k/P@@L Cn.Ox s.C >B.O  st0IKi1O y;O.  xt5O YY l]@H@L strx k3] WZ3  c0lP@W@ strgk3`@i@- 1s1s2lp@@Y lɸ end ˽] l̽_>Bͽ^neg3 k3 out@ g C)l @@- l end gk@@Y KlendkEV@?@ lD xjD) >BD3U FV negG3koutr@5l3@@c@sk1p@@1lxj>B3yml@^@Mh"intXI5Lf7e~t](e 'el0Zzo y , I-# r.#  Ll/lk@@:ljZ+5jZ4jil3%DqZCLnrZupZle @:@ldArdAplF4@@@4lErElGdiHZ~HZ7ll9 @^@U^i:ZEl6@/n4@  y1@  yl2`@.ml`@@mh"intXf7Z~t](Z'(#05)o#mSm*zo  &m&1*'#Jm(O#  ama`@@2 Jm`Onmb2ic3 6mO@?@y JmNOnmP2iQ3Y m,O@@@w 1*+@+Oid-O&m52nm<2i=3Zm#@Em$O@̖{nl@@@.h"intXf7Z~t](Z 'Zl0|Ooz 3 pid4O# Ln5O# m6o# 47z# m8 '$ (*# 05)o# m$Sm*Ao mtpids|LnsO~u3nvmr@@z@pidp|LnpOnq;[nb@@4pida|LnaOna3mS@@`gpidQ|LnQOnROnC@0@pidA|LnAOlenAo4B;  nA0@L@smP@@{pid|n;/moN4;mLnOm{nKg\r}A H!n1@@pid0|n0;m0o40; "n2!m;@E@#pid|"$n;B$mob$4;%;%n%nO&n3P@@pid|n;'moG4;g3n&|mO@ @ppid|n;mo:4;ZOzn߉'*nL@@:lJ|LnJO#mKoC4KzynMnNz(Dn3O@)/n:*qn.@0n@z@h"intXf~dc8at]on+@@n#@ @n" &m$V$y n.O@z@L sec-Ox &m/Vřon@@ h"intXf~t]oo@@ o @@ $on@@Ah"intXf7Z~dc8lt]o5o!a@@eax"ODedx"OR|o@ @h"intXf7Z~t](Z 'Z3pid4O#Ln5O#m6o#47z# m8 o   '(#05)o# m Sm*y(VI)#*#o+1 p@@W~3o͙ V Do@@~3ooC @@IBiD3QoEo@@odIi3o "J@+@I,oLoe0@@_hd05doh o3@@_ICco3o@I@O o3 @g@}{Vo3$o#3p@@7str"csep$-.oI/o3@%@ o\0@3@!pidZ|LnZO7"+5Zo"4[z #n]zud#po^ouh#fo_oulo_oW$i`3upoa ~o6@@ @jUEy=|@@QoAU@@>CIKL #o-l@ %DY3pq@F@fh"intXI5Lf7e~t](e 'ey#q"3oFqhq&Z q' -q(# p 6 |q!6# q"<# Rp#3# y$3# r%<#  6 p) KR*6# r+<# (r.3# Jp06# q 4 P56# *p6<# q73#Wqpcpp.Z %1~ id2# }{36# pid4# .5# 7# 8z# >9z# :A# 4l1 4r@=>?3L@ ]p)@6@p(& p.S@@M@E $p-Sq p3P@v@ Q4q2 $p8S@@ ~p7S!@@&!R!4p<@ @q!I;!i=3! /r-@@!-I)"pa"i 3" B^q3@@"yp3"srcdstq qf3@@ #qeipePq@@9#Ie#i3#(qɸ@n}{6#fѾ#TҒCpp6#Xq p@ q@!ipZ@ r@  Z "#op@@ $Gyp38$$srcGX$$dst6$05$qNres6$ M% T&qpp6@@%iporesr6F%!bufq@'qT@F@Y%$strS%(@@V)*@+@X)"+"6+ "65+,q %h@,p %p@,3P@B@'^=3'cr='ys=sc(i?3(?sosP@@(rns(idpZ @wr3@@<)crsr3@@h)crsjr3@q@)i432s3@Z@)csig3)5sc"*oldrX* i2s r`@@*s3*r&s+rH3@1@%+sG3Q+r[+9# :]# 4<# A={#! : ]O>l14  * s s 5t s ' (# 05 )# m Sm *s'8 t(8#fd)O# s+O# t,O# dupO@@,kfdOsO@@,fdOtO$BO @@,fdO-siOQ- sO@@o-fdO-cmdO9.sY.iO.$@T@sap%argO.`@@ap%argO/sPO@n@/ tO8?/s\u/i]O/s:p@@/ Ht~8@@/7fd}O/!siO'0s @@E0fdOq0buf0"T0"H0#8 1#t'1retE1 $s@|@n1ZfdO1buf1"T1"H1#822#tP2retn2Ac@@2fd~O2"H~2"O-~O03#8}3GBf@I@3 fdeO3He05e#g83*o HHP@@4fdGO<4"HG\4"05G4#I84#*Q5s8@@ 5%fdO& ':9z#:A#4l14K  DIR&K lt&3@-@47 }{%`7%3f)7dir-7  V dDY3Ltq0@k@>oh"intXI5Sf7l~t](l 'ly.a%1?id2#}{3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>l14K g % tC:0@k@7 t@:8 tAe8 |tBa8 oliE?9 D?@  ?8 V& 4?@1:@t2:@t0:@st3:@ytqp@@Fh"intXf~t] 'Oyot1dp@@:9t'd@@f9eХrwq@b@h"intXI5Lf7e~t](e}6"s 'eyo.Z%1Jid2#}{3J#pid4#.5# 7#8z#>9z#:A#4l14V  v+3@@9 * *  tK@1@9}{J9bufJJ *JzlenL :N(: a t:3@@b@F:[ 9 9DY3bǦtqp@@wh"intXf~t](O 'Oyt'3p@z@r:t03@@:/3^8o@@:tA3@@: @ 3tJ3@@";K bufIK lenIdQo DY3f6uq@@h"intXI5Lf7e~t](e 'eSR(e1)e+(e)e*e+eG,3-e.e0sy%u4`a#Rb#c#d# e#f#g#|i#"k# l#$]m#(n#,o#0o.Z%1p id2#}{3p# pid4#.5# 7#8z#>9z#:A#4l14|  u43@@N; K3 3  uC3@@z; B3 B t3 @*@;N K ޾ *u30@:@; K  g! c@@J@; !s -3P@g@*< }{ ̾ uR3p@1@V<DfQD<uQJ<posSs<   0u3@@@<3<uJ=fD_= %uy3@F@}= Kx=uxJ>=uz38>{Da>@F@dir > | Du3P@@>K>uJ ?3A?fD_?@@buf}u(@D Y3 vq@@ih"intXf~t]0]9<1|y?  G!f#@"q#Ju"3@@}? tv! tz!d IWuq@G@ʨh"intXf~t]SR(O1)Oyfu#d@@?^u)d @'@?uu/o0@7@@mu5o@@G@-@uqP@@+h"intXf7Z~t](Z 'Z'(#05)o#m Sm*o y u )  pid*|#|u+ #=u,3#l uBCCpidA|iC3uDC unvpidm|io3upCu|P@N@Y@&pid|@=u& Al03,AuC@Ah@@#.^A7I@D@Va|Aj 3u|P@s@AX=u&uT@@ApidS|AuVCoutf@@@V#.B7u @@;Bqpid}|gBLn}O+5}oB4~zBuCB K#(.C7!H#`.%C7"u9@@CC#u0@ $DY3 vq @4@Hh"intXf~t]0]yu!u"d#u#d#v*3 @4@oCK)H)  o  uv DY39vq@@p@ժh"intXf~t]oydr*r@@p@C+')3J+@d ? fvqp@@h"intXI5Lf7e~dc8wt](e 'e0~y.Z&v/A%1Yid2#}{3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> 8!"S#K## _  DIR&l%"I&"#g'#05(l# )#*# +# _2 zv-vtp@@CsdirssHs~ Pvi@@Cdirhs9v]~@@Ddir\svC'@w@KD'dirBswDGvD-DZvJDAvP'D w 2v53@@E_dir4srv*s@@3EI) _[vq@W@!h"intXf~t](Oyv,@@_Ev+Elen/dEi03EnumB3Fv.3@@ ov^3@W@=F?v]iFfd_3F len`dP bufa? N NDY3VDn`@@h"2>intXf7e~t]orpc"`@{@Fpid!ZF #ZP v2>@@GDpid0Z@G D0ZkG Ln0ZGlen1ZG 41zG 33P v:Th ZT Drmw@k@*h"intXI5Lf7e~t](eo 'ey.Z%1?id2#}{3?#pid4#.5# 7#8z#>9z#:A#4l14K  Zcw[#4w\#-^z#I_#  aw`dc4wd#-fz#Ig#  a wh Ew3@4@G;w!H3zHw?ulw?Hv@vHvz I05zIH{  V  a  v33@@k@2Iw1^I;w1Iw2LJ43lJyw5Jv6KwG?hKwH?Kv@Tw@w@@k@vmzK05nzKHo{rl  a DY3nnp@|@h"intXf~t]owp@|@L(Ͱw@@@h"intXf~t](Ooyo'(#05)d#mSm*  & x y x }xw/ x1&x2#x3#35&# o6Bxppcwd}wv(y3wpxpcwd}wv(y(3i)3xFv3DlenEdxExEwGv oxi@@;L}{hgLhpLxh3LxjugposkL(yluhxmulwnv.MxwdLM !!!!"#@@(!!!!"#@X@[!!!! "$h@@!!!!( "l%Xx}@j @M&}{ Nwv'4xp*N(@T @'}HN'WZdfNx@pi3w3wv) y:d9p05;di<3w=vjx_]pH]}w^ib3wcv%x}p @4 @yNZ&}{Nwv*4xpud(y3'05dN'+x}O+6 @% @r!C@ ,N @ @!!!@!,xP,P/x}@ @@@P&}{P'w}P*pul'05dQ'wv4Q-@p!+!R!"^,j]Q"t.&@@-!!!!,Q,QO`yn@@@h"intXf7Z~t] 'ZSR(Zoqy'o@@L@Q pid(oQAy8oP@c@Q pid7o 9o#RyyVop@@6Rm 5yTO uidTz zT Uo pidWobR Pyk@@uRyz@@R {R yn@@)h"intXf~t]oy@@Rlyn@@jh"intXf7Z~t]oy!@@ Sl O]y!z@@ձtK!0jK:oh"intXI5hf7~t]( 'y.v%1Tid2# }{3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>l14`{z  O :qz  O  O  :y   hzv# y#arg#z##fp$## ky4O@;@8Sfp3#"[3ap3%z5 tz6hy<O@@a@dSfp;#"[;ap=% >OPMz/Op@@S%arg.%Sj.Sn.OT  [z(O@@2Targ'%c':^Tcz!z@A@h"intXf~t](OtK!|jKo{z3 o qz3 o 3 y   hz# y# argo# z &W H'W# z(d# )d#z-3@Y@}Targ,Tc,T z>3`@@UH=AU"[=wUap=qUz? `z@T A3UWze3 @A@UHd"[dapfq g3PDz!zP@@ah"intXI5Lf7e~t](e 'ey.Z%18id2#}{38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >l14K z3 zP@t@VvYo@@-V{3@@YV t dz3@@V,c3V@@cs>u{{8@@Vh8Wpos3IWc3gWo!cz3@@Wc3W t@@cs>u{Uz3@<@W neXstrYUX6|3@@@X7strYXz/@@X~{0%Y}{1~~052zYY>V>Vz)@$`@]%d@&h@DY3 V1!z @'@ڴh"intXI5Lf7e~t]o(e 'ey.Z%1?id2#}{3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>l14K3pid4Z#Ln5Z#m6#47# m8a 7id8#!9#V:#{;Z#  {<?Iid@#!A#VB#{CZ# 4DI# AX "|EOyidP#j|QcUidV#{W Kl  z{& zres {K#O| |#% | t Va{2%051{3E t% @'@Yc80@5@Y|3@@Q@Y t _3`@i@ZK^|3p@Q@2Z_ t^ZH?Z3Z05 {_| ?out8@ |R3`@@0[ tQ|M3@@\[ tLHL?05L;|G3@@[ tFHF?P{@@[src[![V\ t;\+5g\|\{|Qo\@@4\  A  XH|3@h@\7 t\05+]{|3p@@I]u tu] {yp!{3@d@]" t]#Z ^|hsp@@+^ tgW^ {npos^Qow^ J{N3@z@^d tM_HMs9_O-M3e_$|@@_ t|@@_4_! `V)` tv`+5`5|83 @r@a:%str7 t7|%3@@.ac$3Za t$&ch&zu{|3@%@yac3a ta|E![|0@!@b "h=b"!b"Vb" tb# {Uc {\'" Qoc05c(")'0" Qo*c05,dP @(!@*i3d+|E{F3!@!@-d  tEYd,cGzd{]?!@"@du h\?dWZ\3e t\1e,i^3Qe,c^3oe!B|K"@$@e "KJe"Je-{L?up.msgR +0USE*iW3f#Qo~9f# tWf/P"+{_ z 0|%@%@fi{l3 %@&@f  kfkg Hm _y{nA{o,srcqOg,dstxxg/h"WZg A 1!Y{&@'@gM "}{g"h":{$h#Zh+p{V-2{-@-'.Z@-a|/@282D Y3|!z'@)@vh"intXI5Lf~t](Zoy'(#05)o# mSm* ue'@B(@xh d3h msggd nhzV=ui,A, 3;EP(@d(@h|M3p(@(@hsDLus u1(@)@i 03Gi(@(@i43riD5u |(@DY3 }!z)@?@9h"intXf~t]tK!qjK{o{z3 d {qz3 d 3 { y  hz# y# argd#](~~}P~}~}}6} 1}0 }3L}:}OK}Vm~}}{g g w~ g# ]#}}'|buf|~|O}2V)@t)@i}1Vi }1Oi}1jB}3Vrem4OO}L)@:*@:j.KVfjbufKj+}KOjx}KOjpMuXr}N.u`vOVk}PO;k}QOup e}3@*@g*@Nkmzmzkc{k~3p*@ +@kzmlj&ln3Fl"i3l3l ~3+@U+@l!}l"~3m#~-`+@/@,m!"[,Xm$ap,fn%~.ud"AT/3ao%~03ul"4~03o"@~03o"\}136p"c~23up&i33p#}3/@?@p !zm q!"[Eq$apf)r&tt"3v"r{mv" Onw"~!Ow"WZ"Ox"}#O1y'v$O"~%3Az"~&}z(}?/@)"&ret23z)" &ret=3{)"'"j9{)# &len3{&pad3;|)@#e&ret3K}*=@!>@&ret3})X#&ret3~*0@1@&ret3U~*w=@y=@+ret3P)p#&ret3~,>@>@&ret3~,-8@O8@&ret3I*|1@1@E&retX3)#-bufl %m])#&ret~3.#}/01])$ +buf " ~3)p$ &len3ˁ*>@>@+ret13P*r7@7@!&retH3m* ;@0;@?&ret 3)$Y&ret#3ʂ*;@;@w&ret?3 *;@;@&retC3H*;@<@&retE3q)$&ret-3)$&ret3,>@>@&ret)3#*w5@5@ &ret^3)$: ":)%T "Vل*x8@8@r &retS3AP%&retY3u)h% &c{%&ret3҅,6@ 7@+retc3P2{ 3 45{6 B3~!z?@?@ɼh"intXf~t]o~(~'On?@?@| ~K ?@-?@H ~JO n%L ~230?@?@t rnd33cA]?@?@~ 3@ v!z?@*F@"h"intXI5Lf7e~t](e 'e0sytm$".=#3#$3#>%3#&3# K'3#(3#)3#*3#+3# o.Z%1 id25#}{3# pid4#.55# 7#8z#>9z#:A#4@l14 )   ~   ) 8 ) D  [ 3 9 Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec . U   F ~  Sun Mon Tue! Wed" Thu# Fri$ Sat% r& .' ( AM) PM* R+ ,~|?@;A@߆{ {+K3t3}&@  `@A@gA@__^bu|ZopA@A@܇ n"A@A@6A@A@4bb htm A@A@`ԋA@A@݅ zA@E@strz~tmbi.c.Ŋ05znzwH`i .3..DE@*F@tC׋EuthG 0  3& tm"@I%L@~&L@r,}3@@b,y!z0F@F@tK!0jK:oh"intXf~t]y{zO :qzO O : y  hz# y# arg#}<O0F@fF@Yc"[;ap;%z=lyCOpF@F@"[BapD% EOPNz,OF@F@arg+j+݌n+Olen-O\z%OF@F@Iarg$c$:uz!zF@G@tK!0jK:o{zLRggn:int qz{gng : y  hzA# yp# argn# z  H!# " #:~z&gF@G@Karg%Kc%:t-gG@_G@H,"[,ap,%7z.ld/` 0gWz<g`G@G@jH;"[;ap=% >gPO!zG@G@oh"intXI5Sf7l~t](l 'ly.a%1?id2#}{3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>l14K 'G@G@ %Ž % b%: }&:C  % 8 Vzɀ!zG@H@h"intXf~t](OtK!|jKo{z3 o qz3 o 3 y   hz# y# argo# "W H#W# z$d# %d#)3G@4H@carg(c(ŏ C3@H@H@!HBW305Bd^"[BapBqzD dzEX F3ɐU3H@H@ܐHTW05Td"[TapVq W3P$!zH@I@Zoh"intXI5Sf7l~dc8~t](l 'l0y.a&v/H%1`id2#}{3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>l14l %I&#g'#05(s# )#*# +# %  zv- $!!w#' l -%Ԁ*:P t)!H@H@nCH@ I@4wB'` tDl w2 I@)I@DP0I@`I@ʑ?wO'dirQ!6I@II@Q)e2OI@\I@S,>:`I@iI@4 t=!H=O-=:0pI@I@` t/!5’ {.mnI@I@eh"intXf7Z~t]o;!I@I@Jm O@ OI@ P@h"intXI5Lf7e~t](e 'eo 3 pid4Z# Ln5Z# m6z# 47# m8y >HJE IKE# gL3#@ Mz#D tNU#H U? Adf3I@AJ@ Kres38nK3PJ@zJ@idev05zJ@J@Szؒ}S߄zpos3,3J@]K@?zkh߄3uppos3l`K@K@z߄3supret3} %CK@L@QIBӁl L@dN@';cmdkS#k3pidm߁pzuhq;krultzbzmJ%}{RYdirO%^zxh J Y h wXpN@O@W3IYmsgZ(1 O@O@͖I0I2msg3 LNO@ P@pidMX-P@vP@Ah"intXI5Lf7e~dc8wt](e 'ey.Z%1Cid2#}{3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#HJl#O-K3# łLd Vl .P@vP@% t-Q H-l O--3 }/d_%P@YR@h"intXI5Lf7e~dc8wt] - !.Z#mac/l#o  y 8.ZP@P@ԗ ip- //lׂ1AA)tQ@Q@={ sZmacsl Euh Hz{T YQ@R@imacXl ZuxMR@YR@ipLZ Nu|sn`R@R@h"intXf7Z~t]%zoO`R@sR@05O idOLzR@R@ idO qo, _R@R@? idO1nR@R@>h"intXf~t]otd3R@R@knOsniǃnR@S@uh"intXf7Z~t"iyZ]"$h%o&'#(z#) *! 05 O r O ptr" R@!S@.  h10S@NS@Ù050Or0O ptr2&20&pփ7PS@kS@056Ox6Or6O ptr8G3pS@S@3F05FOHOGlUS@S@ZT05TO;nS@S@Fh"intXf~t]oPS@S@J S@S@S@W@h"intXI5Lf~t](ZO)3 'Zo $ ? d j ) g*# +z# len,o# /& num0o# , 1&#5 4z ppb5z# ]6o# 7o# 8o# QoldPPo&PonewRAƄ>b?5 YS@s1j1֥11{3Rtok3pc43sc43 @ o   `\@\@ʦ s__1a@/j\@\@h"intXf~t](O)\@\@s&"c'3Zn(d8'p+R    A% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I  : ;  I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II&< '  : ;I8 .? : ;' I : ;I: ;I.? : ;' .: ; ' I@ : ; I!4: ; I".: ;' @#: ;I$.: ; ' @%: ; I &.: ; ' @': ;I (: ;I ): ;I*4: ;I+4: ;I,.: ;' I@-4: ;I .4: ;I/4: ;I0 U11UX Y2131X Y41UX Y54: ;I 6!I/7: ; I84: ; I94: ; I:1X Y;.: ;' < : ;= > ?.: ;' I @.: ;' A.: ; ' B: ; IC: ; ID.? : ;' I@E : ;F41G41H41 I 1J K1L UM 1N4: ; I? < O&IP4: ; I?  Q4: ;I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II&< ' .? : ;' @: ;I .? : ; ' I@: ; I: ; I4: ; I .? : ; ' @!4: ; I"4: ; I#: ; I $ : ; %4: ; I &4: ; I'4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I&I' I : ; I 8  : ; : ;I8  : ;I8 .? : ;' I@: ;I 4: ;I.: ;' I@: ;I.: ;' @4: ;I 4: ;I: ;I 4: ;I!.? : ;' @".: ; ' @#: ; I$4: ; I%.: ; ' I@&: ; I '&( )4: ;I*.: ;' +: ;I,.: ;' I -1X Y.1/4101UX Y112 U34: ;I 4!I/5 : ;6: ;I7418.: ; ' I 9: ; I:4: ; I; : ;<41 = 1>4: ; I ?4: ; I? < % $ > $ >  : ;  : ; I8  I&I&I .? : ; ' @ : ; I 4: ; I .? : ; ' @ I!I/ $ > 4: ; I 4: ; I? < 4: ; I?  % 4: ; I?   I&I$ > % $ > $ >  : ;  : ; I8  I&I&I .? : ; ' @ : ; I 4: ; I .? : ; ' @ I!I/ $ > 4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.? : ;' .? : ; ' @: ; I: ; I : ; I!4: ; I"1X Y #1$ U%1X Y &: ; I '.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I .: ; ' I@: ; I: ; I 4: ; I!4: ; I"4: ; I #1X Y $1%1UX Y &.? : ; ' I@'4: ; I(1UX Y ) U*1X Y+ ,4: ; I-1X Y . /.? : ; ' I@% $ > $ >  : ; I$ >  I : ;  : ; I8 : ; I8 .? : ;' I  : ;I 4: ;I: ;I 41.? : ; ' I@: ; I4: ; I4: ; I: ; I .? : ; ' @.? : ;' I@: ;I: ;I 4: ;I: ;I : ;I.? : ;' @1X Y1 !4: ; I"1UX Y # U$41%.: ; ' I@&: ; I'4: ; I(1UX Y )1X Y *: ; I +.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.: ; ' I@: ; I: ; I : ; I!4: ; I"4: ; I#4: ; I$ : ; %1X Y &1'4: ; I(1UX Y ) U*41+ ,41-.? : ; ' I@.4: ; I /4: ; I 0 : ; 11UX Y 21UX Y31X Y 4 % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I.? : ;' I : ;I: ;I4: ;I 41 .: ;' I@!: ;I ": ;I #.: ; ' I@$: ; I%: ; I&4: ; I'4: ; I(.: ; ' I ): ; I*: ; I+4: ; I,4: ; I-.? : ;' I@.: ;I/: ;I04: ;I14: ;I 24: ;I34: ;I 4 : ;51X Y6171X Y8 9 U:1UX Y; U<41=.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.: ; ' I@: ; I.? : ; ' I@: ; I 4: ; I !4: ; I"4: ; I#1X Y $1%.? : ; ' @&4: ; I '.: ; ' I (: ; I): ; I*4: ; I+ : ;, U-4: ;I.1X Y/ 04111UX Y2 U3414.? : ;' I@5: ;I% $ > $ > : ; I  : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; I&I' II& : ; I8 < ' .? : ;' I : ;I.: ; ' I@: ; I: ; I4: ; I4: ; I U!4: ; I".? : ; ' @#: ; I $.: ; ' I %: ; I&4: ; I' (.? : ;' ): ;I*.? : ; ' I@+4: ; I , U-1UX Y .1/104114121X Y 3.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I4: ; I4: ; I 4: ; I .? : ;' I : ;I : ;I!4: ;I".: ; ' I@#: ; I$: ; I %4: ; I&1X Y '1( )41*1UX Y + U% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I.? : ; ' I@ : ; I!: ; I"4: ; I #4: ; I$4: ; I%.? : ;' I@&: ;I'4: ;I (.: ;' I@)4: ;I*: ;I +4: ;I,4: ;I- : ;.1UX Y/10 U1412 3: ;I4 : ;51X Y6 74181X Y9.? : ; ' @:4: ; I;1X Y <41 =1X Y >: ; I ?4: ; I@1UX Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I4: ;I.? : ; ' @: ; I1X Y 1 !41 "1X Y #41$: ; I%: ; I &.: ; ' ': ; I( ) *.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$.? : ; ' I@%: ; I &: ; I ': ; I(.? : ;' @): ;I*4: ;I+1X Y,1- .41/.? : ; ' 0: ;I112413.? : ;' I@4: ;I 5.? : ; ' @64: ; I71UX Y 8 U91X Y :1X Y ;41 <.? : ;' I@=1X Y% $ > $ > : ; I : ;  : ; I8 $ >  I &I .: ; ' I@ : ; I : ; I 4: ; I .? : ; ' I@: ; I 4: ; I4: ; I4: ; I : ; U 4: ;I4: ; I? < % $ > $ > $ > : ; I I&I.? : ; ' I@ : ; I : ; I 4: ; I 4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I .? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I .? : ; ' I@4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.? : ;' .: ; ' I : ; I 4: ; I!4: ; I" # $41%.? : ; ' I@&: ; I': ; I (4: ; I)4: ; I* : ;+ : ;,1UX Y -1. U/1X Y 0 1412 3141UX Y51UX Y 61X Y71X Y% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I  41!.? : ; ' I@": ; I#4: ; I$.? : ; ' @%: ; I&: ; I '4: ; I(.: ; ' I@).? : ;' I@*: ;I +.: ;' I ,4: ;I-: ;I.: ;I /4: ;I0 : ;11UX Y213 U44151UX Y 61X Y 7 81X Y91X Y :1;: ;I<4: ;I =4: ;I>41 ?4: ; I% $ > $ > : ; I  I$ > &I  : ;  : ; I8 ' I I &I!I/ .? : ; ' I@: ; I.? : ; ' I@4: ; I4: ; I4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > &I .: ; ' I : ; I4: ; I4: ; II!I/.? : ;' I@: ;I: ;I 4: ;I4: ;I1UX Y1 U4141 41.? : ;' I@% $ > $ > : ; I$ > .? : ; ' I@: ; I : ; I : ; I 4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I .: ; ' I@: ; I : ; I !4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I4: ;I.? : ; ' I@: ; I: ; I4: ; I 4: ; I !4: ; I" : ; #1X Y $1% &41% $ > $ > : ; I  I : ;  : ; I8 $ > I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; !I/.? : ;' I : ;I: ;I4: ;I.? : ;'  .? : ;' I@!: ;I".? : ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I (.: ; ' I@): ; I *4: ; I+1UX Y ,1- U.41/.: ; ' I 0: ; I1: ; I24: ; I3 : ; 4 5.: ;' I 64: ;I7 : ;8 9: ;I:4: ;I;4: ;I <4: ;I =4: ;I> : ;?1UX Y@41A41 B 1C1X YD1X YE1UX YF4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I@: ; I: ; I : ; I !4: ; I"4: ; I#4: ; I$4: ; I%1UX Y &1' U(41% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I 41 .? : ;' !.? : ;' I@": ;I#: ;I$.? : ; ' I@%: ; I&: ; I'4: ; I(4: ; I)4: ; I*1X Y +1,: ; I -4: ; I. : ;/1UX Y 0 U11X Y 2 34141UX Y5161X Y71X Y84: ;I9.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I .: ; ' I@ : ; I !4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II&< ' .: ; ' @: ; I : ; I : ; I4: ; I.? : ; ' I@ : ; I!4: ; I"4: ; I #.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I 41.: ; ' I  : ; I!: ; I"4: ; I#4: ; I$.? : ; ' I@%: ; I&4: ; I'4: ; I (4: ; I )4: ; I* : ; +1UX Y ,1-1X Y. /1X Y 0 U1 U241% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I ( : ; )1X Y *1+ ,41-1UX Y . U/4101X Y 1.? : ;' I@2: ;I34: ;I4: ;I 5 : ;61UX Y71X Y8191X Y:.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 < &I $ >  : ; : ;I8 I!I/ ' II& : ; I8 .? : ;' I : ;I: ;I4: ;I.? : ; ' I@: ; I .: ;' I@: ;I : ;I4: ;I: ;I4: ;I .: ; ' I !: ; I": ; I#4: ; I$.: ; ' I@%: ; I&4: ; I'4: ; I(4: ; I )1X Y*1+ ,41-1UX Y.1/ U041 14: ;I2 : ; 31UX Y4415 161X Y7.: ;' 8 : ;94: ; I? < :4: ; I?  % $ > $ > : ; I  I : ;  : ; I8 $ > &I ' I I &I!I/  : ; I8  : ; I 8 .? : ;' I : ;I4: ;I: ;I.: ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I4: ;I 4: ;I: ; I : ; .: ;' @!: ;I": ;I #: ;I $ : ; %1X Y&1' (41 )1X Y*41+41,4: ;I-1UX Y. U/4: ; I 04: ; I? < 14: ; I?  % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' : ;I.? : ;' I .? : ;' @: ;I: ;I : ;I .? : ; ' I@!: ; I": ; I#: ; I $4: ; I%1X Y &1'.: ; ' I@(4: ; I)1X Y *4: ;I+ : ; ,1UX Y - U.41/ U04: ; I 1 2.: ; ' I 3: ; I4: ; I54: ; I6 7: ; I 84: ; I91:41% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I !1X Y "1#1X Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I : ; I .? : ; ' @: ; I4: ; I4: ; I 4: ; I!.? : ; ' @% $ > $ > $ > : ; I I&I.? : ; ' @ : ; I : ; I : ; I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I & &I I !I/ $ > 4: ; I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I: ; I 4: ; I4: ; I 4: ; I 4: ; I!: ; I ".? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.: ; ' I@: ; I : ; I 4: ; I!.: ; ' I ": ; I#: ; I$4: ; I%.? : ; ' I@&: ; I': ; I(4: ; I)4: ; I *4: ; I + : ; , U-1UX Y .1/104111UX Y 24131X Y 4 5.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I .: ; ' I@ 4: ; I!4: ; I% $ > $ > : ; I  I : ;  : ; I8  : ;  (  : ;   : ;  : ; I8  : ;I8  : ;I8 ' II' &II!I/ $ > &&I : ;.? : ;' I@: ;I : ;I4: ;I.: ;' I@ : ;I !: ;I"4: ;I#4: ;I$.: ;' @% &4: ;I '4: ;I (.? : ;' @)4: ;I* + : ;, U-!I/..: ;' /: ;I0.: ;' I 1: ;I2 : ;31X Y415 U61X Y7184191UX Y:41 ; : ;< : ;= >1UX Y?41@ 1A4: ; I? < B4: ;I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I : ;  &I.? : ; ' I@4: ; I% $ > $ > : ; I I : ;  : ; I8  : ;I8 : ;I8 .: ; '  : ; I : ; I .? : ;' I@: ;I4: ;I&I.: ; ' I@: ; I4: ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ;I4: ;I : ;.? : ;' @.? : ; ' @1X Y  1!1X Y "1#: ;I$4: ;I%: ; I & : ;' : ; % $ > $ > : ; I : ;  : ; I8  I.? : ; ' @ : ; I 4: ; I 4: ; I 4: ; I 4: ; I.: ; ' I : ; I&I.? : ; ' I@: ; I 4: ; I1UX Y 1: ; I1UX Y  14: ; I?  % $ > $ > : ; I I : ;  : ; I8  : ; I8 .: ; '  : ; I .? : ; ' I@ : ; I &I.? : ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I1X Y 11X Y 11UX Y  .? : ; ' I@4: ; I% $ > $ > : ; I I$ >  : ;  : ; I8 .: ; '  : ; I : ; I .: ;' I@ : ;I: ;I .? : ;' I@4: ;I .? : ; ' I@: ; I4: ; I4: ; I4: ; I U1X Y 11&II!I/ 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I.: ; ' @: ; I4: ; I4: ; I.? : ; ' I@: ; I&I: ; I 4: ; I.? : ; ' @: ; I 4: ; I 4: ; I4: ; I !I/ U% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  < I !I/ $ > ' II&I : ;  : ;I8  : ; : ; : ;I8 !I/.: ; ' I@: ; I: ; I4: ; I.: ;' I@: ;I: ;I4: ;I : ;I !: ;I ".? : ;' I@#4: ;I$.: ;' I %: ;I&: ;I'4: ;I(4: ;I )&*4: ;I+1X Y,1-1. /410411.: ; ' @24: ; I 34: ; I44: ;I 54: ; I6 U74: ; I84: ; I 9.: ; ' I :: ; I;: ; I< : ;= : ;>1UX Y?41 @1X YA.: ;' B4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > .: ; ' I@ : ; I4: ; I: ; I4: ; I.: ;' I : ;I: ;I4: ;I.: ; ' I : ; I: ; I4: ; I4: ;I.? : ;' @: ;I4: ;I4: ;I 4: ;I : ; U!1UX Y"1#1$41%41&1UX Y'1X Y (1X Y )I*!I/% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  .: ; ' I  : ; I : ; I4: ; I .? : ; ' I@: ; I4: ; I4: ; I4: ; I  : ;  U1UX Y 1 U41 414: ; I&I4: ; I? < % $ > $ > : ; I : ;  : ; I8 .: ; ' I@: ; I : ; I 4: ; I .? : ; ' I@ 4: ; I 4: ; I4: ; I U &I% $ > $ > : ; I.? : ; ' I@: ; I : ; I: ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > I !I/ .: ; ' I@4: ; I 4: ; I.: ; ' @: ; I: ; I4: ; I4: ; I.? : ;' @: ;I4: ;I 4: ;I: ;I .: ; ' I : ; I.: ;' I : ;I: ;I 4: ;I!4: ;I" : ;#4: ;I $: ; I%4: ;I&1UX Y'1( U)41 *41+ 1,4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I 4: ; I I&I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ >  I$ > : ; I&I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I.: ; ' I : ; I.? : ;' I@: ;I: ;I4: ;I4: ;I4: ;I1X Y11UX Y: ;I : ;I 4: ; I I!I/ 4: ; I % $ > $ >  I$ >  : ;  : ; I8  : ; I8 &I .? : ; ' I@ : ; I 4: ; I 4: ; I: ; I4: ; I4: ; I I!I/ 4: ; I % $ > $ >  I$ > .? : ; ' I@: ; I: ; I 4: ; I 4: ; I &I% $ > $ >  I$ > .? : ; ' I@: ; I4: ; I 4: ; I &I : ; I I !I/ 4: ; I % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I4: ;I 1UX Y1 U414141  % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I1UX Y11 U4141 41  % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41  % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' @: ; I: ; I4: ; I 4: ; I 4: ; I  ' I I I&I!I$ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > : ; I$ > .: ; ' @.? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I $ >  : ; (  : ;  : ; I8  I  : ;  : ; I8 .? : ; ' I : ; I4 &I.? : ; ' I@: ; I.1@1.? : ;' I@: ;I4: ;I: ; I 4: ; I: ; I 4: ; I U4: ; I U 4: ; I !4: ; I "I#!I$: ; I%&&&I'.? : ; ' @(1X Y )1*1X Y +!I/ ,4: ;I -4: ; I?  .4: ; I? < % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I$ > .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I &I: ; I: ; I 4: ; I4: ; I4: ; I? < % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ >  : ; I : ;  : ; I8 .? : ; ' I@ : ; I  I% $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ > : ; I : ;  : ; I8 .? : ; ' I@: ; I  I &I &I 4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I 4: ; I 4: ; I I !I$ > 4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > $ > .? : ; ' : ; I.1@1 .? : ; ' @ : ; I 1UX Y 1 .? : ; ' I@4: ; I.? : ; ' I@4: ; I % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I@ : ; I 4: ; I 4: ; II!I/ .? : ; ' @: ; I : ; I .? : ; ' I@% $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3  ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et./../e2fsckmke2fs.cext2fs.hbitops.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hext2_types.hext2_fs.hcom_err.hext2_io.hprofile.hgetopt.herrno.hext2_err.hprof_err.ht@@OE3[?[G1Xg[Wg~XgZ@Jg Xg}v!Ywmw%>wGKأg}h $#=hf0=v!K="XZu/#=Y<uJ^K=Ku"r{wYV#=$  ֑{?= !K>iكg!v0"u=YRMAT"u <ɱ+/e$! u@=a+g?tr=`XrKY>u=>mi!=/׃Z"-K>h =tg0YYl<^ <d'vOu{//qJ"y]i#f|yyuZC  #gm!h=Yf!YJ"~ ։Ke?a <w䟟tl0u o<n0N"ig%kyYuOuxYKpuzuw1yt f}j"tJyJkt~Ȼzo (ztx;ugY廻= ~J#~tWwlwwu<vfpeYksnzyxGD.XK~K""  hX gY {Ptuuɮ5f1.*$ _Yuy<K>Y{|!kX/ 9(<}tX$!?g0 $0| f֠="Cyu埓={K׻OtK{<>i~J|t*W{J {QK׃@/#eA$Vzg}}<1<Zw(jr.Ifh#ذ&>Dhv  ϑϑ0=vΟ̟K׭-Jh$ײʭɰɻ}<<t kgK/ ׃Rgz.~ft0 <gJ[حu!uJz|E _t  Mwt|fvgx&K !vK u\|}{dJy|<|>r>sp@ Q /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/ext2fsutil.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hcom_err.hext2_types.hext2_fs.hext2fs.hext2_io.herrno.hutil.hT7@g+\<yK//kY<z>v%ȕv!ng=vK=Pl/x=^<$ tQ fL>T䢟z t Jmf!=r<x"t>=u=I  f!PX潜WM=@+ ./../e2fsck/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/etprofile.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hdirent.hcom_err.hprofile.herrno.h <@?Y<=WYZ=oȄkJuYKZ,=Ivf%hKp|t[=guAYKj tK J!mJCuYuB=/ tgut .OzX֭uut/KvuuuK ֩[t~==gvuu]xKOuvv^rt OMY<g#zbuvtL&/MJiJnrtJ&/MJhJmqtlvf7JYH#ׁzYYYgCu tvet/`tto0p#둮hv>`vQgfKR5Xry.u~jTfY)" x KY Xu!x fvJw}tg/? v J~Y fvJ ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc_tables.cext2fs.hbitops.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hV@&"w Xvf= v<0=r .vp$v(#  <vXBQ h> Xw fvAZ~ v=uh  v fw fv֕v w fw<iYY wJ=Yy YZvg vJZ~w=uN<tf fv$d!xztv ../../lib/ext2fs../../lib/etbadblocks.cext2fs.hext2_types.hcom_err.hext2fsP.h@\@  XjJy?OLz.K =M> tYxti=Wy>w /u<>]:[?(Axtg=uvuf XtxXx?~&\>4KU`>p^fgwttt Ww > wguf  vD/vwt"! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etblock.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hd@-|XOY<֠C<Cu6<u\h t==tK0u>et. =w= fh!OY>C>Au8<"u\h t=K0u>ct.J?= ffJ~zx tggggw!yg Ȣȉ#~zz~g><ί` /uuu>gZp gvhX)/~XUJY qȏggZK~JC>u֭ux.<~"~u tKgp'<ZxMgsK"u>zigh! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etclosefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.hq@MZ4zX^[=]E7X vf 5> huuuYuap#u=hwuuiJ~hnY  hiZ0u+Xu gl~ "w7It-qliXJftww._!XyJ  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etexpanddir.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h`z@%teuuvitwc<"XYH'g&t]=t bux  JwtYhfXXwt<w<5 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etextent.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hext3_extents.hcom_err.hext2_io.hext2fsP.he2image.h|@kv) <iʑu2gguqy]u "uxtw=XYhifYg f[t%t]t|t  ~g ~v'J0gvAg=t @uv~,w//uM=tx=t׫?zuv=wLׯMȣaX 0h t~u!#"!  gutg tl)x!uv).~<8!=&@u!6Xp<g~+twAg它w guwȟuYuwuw֢\xȻxf=hwjYgigw#=-MfYvxfuu^uhxtu  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etfreefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.h@@ yftguwufwUdbtguwtwi>#_KK tguv tguv tguv tguvuuuvu fYuwtguwtw fwA ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etgen_bitmap.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@9=E..E .%l$'Xwht ../../lib/et/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includegetsectsize.ccom_err.herrno.h@'l tu. XF  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/eti_block.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h@M x,ggڣM x,ggڡ!}=9  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etind_block.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.hP@/ ;KW<<vf     /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etinitialize.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hĥ@wy>t=}ֻ<w<J=w<w>ghg=/ggɻ6tzt}wss֑/i={!hv!ɯ=uukugxJd!twtiKg=(Lwʑ55 yC$#Au tj =u/L c C <wH X ~g= C>=>0u=ghgXvuwuQvuYxJf=uug= 3$g=uftg=\=u~Jh <0v.urLJg0|<?wftuw f.w.uutvw<JwXfYc{J!uظ- X˭%L,1!Ԡ !qlo&@1=$&mJhilm"Dt[uguguh+`M$yXmfg0~< "gOky1st=oXmfp=Yz>Yxo=n5uKhaYKur /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etmkdir.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hL@"v fKtwz!z/|==!ɲu&c"v={u{xJfL /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etmkjournal.cext2fs.hstddef.htypes.htypes.hstat.hext2_types.hext2_fs.hcom_err.hext2_io.hjfs_compat.hkernel-jbd.herrno.h|@`[uXvuJ Xw< Xy<_)]~J\"DK{n.Xo.yuYu^[\"X1RY"t WZ>u0  J׼iJ2̑{fik~"w-uvhptwXye (-t~h|fxKki~wguguv x$guKK,ՇuLxw.Kxw<zgKufzt't|t֒zt ftz~j2(</&!tbtyJ Z%1ȫYV*Xi=. ,tyb V  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etnewdir.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@wvvg4YKKgk=KgKKltv#XtwX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etopenfs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.he2image.hd@hKz.^9hF\:hy._}<Zo" u  qJ* wiuf=w<岼=vˑ>K>lޱ+u <% tugG<w?Jw#><wJx0hu=gU</ufȑw7)<xgxtb>xXyXihhiv>r< gtXtYQivhr< gtXdxtxtxJ+gImfguzfgu  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include../../lib/ext2fs../../lib/etundo_io.cext2fs.htdb.hstddef.hext2_types.hext2_fs.hcom_err.hext2_io.herrno.h@@X=X= vuuhhvF=pu#9I2xJj=*u;2x.`@= b!w!Xattw|. J>ݓ9gxZw</&.x1K+ Ruvuugvgl<) ]X <@?<u.Nבλgo _MqnXex= yLuMqv.}gJ# pJl}&ZɣZ%X/guytguw"yfy.y<J=y<=uuuvh{Q: tvwuy<yXyY  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/et../../lib/ext2fsunix_io.cext2fs.hstddef.htypes.htypes.hstat.hcom_err.hext2_io.herrno.hl@k=*ux.`.>rkvtu0q Xx Ȝ Mpu <JiKLiZttj=*2S X|<gggzg'b \svf gw<!Y=mfsgK{Xu%R!inFJQ4U=v<fzz"u/M$VLr"gKX=!w/g}vtXoKt=t$p t|uuvKfYuyyf f^tuuvJs?y. v X=tZ=uNpxt .pa=pl|"tguztguz~ zfzz<J=z<=uuuvg#g@6t XXzv[KtkzX@Yo ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@g*uVXZlK= <yf<~x!t zn~"cit .}7}kfKg>~x!=sJ Zj|h x Xtxh f!wpzxXZȕcKNUI}~v!=X~vvl\d] ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc_sb.cbitops.hstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h| @-wkuL~yt~~<  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etbitmaps.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.hh @g[jJg[Og[jJg[sJgMtXgMuXg0vz>wgxq.hxg. vXvk(^t w.w?"kJ>z>y>z>V9 ../../lib/etbitops.ccom_err.h@K,LhJ ../../lib/ext2fscrc16.cext2_types.hcrc16.h@;myX JE  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etdirblock.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h@!w/=OO>m.J> .g3#<Qg /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etdir_iterate.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.h@g;"X )#0j.>K>"gNY~.Kg>bJN8S8ugw~?/Z8Ov ~XiwggtvwX<_Ou[~nxX`t {[xuLthu+YL夔f t={ yfK~Ȼ $f~vu~>$i8~fɠJ=&0x'*f&Luh$~XZY1 $'~guk.'vu& .@0 /=r Yugfj u. Jv<<x/r@Mvw(<u!G#>"u2a=e< < f!bք<{=0<t  "5h2'u<Y$  f !uEf5CuivJ<{YeX_'yfK"yfJ"u Kx Zvju".֟y?,ufcf#@ ޮ = uKZP\f"<<y r=?=Mh~f-Bv>iot> <=gn (_$fN^> %kv@  y=/>Б <wx>Ⱥm}tz] Juf<@g=gu8/Ktt@w<xt tX  X*k=jft% th"g=gwZlz$ʻ <i Xf<#.DuAtmf$Zgl tJlX f ]֓w !O#s hOw.gY[hv|\ttJgn.P>S,<N2XqunfpttY~f8u.P/.j=gl"eAm3!!tbef$fb]_?nfuXch.YpY<>.uyX#%<;Z'e!iɟewv۳z@u<fs rX y .$ȭl?/g"r .~fyv+Kguggg̑.#iBY.~uY~gg>(Z  f!~+Y Au0Q~/fD fqEOfz .lX~Au~f  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeerror_message.cstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.herror_table.herrno.hXf@D[BXxdtu!gtWt/gOu2]ftgYK{6p.J%ktMpt"mtUwguhYpXltXzt'.X=~th0 f "=`-wK!t Jy K- et_name.ccom_err.hj@ tKY]> /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.hj@1=g.gZKk90=YG.uKhNK1=sxXu&~=  Jw[uuNrtJ$/] 1gFEDO&Kz0Nt J1  ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systag.clist.htypes.hblkid.hblkidP.hm@ggQYxXNYY~M .sM"RJM6uM1* P[w.w*J'tyT{'?4gxf f=oJ{ycXfg,h}X7JsX= .sf=_.uu=Iug=itJYf?vYgΑwYv=> X~i#Yyf5fJ\wYlك] uKXsY g<c<=Y=.׼tc=g=t&sdOv<c<=Y=turq ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syscache.clist.htypes.htypes.hstat.hblkid.hblkidP.ht@M\[xtMYB򄼄nXt3 3xw3 0[Y.guF@tz g//}#Y!ׁ2u@i3i=Y=h ."iz$KL=hu歠בh-z0>zxo -s|!Y!=!=!=gAr )qiEgk.iEg8.tYeJkl<tffYjJf7 hnJ gguu tuuK?S |<t|[u|<tw>K?S?"\{{<{< ufA{XNMvX X]"{tf[ /|) >Y24?{<t{tf~֭/Yx.<~Z!pX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidread.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.h@wY!_u fk<[vVYC{>-[1'H}?h(ױ>Tf-fO= Y=1tKuhKKS<K+ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidsave.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.herrno.h@9 P#Nt6.vt1خ,X|Ku僭 u0X</ɭuzH f(^. /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidgetsize.ctypes.htypes.hblkid_types.hblkid.hstat.h@=wa3l .D .v$pJ ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cblkid_types.hblkid.herrno.h@vAyX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysgen_uuid.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.htime.huuid.huuidP.herrno.h<@ !W??K/xJKucJ/W ftx< v .gwJ~+'hlYhK!,<KK~Xv~ɻg/Juf<'f*X?9v=;: isnull.c@&<]s+1k /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includepack.cstdint.huuidP.h0@&/====>ZK>hK>hK>hm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.h@&=uuun /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.h@3B gzJgzg8A ../../lib/ext2fsfeature.cext2_types.h@u dtMYgt 億p ֱu dtMYgt 億p ֗uuPJ/m+.Lurt6 +RK J_#R_37]f.;X.u tuuRt;g=~.oXoX JfoXoX JS  hashstr.c@/.utR[xt^ȢsZ" parse_num.c@x#vvv  m/mXXnJyJG ostype.cH@,]dux A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@M#~K/giLNXtgfuw~K= Q<0ML A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hl@"gi~fhg[Lt=u. J==u=  g~uu9<ׄZ> K/r.MA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hP@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hx@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM ctype.c@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.hй@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDc4 ../includesort.cstddef.h@ 8j*@ڻ+@8/Yy. Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.h @)Xg[ye_< rindex.c@*xG=v,02K ../../includestrcasecmp.cstddef.hbsdtypes.h@3=L=]d$Z3zi=e"[91eu;K8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V 9 strcat.cP@"?; index.c@*8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@@;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h`@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h@@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=lsC ../../include/arch/i386msleep.cstdint.h@*<xK-!ĠK-Ksg&zX3 pv.c@=xi=eN ../../../include/arch/i386get_tick_count.cstdint.h@ >{ ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf  ../../../include/arch/i386../../../include../../include/sys../../include/netinet../../includenet.cstdint.hstddef.htypes.hsocket.hin.hnetdb.hio_struct.hstdio.herrno.h@(<>ʯʯA7yy5ZV>1b v< .SA7k~Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~ ../../../include/arch/i386../../../include../../includelink.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@*$T0i9i-/3;/[x.jgzP ../../../includemisc.cstddef.htypes.herrno.hp@&"V0",0#U/#U/gp ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]D ../../include/systime.ctypes.htime.h@!<=gw]9 ../../../includeuser.ctypes.h@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.hP@i+G ../../../includemktemp.cstddef.herrno.h@+?82Y t2,I,Ii.i. >绾;/w X hC ../../../include/arch/i386rpc.cstdint.h`@!X@Kxx< [T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ 3 sleep.cp@=xM ../../includelost_path.ccollections.hstddef.h@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c@=gP ../../../include/arch/i386add_intr_handler.cstdint.h@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h@3g==hwfA\jg;"xg;KW ../../../includeasprintf.cstddef.hstdarg.hjprintf.h@,K #ugKs/ %JY^JDI <9uv[1 fA\u ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.hP@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h'@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h)@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io ../../../include/arch/i386../../../include../../include/sys../../includetime.cstdint.hstddef.htypes.htypes.htime.hio_struct.hstdio.h?@Bz< \T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h0F@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.hF@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hG@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.hG@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hH@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hI@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.hI@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'\ ../../include/arch/i386../includenetwork.cstdint.hnetwork.hP@-==t{o>i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h`R@?Dx ?Dx =3 puts.cR@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.hR@ ic?9 fi='=% wait_for_rpc.cS@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.hS@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.hW@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h[@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x \ strtok.c[@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h\@(JgKwp@| P@!AB F| 4t@AB 4@'AB 4@)AB \.4@AB Q.4@(AB T. 4,@1AB F.Y. J. 4`@)AB FP. 4@AB FI. 4$@`AB FT. 4 @AB F`.4( @DAB DN. 4l @aAB FW. (4 @PAB IM.. `.4 @@AB D[.$4` @AB FL.].O.(4 @AB Fg.).U.<4@`AB IY.t.y. X.V. b.P.Y.a. J. 4H@AB FM.84@rAB I^.W. j.T.Z. K.f.Y. J. 4H@AB Ff.04@AB EI.P.^.L.^.k.^.$4@AB FS._. o.4@DAB BZ.4@WAB BL.$4`@D  F AB Dj.H.s..Y...~. ].w.\.[.P.g.P.m.r. Y.w. Y.M.t. J.k.n.a. H.O... M.\.o.E.r. F.N.N.h.X.P. Y.y..h..r.W. X.T.z.t..j. q.[.H.!.].~. f..... _..K.| T7@3AB f. 7@AB FP. L8@AB FP. :@AB DH.:@AB L. l;@AB DH.b.V.;@#AB DF.|  <@AB 4<@AB T<@bAB A<@AB B{.\=@;AB Da.$=@kAB B\.f.U.>@9AB DY.@>@?AB Bu.>@=AB BS.>@AB Q.$>@AB FJ.o._.$d?@AB F\.S. P@@4AB BK.R.@@5AB D[.D@@AB F.^.t.G.L.}.w.R.N..M.(xD@%AB I[.R.\.(E@AB F.o.. pH@AB FO.pI@AB E^.I@AB DY. J@AB FY. |K@AB Fa. 8L@AB Fa.0L@AB FZ.X.l.m.k..(N@AAB FH..l.O.4P@LAB FE...\.].y.|  dS@cAB Dl. S@AB H.|  S@cAB Dl. DT@AB H.| d \T@1AB  d T@AB Fe.d TU@AB N. d pU@AB Fe.| $ V@0AB F. [.< 4W@AB F.O. d.J. p.. ..  \@7AB B[.|  @\@zAB B \@AB F. \@ AB A. \@TAB BZ. 4]@ AB A. @]@NAB A ]@ AB A. ]@ AB  ]@[AB E ^@ AB A. ^@!AB Y. 4^@ AB A. @^@VAB DP. ^@ AB A. ^@ AB F. _@ AB A. _@AB FJ. `@7AB BS. `@ AB A. `@AB H. `@AB H.| a@AB DS. a@AB F{.,b@ AB I{.a. k.b. M.| d@AB AS.0d@OAB F. S.m. B.. (g@XAB F. V.. H`i@MAB Ir.$. @.z. 6.. g.. g.. q@2AB h. | q@@AB E$r@QAB  xr@AB F@.(t@&AB $Pt@AB F.C.lw@^AB Df.|  dw@AB Fn.d|x@.AB D dx@oAB F.dz@AAB D| $`z@AB Il.{. o. \{@1AB Fn.| X|@?AB X|@AB FX}@lAB Ba.X~@AB B,X~@AB F#.Z.. X@TAB E. X@uAB FU.X@AB R.(X@MAB FI..m.8X@BAB In._...x.*.c.$X8@%AB Bb..4X`@AB I.u.~.,.k.. X @AB F_.(X@KAB F}..l.| @@vAB Df.@WAB Db.@ AB A.@AB Ep.|  @ AB   @ AB  @ AB  $@9AB  `@MAB F @rAB Fd. $@nAB F`.  @WAB DA. @WAB DA. D@3AB D_. x@(AB Fe. @lAB EE.  @'AB ].  4@%AB [.  \@HAB b. Y. @AAB Z. @uAB Fm. `@BAB Z. @BAB Z. @zAB De. d@AB Fv.|  @?AB DG.,L@jAB FE.t.|.d.| @7AB H.| H@AB FH|@AB FH@FAB C| P@+AB `.|@GAB `.|  ĥ@ AB Fd.| @@>AB A@@"AB @ @+AB @L@AB F@а@ AB (@@AB Fs.i.X.@@AB Q.(@@AB FQ..g.$@ȴ@AB I|.~. @@vAB Fa.@ @AB Q.(@<@AB F$.H.@T@AB Q.@p@AB Ea. @@AB Ie.@@^AB D_. @@mAB Fb.|  p@IAB Cn.$@AB Fr.^.$X@AB Fr.^. @ AB FJ.|  0@@AB IG.0@@AB M.| X@GAB y.| @`AB C. @JAB Bc.| 0L@/AB I@. [.%. e.c. g.| L|@vAB  L@AB Fd.(L @eAB Fn.. K. Lt@}AB FX.(L@AB IV.. . L@AB IJ.| <@AB BU.| pd@2AB p@,AB p@/AB  p@AB FR. p@AB FW.pH@!AB W. |  0l@AB H. a.0D@JAB n.| @AB AK. @AB Iz.@%AB [. |  @AB IP.|  0T@AB FG.0@LAB 0T@AB 0h@AB  0|@AB FU.0h@/AB 0@AB 0@AB |  @AB  @AB  @gAB Bt.  H@]AB BG. @?AB n.  @AB FF.4 @AB I.O.J.|. o.g. X.( @AB F.x.G.  @rAB F`. @"AB F.( D@AB I.o. t.( @AB FP.. K.| !l@<AB !@AB F(!H@ AB Fn.w. D. !T@yAB FI.!@/AB  !@eAB FR.,!h@@AB F{.s.\.U.^.!@AB S. (!@AB Fe.S. q.0!@AB Fc.t.h.._.!@AB S. !@AB Fy. !@AB BH.!@dAB Et. !x@eAB Fn.!@qAB F(!T@AB FX.N.O.,!(@~AB FP..o.G.I.| $@1AB  $@AB Fw.$$@;AB FD. Y.$$@AB Fd.t. $@AB FT.($ @AB F.o.M.| $x%| @AB FV. f.| %h @AB T. % @AB T. % @AB T. % @AB T. % @AB S.% @AB S.%( @AB Q.%D @AB Q.%` @ AB A.%l @ AB A.%x @ AB V. % @ AB V. % @VAB DB. %@FAB y. %X@ AB A.%d@ AB A.%p@ AB A.%|@ AB A.| '@?AB [. W.| '@4AB B|  ,(@AB FS.,(@AB N.,(@"AB ].,(@AB N.| (@-AB Bf.((@AB Fm.. .((@AB Ec.]. M.O. (@.AB d. |  `)@AB Hf. {. `)@9AB F.| )@ AB )@+AB ) @AB Dg. )@qAB Dp. c.)@IAB Di. )h@+AB `. )@RAB D@. )@IAB C)4@AB )L@AB )d@&AB BX. )@AB F$)@TAB Fc.T.J.$)l@AB F[. k.b. $)@YAB Fs.T.)P@AAB B)@ AB )@AB )@AB )@>AB A()@AB F[. i.v. C. )@nAB FH.)L@$AB D)p@DAB E )@UAB D_. P.R. ) @ AB )@ AB )$@AB )4@"AB )X@ AB )d@ AB )p@AB )@AB )@AB F)L@AB )T@AB )h@AB )@AB  )@AB Bj. k.)H@AB )X@AB )l@AB $)@AB Fs. y.)T @AB )h @AB )| @AB ) @AB ) @AB $) @AB E^.X.W. 8)!@AB FF.W. m.o. J.U.R. ].()4#@AB F.l. . )$@'AB DG.O. )%@*AB DG.R. )0%@*AB DG.R. )\%@AB BQ..,)L&@AB Ef.B.f.N. W.)((@NAB Bh.$)x(@AB I}.d. ,)D)@AB Fq.r.G. .$)*@AB FJ.m. ()+@AB FV.z._.D. $),@-AB FR..<)-@AB FM. o.l. w.q.K.M..h. k.p)0@|AB FM.v.R.l. v..d. f..f. S.r. Z.e. t.S. S..m. S.}.Z.P. _.S. ) 7@ AB V. ,)@7@AB FS._. n.Q. [.()7@AB F|. I.Q. )8@AB F.()H9@+AB F.\. F.8)t<@AB B\..]. _.t. V.a. J.U.)4?@"AB N.()X?@AB FN. h.. )A@AB Q.)$A@*AB DG.$)PA@VAB FI.t. $)A@tAB Fj.f. )B@;AB DM.X.)XB@)AB DG. )B@AB EG.f.$) C@AB FJ.N.<)C@AB F.U.V. `.u. \.h.d. W.()4F@$AB FQ. V.Z. ^.)XG@AB F0)H@AB F.].g.a.n.f.)I@)AB DG.()I@AB Fn.p.o. )K@AB F.0)L@AB F. R.P.W.G.P.$)4N@aAB Fz.L.()N@AB Fj.\.].J.h)O@AB Ft.U.n...K.T.W.X.x..Z..a.D.~..O.a.`.`.a.4)U@BAB FS.Y.\.a. ].I.o.[.)8W@8AB Dg. ,)pW@ AB F]. ^.t.Q.W. )|X@'AB DG.O. )X@*AB DG.R. )X@*AB DG.R.)X@"AB B8) Y@AB Fn.a..y.w.i.U.^.Q.4)[@_AB FH.~. A.y.Q.].Q.,)X]@CAB Ff.l. d.0X.]. )^@EAB Bf.U.)^@rAB FY.C.`. S.. P.a.r. N.r.|. `.K.j. L.G.C.|. I.X.R.G.x.V.S.V.S.}.P.T.R.W.s.| 9Xf@AB 9`f@AB (9hf@AB DY.\.j.W.X. 9dg@AB BV. 9x@AB T>x@AB  T>x@&AB DE.P.(T>x@AB Fx.).Z.|  >z@@AB FS. >z@hAB FU.>L{@AB H. >`{@LAB FF.(>{@XAB IC..T.$>}@AB FS.}.| ?}@)AB ?}@AB ?}@`AB C?H~@AB ?P~@HAB Be. ?~@6AB F.?@#AB W.?@2AB D_.?(@3AB DO.?\@0AB ].?@0AB ].?@5AB DO. ?@ZAB FH. ?P@:AB BW.P. ?@AB BW.S.? @@AB Bg. ?L@AB DI.f. ?Ђ@@AB BZ.M.(?@AB FZ.M.G.q.?@*AB ?@:AB ?(@CAB $?l@AB HS..^. ?@AB Fe.$?@AB Fk.. (?@AB FJ..b. ?X@AB F_. ?@(AB If.4?$@dAB FI.. U..H.U. ?@AB F. ?,@fAB FM.?@`AB E.o.?@`AB E.o.?T@aAB D?@PAB D$?@AB IP.q.?@AB DA.?(@AB DA. ?@nAB Ik.| E@LAB Bn.Ed@5AB D[.E@OAB Bu.<E@AB IR..E.U.C.L.T.a.b.|  E@AB Fx.| E@?AB DG.$E@AB FH.Y.| HF@GAB y.| (xF<@dAB EF.E.\.a.$xF@AB Fs.^. xF$@AB Fx.xF@AB Q.4xFԥ@AB F}.!. N..h..X.xF̨@AB H.xF@+AB DR.| G@ AB | G0@VAB | G@nAB A|  H@_AB EI..@HX@AB Hl@AB H@AB | H@AB Ec.H|@AB Ec. H\@AB F~.Hp@AB R. H@AB De.H@AB De.| pI@AB Ec.pI<@WAB D|.| I@AB DI.| IH@LAB Bd.I@QAB B_.| LJ@AB E| Jl@AB E| JP@'AB E| Jx@_AB E| K@AD K@AD K@/AB K0@AB KP@AB Kp@AB K@.AG K@/AB K@AB K@AB K0@4AB Kp@AD K@AB K@AB | Lй@AB L@AB FIL@AE EL0@?AB FLp@VAB FL@3AB D| HM@AB F| |M@AB F| M@KAB DD| M @QAB B| N@)AB D| HN@~AB FHN0@tAB F| N@AB F| NP@<AB AD| O@.AB | 0O@>AB A| `O@-AB A| O0@JAB FI| O@AD | O@AB F| $P@@AB F| XP@9AB XPP@AG FXP@hAB BXPP@AB XP`@ AB XPp@AB FXP@ AB XP@ AB XP@oAB FXP@@#AB XPp@!AB |  Q@vAB FIFQ @AB  Q@@AB AFFQ @>AB |  R`@dAB F R@oAB F R@@AB E| R@@:AB DR@1AB R@1AB R@0AB R0@AB RP@IAB FR@AB AR@AB ONRP@YAB XR@YAB X R@AB IFF| S@AB S@JAB ACS@jAB AF| PT@ AB PT@AB | T@ AB | T@&AB T@'AB T @AB FT@gAB AGT@AB T0@AB MFT@_AB LT @GAB FFTp@AB LT@AB T0@AB FT@@AB F| 4V@&AB 4V@@ AB 4VP@&AB 4V@ AB 4V@AD 4V@ZAB F4V@qAB F4V@9AB 4V@AB 4V@AB F 4V@AB IFF4V@?AB D4V@vAB | WP@ AB | W`@IAB DW@IAB DW@IAB DWP@AB EWP@_AB DW@%AB W@%AB W@aAB  W@AB MFFW`@WAB DW@qAB DW@@AB W`@"AB W@IAG | dY@AG dY@AG dY @yAB CdY@ AB CdY@AB FdYp@KAB dY@RAB AFdY @AB OdY@AB OdY@tAB LFdY@IAB dYP@AB LdY@ AB dY@AB EdY@"AB | ([@]AB D| X[0@;AB D| [p@AB [@ AB | [@AG [@qAB L[@@"AB | 0\p@ AG 0\@AD 0\@AG 0\@AG 0\@$AB | \@AD \@AD \ @ AG \0@ AG \@@ AG \P@AB  \p@AB FHE\@@EAB D\@AB FI \P@AB IFF| ]@AB | ^@AD ^ @AD ^0@AD ^@@AD | ^P@AB C^P@#AB ^@AB E^ @AB F^@&AB | (_ @AG | T_@@0AB | _p@"AB _@#AB _@AB _@AB IH_@AB _@ AB | ,`@AB F,`@AB F| ``@AD `@DAB E| `@dAB F`@@+AB JI|  ap@ AB | La@7AB CLa@AB FLap @AB FLa@ @AB F| a@@ AB aP@AB ap@!AB Da@ AB a@ AB | pb@AB | b@AB | b@;AB b@@!AB bp@JAB IFb@"AB | Dc@iAB FFDc`@AB FIDc @!AB | cP@$AB c@AB c@ AB c@NAB Dc@AB BFc@NAB Dc@\AB Dc@@kAB Dc@jAB H| d @AD d0@AB d@@AB d`@ AB dp@AB Dd`@+AB d@-AB d@.AB d@AB FKd@xAB Ddp@aAB Dd@AB FFdp@AB Dd@zAB Dd@#AB  d@fAB IFFd @RAB FFd@EAB Dd@UAB FFd0@UAB Fd!@RAB Dd!@AB IId"@6AB Cd%@AB d %@AB Id&@AB F| g'@bAB EgP(@AB gp(@GAB g(@HAB B|  4h)@dAB FLG4h)@AB F4h@*@'AB 4hp*@AB F4h+@EAB A4h`+@0AB F4h/@uAB C|  i?@ AB  i ?@ AB  i0?@RAB I i?@ AB | i?@AB Fi@A@'AB ipA@AB iA@AB iA@ AG iA@ AG iA@AD iA@AB AGiE@AB E| j0F@6AB jpF@AB jF@@AB FFjF@AB | kF@ AB DkG@OAB Gk`G@!AB | kG@?AB |  kG@dAB FGGk@H@[AB HkH@(AB | lH@AB lH@0AB l I@ AB l0I@0AB l`I@ AB lpI@`AB FF| lI@AB | lI@QAB AlPJ@*AB lJ@mAB FlJ@mAB BCl`K@rAB FIlK@7AB Dl L@DAB FlpN@AB Dl O@AB PFlO@+AB | ,nP@fAB D| \nP@rAB E\nQ@AB D\nQ@uAB D\nR@IAB | n`R@AB nR@AB nR@AB | VRAtpQAtlWP?WDEuEGuG0tD`P`fSjmPmS0SD[R[hWhjRj0WD[Q[gVjVV'0VD  t0`jQvxQQPQ'Q`jt`~t`Pt`P0t``jt\'t\.0t\`bPbjtptpP'P01u13u3dt09P9bVdeuegugtdoPoSuuXtPSSS!SSRVRVRXVWtX:W:>S>xWxPWPSWPW!P!3W3MSMWPWPW P#tXPPPXtXSSP:S>xSSPS$3S;CPSSSSSt\>Et\t\Pt\!t\t\t\SMSSSW>EPPSPS;;P_nPPP3;W;>P>XWRCER`eRjoRRPR!RRRRRRRPR RPtptpPt`ut`Xt`SSXSXYuY[u[} tXiPi}S} SwWWP W  V ! P! J VJ \ Wa } Wwto} to u u N t P th P N th R N td Q N t`   t $ $ ; t; N - X Rm p R R S S  S@ S R S / S4 6 S tl tl tl N tl S  P " P) , Pf i Si w P S P S  S  P C Sm ~ S S S/ 4 S6 ; S; F PF N S tp tp tp tp N tpP Q uQ S uS O tP z z O tP z z V  t   V  t  0 V0 3 t 3 O VP   t   D tD O  D tlo z Sz P S  S / S3 D SD O PP Q uQ S uS tP { PP a RP { QP  t} S P S P S P S S u u yt  WMtMXWXdtdlWlyt   t ddlt ly   t ddltly   t d dltly 55FtFXXdtdy MtxVdtxjytx )RCMR]yR|}u}uZt|StSStSZS|t Zt |tZt| t Zt|tZttpZtpWWZWVZV\]u]_u_t\ttSt\t t \tt\ t t\ttWtWtWtWt\ttVtVtVtptpSSStltltlRRRPRuut00ISItWW[t [eet WW[t[eetW W[t[e et00[W[etetWtvtv~W~tWt00bVbetesVsvtvV[etpytpIaSerSvS[etl~tltl[eR~RRuuttVt VAt AOVOt t@t@SSPSPASCHSHOPOkSkmPmStD7tDOtDtHAtHOtHtLAtLOtLtPAtPOtPVAVOVuutPtltlRthWPPP\cPcjVVPVVVmtptpWtptpcVmVVuuDtPSPtStS8t8DSZtp8tpMt8tZVVVP'V'7P7VVVV V5VP PPZztztt't'ttt8t?DtZt8tPPPPVVVZt8tZt8tuuctP,t,.P.ct 8R?SPacP*S.QSScSdeuegugytuuctP,t,.P.ct 8R?SPacP*S.QSScSdeuegugytuu1t  1R1t45u57u7t4YYVtV4YYt 4YYtt4 t uutuut99StS99t PRt 99WtWuu0t/P/0t\7R70tX#Q#0tTtt(t(0OO(t (0770t t (t(0 (W0WVVnQQ01u13u3t0__5W57t7W0__t 0qqtt5QPPPP,/PPPPP7tptptpfpVV4V7V2VbVItltlRtlR7tlbtl|tltlSSS7tT7NSNtTStT4V7tXStXtX7t\?t\t\uu;t5V57t7;VP.0P9;P4Suuztt&P&zt**zt VPV79P;=PMzVQ-9Q=zQPPCZP_zP|}u}utuutuutStSt QQQQQuutuuNtNRP*P@CPPQuQSuSYt\]u]_u_gthiuikukth~~PtPtPth~~RuutuutPtuutuuVt=S=?t?HSHJtJTSTVt::PEEPQQPXYuY[u[atdeuegugotdxxWtWt6W68t8oWdt 88[t [ffot }}PPP00P:?P}SQSRSRS4S8?S?BRBHSH[Q[oS}t`t`B[t`mot`}tptpotppquqsusyt|}u}u\t|PV V04V9FV|R\t`|Q!t\!-V-\t\P((PAAPtp0tpI\tp\]u]_u_t\St\Vt {QPQuutuutuutuutGGLtLttJSJLt LQSQSt SS))PPPP)LtxStxuutt**tWt Wt (W(*t *W55t tptp5KtpWtpuutQSQUtUcScgtgS\\%t %uut ?JWJMPMuWuPWPW %W-SW]eWlnWsWuutuukt3P3kt\<R<ktX<Q<ktT<<\S\`t`{S{tStkS>^W`}WWkWL`t`ut`t`]t`dkt`L`tputp KtdKtp]tp)PDQPPP 1PL]VcoVo|PRVkVL`thuthKth]thL`tlutlktllmumouotlPtXlRtTlQtPlVtVtVtVWWWWt\t\\t\%t\t\tltlct`tl,tlPx~PSSSS"SStdtdtd3tdththBthuu t t t t/t1 * t t t ? t 1 t1 @  @  t1 t1 @ @  t1 t1 @ @  tVjVLV  V VPPP P  P P!t}/<t}JLt}[8t}Ct} t}@ o t}t t}  t}* Y t}^ t}  t}?  t}t} & t}& 1 P1  t}VjVPRVRVV/V  V@ t V* > VR> ^ V V  Vtl /tltlt  tl tl tl ? tl  SVySVt SV  SV SV SV ? SVth /ththPRtht  th th th ? thtd /tdtdt  td  PR  td td td ? tdW /W~Wt W W W ? WV/V  V^ V V  V?  Vt~/t~ 1 t~ t~ t~0 t~  t~t~/t~ 1 t~ t~ t~ W2 W W t~ W  t~ P PS S 1 Sa S S?  St~/t~ 1 t~ t~ t~< t~  t~t~/t~ 1 t~ t~l > t~> D PU ^ t~^ z P  t~  u  u F tuu@tP@QR3S6=S@AuACuCt@OOt@iit uuAtAtAt jjtAy ytA tAtAththAth[t`t`<At`]Q Q4AQSAStlAtltpAtpDEuEGuGjtDTTjtlmumouotlWtWtWV,VVV P .VFVS S  P7kSkrPSSP  PSPS&S&)P).ShS.tLFtLtP.tPFtPtp.tpFtptl.tlFtlth.thFthx|td|Rt\ -t\-Vt\uutStStSPPPPPuutP"S&SSRtp_VVP.WWuutQtuuOtOt6W8@WBMW%Btd,BtheRRR R,#V,4S8>S,BtlPQuQSuStPccQtuutHSHLtLStStSIVILt LVt Vt VBDPLgP{PPPPPPuu-t??-t!W!#t #PWPRt R-WStSV#t#?SV?RtRySVySttSV-tV#tp?Rtptp!-tp#tl?Rtl}tl-tl=JPR\PnsPPPuu?t  !P!?t44?t @AuACuCt@TT]S]ataStS@t  u  u tt3P=XPUrVtuuuwuw8ttVt8VtSt8S89u9;u;)t8PP)t8vvt t t )t 8qqtmmt)vWWW)WSPST,SmS}SSS)SV VVVvVVV VVV)VPPPPPPPP PPP$)PQ}Qgpt`ptXt`tXt`tXt`tXt`tXt`tXt`&tX&4t`4,tX,Ft`FKtXKht`htXt`tX/t`/tXt`tXt`)tXvtp)tp,-u-/u/t,CCVtV,Nt dSSSSPPSSS SS&S&2P2JSbzSuu tP tLR tHVt VWtWt VW tW t VW tW t VW tW t VW tP - P- tP P tP u u  t    Rt  u  u a t 2 P2 S tHS X PX a tH| - VW0 C VWS S , S0 B SF O Sd e ue g ug td P S S S P S V P VR V V V V V PVP2V?GVGMPMVPVPVP&V-2V7<V{VPVPVPV**VQ\V\PVPV tlY tl&tltl t~Y t~]&t~*t~ t~ t~ t~ t~ t~ <t~glt~t~ t t t tY t &t2<tt t t <ttVt tB t t  W &t2<tt"W"t t t t V <tt WY W WW*=W t4 t &t2<tt t; t &t2<tt WY WC WI R WY W&W=WuutVtV t V0EtSS-SS?hRmRRS S PS #P#-SSPSPSSSuuttt  t~tt~ t t~tt~``tptptPPPPPPPkSPSPS,SSPSpSuzPPPS*5S5;P;`S|SPSPSSSQvSvyPyS1t~pt~t~R;t~pt~t~Ept~t~Rpt~t~'tpttuubtbt`WdeuegugtdtdEVEat avVvst sVt Vt Vat\mst\zt\t\t\t\ SE]ShmSsSSS SPmuP ]SmsSatlmstltlVatlstluuvtStkSkmtmvSxyuy{u{txStStuutuutVtVtuu t PP !u!#u#+t,-u-/u/7t89u9;u;qt8EEqR8EEEPEGt GKPKgt ggPiot ooP8P Pqt8WWitiqtuuuwuwttQtSVPPuu6tVt/V/6tWt 0W06t 6tpSQ89u9;u;t8RRVtVt8RRWt Wt 8MMtpdSkQuutQtPt Pt PR tuuWtMQMWt$P$.t ..P.Ot ORPMR3 3WtXYuY[u[tXmmStuutPtP(t((P0KPKtPPtPt 0t0vvtt tV-VVS,SSt`t`V0t`9<t`<>VBvVvt`Vt`tp0tptpPd|Puu t W MtMZWZtW tt  t t t t  tt ttFMtM^^t t t CFPPP PFKWsW W*Mttgtt ttFMtttt tttt !u!#u#GtHIuIKuKmtpquqsustpQtQtpRRuutQtQtPt Pt PPPuuqtEVEHtHaVadtdnVnqtFWFHt HbWbdt doWoqt HtHddqt"DSdmStuuuwuwttQtQtPt PRRRuutQtQPt PRRRuuvttStvtxyuy{u{ txPtPtPtPt Px tx StSt SVV Vuu?tP5S7=SRQ@AuACuCt@``t@t R.t .t U`W`fPf,W.WPWW*SSStttt`gRQuu7t7t)P05PuutPRPt5S59t 9St Vt6VW67tW79t9VWtWtuutRtSt St VtVWtWtVWtWtuu^t33^R33IWIKt K\W\^t **3St3GSVGHtVHKtKZSVuu+tPtP+t,-u-/u/st,;;TPT[t[bPbstVYPuu ttt tVt VVt V t t t  ttLtL  tLVVVRVVnVVV_VVVRVV&2VMQQQMVQ& VX g Ps RR:IRtP tPvPtTtT&tT> tTtltl tlPPPnP RIKRnRQ/7QIMQQQQQtltl tluu>tP>t<S@AuACuCbt@JJbPdeuegugtdqqQdqqR{{PPuutPVW Wuu4t45u57u7t4HHSSSWtWStS4 t MWR_rRtRRPRPRRR RxRRMWtptpMUWP W PWMOPPP3zQ*QQMWtd? tdtduutuu tP}VPVV VuxPPPP'tptp tpFtptp tpVtpYtp tpYtptp tpY|S SYtp tp  u ut ##t t t t  WWiV]  ]t/ /StS] qttt -;t~t~t~t~-7SSR1ShS-;t~\t~t~-;t~8t~8vWt~NSt~t~t~-;t~t~t~t~-8VVVV-;QQQ'QQ-9W PW<BPjtPtWPPWuub t  b t  t b   S t = S= G tG Z SZ b t V V D VG b V S= C SZ b S tp b tpd e ue g ug  t u u t  t P t  t  t  t Z Z t  t   M tM Z  Z t    t tdM tdZ tdH e td td S> V SZ q S VK e V th thZ th P P P P  PM R P P P P P P V VZ ] V  Q/ M Q Q & Qe g Q Wc m Pm WZ W P tlV tlZ tlZ e tl u u t u u Et  S t *S*-t-;S;>t>ES  V t +V+-t -<V<>t >EV R P R R P-R5>RCERHIuIKuKtHbbStStStSHllt t HbbVtVtVtVRQPQQQQuuBtSt@S@BtDEuEGuGtD\\tDrt rt zzt jtPorPPP*/PMUPozPPjvS2zSLztptpztprztptpztptpuuIt6R66t6IR3W36t 6@W@Bt BIW2V26t6?V?BtBIV 1S16t6>S>BtBISLMuMOuOtLrr|V|tVtVtVtL^^rQtr{QS{QtQSQtQSt St QSQtt Ld dtlLjjthuutVtAVADtDaVaeteVtQtQSQt@QS@DQtD\QS\`t S`et e~QS~Qtt  tlthuuttt qt {t VPnVv{V}VVV'W'+P+oWmSmoW;?R?CPCPRuu@t@tBMVM`P`V5V.W6W;@W@AuACuCWtuuGt  Pt"PR"'t R')t )4PR4APtAGt uu`tRtKRK`tRR`t RR`tR R`tRR`tRR`tPP^P`auacuct`tt{V{}t}Vt`ttzSz}t}Stuu/t*V*-t-vVvyty/VZZyt y/t ::/tZ Zytyk ktt /t#)SSuSyPSPSPLSLWPYdSdqPqSPSPSP(S(/P#-tp6/tp#-thZythth/thuuvt  Pt PRtRTPRTVtRV]PR]_tR_ePRegtRgmPRmotRotPRtvtRxyuy{u{txtxRVRUt U_V_bt bVt VxUtUxH HMtM x<<MtMSWQSP5MPZZPPPuuttt StSVSttSVSttSVStSVStt t tptptptptpWWPWPWuuut++tntnuVt VVVnt nuVt1YnuPQQPsuPxyuy{u{# tx# txPPbt b# t xPPbtb# ttvVEtvEbVbitvinVntvPVPVVPZVVTVTfPhVP1V1QSQrVrS1 V1 < P< P VP c P V PRR # RW#*W*4P4bWnPWtltltl tl $ P$ # tltu"?W?CPC|W|RWPStuStutuWtuSP W  tu S< K WK P PP # tu5qRR'R R< P Rtl1btltltuPbtutuSPbSS1SQS$ % u% ' u' # t$  t   t # $ J J # t Q P Q Q Q Q P Q # Q S,  SuutUVUWtWVtVtIIt ILPPPPPPP{Ruu2t2R2Q45u57u7`t4CC`R4CCLPLNt NUPUWt W`P`auacuct`ooR`oo{P{t Pt uu%tVtVt%Vt t %%tP P()u)+u+t(ttt(ct ciit t t (ttt(Q Qctc ^t^ t t(\\ctctttt(@@MVMtVtVtV^t^VtVtWPWPWWWW1W14P4WPIWILPLWPWitTtT'[tTtTRtTiyPP0R0hPhjRjpPpzRRPRctXtX ^tXtXtX>BPi~VV [VVtptptp3tptptpctptp^tptpQtptp^tpptpPxyPctptp[tptpPuutuutS"t"]S]`t`S--t PTYPu}PPzQPQPuu"tt"tt "t "t uut  PtPuut++tjjt PPtt;;PPcPPPPPPuu)tuutt!/t~Srt~t~SaPPPmrPSrt~t~Srt~t~KSPRXcPRSrtltlSrt~F~t~t~Srt~%yPyPRyt~y~Pt~Srt~P~t~t~Srt~~t~t~Srt~~t~t~SrthP~ththSrtdP[td[cPc7td7@P@~tdtdSrt`P~t`t`SaRPyR6RfhRhQR07QE~R-RCVRr|RSrt~P~t~t~SoV V^VV07V;_V_VrVcxPx{P07P@EP,IPPPuutPSSSWSRtP&Q&tLtTJtTWltTvtTxQ2JQfJtXWltXvtXtXVVWlVvVVP!.PinPPPPPOOPglPqvPPhWJWWlWvWWt\Jt\Wlt\vt\Q!dQQQQWlQvQQtdJtdWltdvtdx{P@JPuutPtPtPRRRQQQuutuu't()u)+u+ t(<P<QSx~SoSs~S S(?R? t(]Q] ttAetdt t ttetdttt ttettdtt ttWtWtdtt tWWWPWPWPWWW\P\eWeqPqW P dWiqWxWWPWPW W P )WQWPWzWz}P}WP Wtetdttt ttettdtt tdt@ t@<VxVV#VVP VZqP V<V<xtXxt\eVeVdVtXQt\Qt\ tXHQQQtXQtX t\<VxVVVR V VtHHetHdtH t`Ot` t`<VVV V4eVeqRqVtptpPP{PP9tptp  u  u C t ! ! * P* , t, C PC C tD E uE G uG W tX Y uY [ u[ k tuutuu t !u!#u#t 00EVEGtGwVwytyV3DSGvSyS@@P_rP~PPuutPtPtVt Vt Vt VStStStS QtQPPPPPPuu'tP t %P%'tPP%%PPPP()u)+u+"t(<<LPLTtTiPitPtP"t(dt (mmt"tLLPPPPP"P?PSTSS"SLTR~R"RLTtptpPtpPtp tpP"tp$%u%'u't$tPtt~$RARRR$QAGQQAtMttt!PAtlRtltljSnsS+6S6FPFaSP +P9APR]PnwSSSPSdt@dntXn|t@|tXtDAtXRtXtXqlWnyW{WWWAtHRtHtHAthRththoS+ASRnSuutWtWtWtTtP tLtd RRPRR th%thuu^t  P$t$.P.WtW\P\^t^tp  !V!$t$SVSWtW^V  "W"$t$TWTWtW^W S$RSP0<P\^P`auacuctuu tWtWt Wtw twtwtwtwe twtw twSVSV SV  SVtw% twtw. twtlr tltl tl  u  u t   t t t t\ V W 7 VC r V V W P 8 WA s W} W W W W : tpC u tp tpuu<tP5t5:P:<t''5t 5<P33P::PP ,P13P<=u=?u?t<cPcvtlvyPytl<LRQLNSQNSVSVSV<tttNRRZWWW\QQuutPthRWWtt`t t`t t+tl+.PR.tltltlFsSVSVSVSVpQQQnPPPPPuuat P atl R ath Q YWY[Q[aWWS[aS 0PDSP[aPXV[aVdeuegugtdrrPtPtPtuRPPuutPWWRVVQSQSttht thuu<t<t  Vt7VW78t W8:t :<VWF Ft <tqqt< tX<tX/6SqS/:tpqtp/:t\\t\t\t\4<t\/:t`it`/6SLqSS<S<=u=?u?Yt<MMWPRWYt \]u]_u_xt\mPmxth\pRpW$,W.xW\ppstsvt`t vxt`\xt\  .t.[ [xt*S24ShjSotSvxStlPR4P<xtlSV.2SVAaSVjoSVtvSV+VajVxyuy{u{vtxvtxt tHttHVWPRVWtHWvtHx `t`j jvtx"t"jjvt`tPjvtPP S APU\PnP(SjvPPP$$P;SPejPtT,tTjvtTtX,tXjvtXt\,t\jvt\xyuy{u{txPRt uu tP t PtP tt  t  t t  SS RQtpPtpP tp !u!#u#t 00@P@ItIXPXtPt @@It Iggt t t  t 3FSISS@GVZ^V^^P^VV@BPPuu tPP S V u  u q t % P% b Wd o W % R+ H R\ \ Pi i P! ` Sd m S# a Vd n Vt u uu w uw tt  S t S P t S t St  W t W t W t W V V R V P P P P u u t   V  t , V, / t/ V  S + S6 S  W% - W4 6 WC W  tpb tp  tp tp u u : t  ) tH t : t  + 3 :  W P W W  W! ) W+ 3 W8 : W P4 tp  tp+ 3 tpuu1t  1R1t45u57u7t4NNt4rrt 4tt4N NYWY[t[WtWtWtWtW4NNXVX[t[VtVtV{SSSuu;t#P#/V2*V-;VR;tXQtTRQR;tT+W)S-tp-tl-thq-t`6;t`<=u=?u?t<VVt<VVaWact cWt  W  t W<VV`V`ctcVt V  t VS Suu,t//WtWt,WllqPRqt t ,//VtVt,VsSPSPSPSPS*S*,PztltlHt\,t\,-u-/u/t,@@t,fft ,[ [twVVvtltlQxWWJSOvSSuut77WtW77jSjt Sddtt@tptpKtltlthjS=VVVuut !u!#u#>t@AuACuC^t`auacuc~tuutuutuutuutuutuu tuu0t01u13u3PtPQuQSuStPbbjSjltlStyQuutQtuutuut u  u tuutuu?t  #P#(t(:P:?tuu4t4R2V24t 1S14tuut((-W-t((t ((1V1t!(S(5P5`SdS5?RQpRsRuutuutuutuu-t01u13u3t0||t0||t 0??GPtGIPRIWtRWt0||t t`V+t`Vt`WV W VTt`TtVtt`Vt`PSSW RWtWWW6tl6SVStlPP%PCLPPSStSSQTtQSSTtSRR!RTtRuutVtVt t teeutueeutuSSPSuutuutStStS}}t t 6R;vRvtRtR} }t t }}tt{PPPPPuutt(P( t P// t / / t  WtWtW2EPfPPSSSRRVV VVB_QQQ Quu t u u7t 7t,P.5P89u9;u;t8KKYSY[t[ySy{t{S8QQTtT[[t8 t 8tRRPuu1tPSS1SR45u57u7}t4CPCLSN{SIIPlxPuutPQRuutPSSRPPQuuItPFVRBIRESLMuMOuOctLaPdeuegugyt|}u}ut|P|R|Quu-tVt-V-t SQSQSQ-Stp-tp01u13u3t0?P?bSfS0TRTdWfW0^QfuQuu tPS SRW WQV V  u uet PNSReS >R>etP (Q(5Vhiuikukth||Pth||Vt uxRxSRSRuutRPt Pt uutuutPuutPSSuut1P1wS{SS7R7YWsyW{WWBQBxV{VVuubt P 9V<_V R :W<`W Q bt`  S R S 4R48S<^SdeuegugtdPdpRpSdyQuutVtuu!tPSPS$%u%'u'.t01u13u3;t<=u=?u?JtLMuMOuOntpquqsus{t|}u}utuutuutuuatSat_W^Vdeuegugitlmumouo}tuutuutuu` tPVV` V R% 7 R` a ua c uc n tp q uq s us t u u t u u j t P V V / V2 j V R S R S R S  R . S. 2 R2 D S Q W Q W Q 0 W0 2 Q2 j Wl m um o uo  t u u t u u t u u t u u t u u t  7 S7 : t: Q SQ T tT S  8 V8 : t : R VR T t T V A A T tT [ [ t  u u K t  W t  W  t K W V2  VL M uM O uO tL f Pf S P S SSL d Rd tlL d Qd k tdk  P ?td?RPRtd tp tptp:?tpMRtptptp R$R W W?WRWuutuuFtHIuIKuKrttuuuwuwbtt@S@CtCbS2RXbRAVQbVdeuegug?tdxxVtVt?V@AuACuCt@RRVtVtNSSuuYtYtWt MWMOt OWWWYt StStSOtOUSUYt\]u]_u_t\kkth\VWVWt VW)V)*W,;W;[V[]W]VWVWV\tttd\z zt`tp,t`,9tp9t`tpt`\t\SS,;S]SS,tl2]tl]WtlWtluutV!t!+V+.t.VIIt t W!t!,W,.t.WuutWt/W/1t1WVt .V.1t 1V$t$KKt St-S-1t1S   t $t$$tpDtpuutPtlRVUVVVSWPPW?RVVVVVuutWtW\PchP|tttp tpt@Gt@t@ Et@Kt@SSSSSththth EthKhthththtdtdtd EtdKhtdtdtduu8!t#t#ssststi ti   t  8!txx#t #t Qt Qssst st i t i   t  8!t ##t#tststApti   t# #t#t sti ti    8!t#t#ssststi ti   t  8!tVtVtQVQatasVsstsVtVtpVptVi ti  V t V 8!tSt St QSQat asSsst sSi t i  S t S 8!t tPWtW\Payty~Pt t  Pz tttQatssttpti t t t 8!tttQatsstt0Atpi t t 8!tQ Q*SQaSSaQQaRR[PP8!9!u9!;!u;!X!tX!Y!uY![!u[!!tX!l!Pl!!S!!S!!SX!l!Rl!!tlX!y!Qy!!V!!V!!V{!!W!!P!!W!!P!!W!!W!!u!!u!"t!"P"/"SR"X"S\""S""S! "RQ!3"3"\"t\"w"w""t!""-"Q-"\"t \"p"Qp""t !R"R"\"t\""!R" R"\"t\"" ;"D"PW""VWF"Y"V}""V""V""u""u"_#t""P"K#VN#\#V""RQ"""L#WL#N#tN#]#W]#_#t"""J#SJ#N#t N#[#S[#_#t `#a#ua#c#uc#&t`###$t$$$&t`#w#w#2$V2$e$t e$j$Vj$m$t m$$V$$t $%V%&t &&V`#:$:$e$te$$$$t$%%k%tk%%%&t&&`#w# w#&t##Se$i$Sm$$S%D%Sk%n%S%%S#k$Wm$s$W$$Wk%&We$k$Ws$$W%k%W%%We$i$S%%Sg&&S&&u&&u&I)t&&&&V&&t&&V&&t&I)VL)M)uM)O)uO)n)tp)q)uq)s)us) +tp))P))V))V) +Vp))R) +tdp))Q))tp))Q)M*tpM**t`**tp**Q**tp*+t`+ +tpp)++ +t + +*4*Q**Q +!+u!+#+u#+9+t<+=+u=+?+u?+f+th+i+ui+k+uk++th++P++Vh++R++tlh++Q++S++W++P++W++u++u+4,t++P+,S ,$,S(,0,S++RQ++VQ++VW(,*,VW+++4,t+++4,t +,,(,t(,4,+,V,,P,,V ,,P,%,V*,1,V4,5,u5,7,u7,o,t4,@,P@,m,S4,M,RQ4,T,T,o,tp,q,uq,s,us,,tp,,,,P,,u,,u,"-t,,,,S,,t,-S-"-t,,,,R,,P,,R,,P,,R,,V- -V,,P$-%-u%-'-u'--t$-[-[-s-Ws-w-t w--W--t $-J-Y-`-Pw--PG-O-P--u--u-K0t--P--S-K0S--R-K0tP--Q--W-K0W.$.VL//V//V040V--V--tH.8.tH8..V..tH.L/V//V//tH00V40K0V--tp8..tp.L/tp//tp00tp40K0tpL0M0uM0O0uO0p1tL0^0P^0k0So0p1SL0b0Rb0l0Vl0o0tPo00V00R01V1 1tP 11V1.1tP.151V51G1tPG1p1VL0b0Qb0m0Wm0o0Qo0p1W 11R!1:1RD1P1Rb0o0tp1p1tp|00P00Pp1q1uq1s1us12tp11P12V22V22Vp11R11S11S2 2S12S 22S22S12tp22tp11S22S22u22u23t232P3213S53x3S|33S2*2RQ2V2V23t3&3&33t22P22R$3-3P53;3P;3@3R33P23V+323VB3y3V33V22V|33Vy23tl+353tlF33tl33u33u33t3333P33u33u35t34P44V45V55V33R34S45S55S33Q34W45W55W55u55u56t5556S6 6t 6{6S{66t 66S66u66u6J8t66P67W77W7J8W66R6J8t66Q6J8t666J8t66P67S}77S77S 818SE8J8SL8M8uM8O8uO88tL8q8q8|8S|88t88S88tv8}8V88V88u88u809t88809t88V 99V#909V0919u1939u39 @t09I9I9b9Sb9f9tf9 @S099;D;g;n;>> ?i?0999>t>>> @t\9f9tv9 @t\9f9tp:;;tpg;n;tpu;h=tpt=>tp? ?tpi? @tp\9f9t:;;tg;>t> ?tX?]?td? @t\9d9W ;;;Wl;n;W>>W99RQ\9f9t9;;tg;>t> @tO: ;Wg;l;Wn;;W??W\9f9tlr:;;tlg;h=tlt=>tl? ?tli? @tl\9f9tl;;;tlg;n;tl;h=tlt=>tl? ?tli??tl? @tl\9f9t;;;tg;n;t;h=tt=>t? ?ti??t??t? @Pg;l;W<<W>>W??W@ @W\9f9t;;;tg;n;t;h=tt=>t? ?ti??t? @t @ @u @@u@NAt @P@P@NAth@@SV@@SV@@WV@ASV'ANASV@@SA#ASPAQAuQASAuSAAtPAAPPAARAAth}AAQSAAuAAuABtAAA`BV`BcBtcByBVyB|Bt|BBVBBtBBVAAABWBBt BGt>GlGVlGoGt/F3FS3F5FP5F9FS=FJFPJFvFSFFSF GSGGS1G:GSbGkGSvFFSG1GS>GbGS\FFtpGoGtppGqGuqGsGusGHtpGGPGGVGGVGHVpGGRGGWGGWGHW=HoHSHHSGGtlGHtlHHuHHuHHtHHHHVHHPHHtHHSHHuHHuHnPtHIIxISxI|It|IISIItInPS=IyIVILVLLVMNVNNVNnPVtI|ItIJtLLtMMtdNNtOOtPPt:PLPtcPnPtdIzIWIJW?JBJWJ+KWP:PWtIzIWLLWMMWM[NWN3OW[OOWOOWtI|ItIJt|KLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItlIJtlKLtlLLtlMMtlMNtlN3Otl[OOtlOOPOPtl:PLPtlcPnPtltI|ItIJt"KLtLLtMNtNPt:PnPttI|IthIJthKLthLLthMMthMNthNNthN3Oth[OPth:PLPthcPnPthtI|ItIJtKLtLLtMNtNNtNNRNDOt[OPt:PLPtcPnPttI|ItIJtKLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItIJt(KLtLLtMNtNPt:PnPttI|ItdIJtdLLtdMMtdHNNtdOPtd:PLPtdcPnPtdtI|It`IJt`LLt`MMt`MNt`[OPt`:PLPt`cPnPt`tI|It\IJt\JKLt\LLt\MNt\NPt\:PLPt\cPnPt\uut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Suu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uu5tWtWtWt5WVt Vt Vt 5V\S\tStSt S tS't')S).t.0S05tGRP_bPP\SSS S'S).S05S89u9;u;t8JJVtVtVt8wwt t 8JJStStStuPPPbpPPPSSSuuPtPRPQ$S$'t'PSPQuQSuStPaPi|PPP_R_gWgiRipWp|R|WaaPP_eSsSuuttRtWt WPPPSSuuJtPtPJt  Jt !!JtP#3PBEPLMuMOuOtL\\tLuut L||tPP\lPP\nthth\ntltlcjSeS\ntptpVVuutPtuu1t#S#)t)/S/1tRPR R)RP45u57u7dt4NNbSbdtdeuegugtdttySytSttyPyWWPWy}SPSPSPSPSuuBt(:R>BRDEuEGuGtDTT]S]ataSDYYat akkt %t 35t Ft t t t DtD tY_WVW%VF]V_fVfnWnyPyWVVWVYPYWYathththVthuthYatl|tlYatp%tpAtptptptpYaRRRRYaQQQQYaRRRRRDVRuu\tZWZ\t$S$&V&XSXYVV$P$NVNTPTYVY\P\]u]_u_t\yySt St St SPuutWtWtBtpIVuu t u u,t ,P,,t,-u-/u/t,EENSNRtRS,EEOVORt RVuutStuuttt tuu#tSt S #tR RRPV$%u%'u'Vt<NRRVRuutP u u tuu>t@AuACuCt@SS]W]_t_W@SSUVU_t _Vt Vt @U[SSPSSSPSU\V\_RfSVRSSVUWPW_tptpPtpfwPzPUWPPPuu@t!P!>W>@P =V<S@AuACuCt@SSVtVVt@SSWt Wt Wt elSllPlSSuutuutPVVRWW u  u `t))6t?`t&&=t =`&t&`)V)1P1NVNQPQ`V?IRKVRVaPaR=FPQ`R`auacuct`tuu)t P )Q R R P 'P,-u-/u/3t,1P45u57u7t4BPBQ4ORO_W_qRqWRWRWMSSuutuutVtVtuutt tt*S.SSQRVW!,W1W!.Q5SPSeQePQuu?t@AuACuCrtJpStuuuwuwtuutPtPRRuutPtPRR u  u =t@AuACuCt@VPVt@@VRVbVeVV@VQVaSeSSuutuuWtStWS1PSWPXYuY[u[tXiiVtVXiirPrtPuutt QtQt Q tQSSSuu\t--TVTVtV\V--SSSVtV\S0@PZ\P\]u]_u_ t\rPr tp\rRrWW W\QQlrSrQSQS StPP  u u6t 2Q26t89u9;u;rt8GGnQnrttuuuwuwttQtuut..VtV..t"7PPPuutP-W/WWYWRQthQtht%'PADPv{PPuu t t\ tX tTx W W u u t   t   + W+ t   t u u F t  F t PR . PRH I uI K uK ptH g g t ptH s s ptl } P P PPe W + W Wz R R t~ pt~ We WpWl r R Rl S S!S Vl VpV PR PR PR t~ t~pt~ P t~a v P  P; N t~N U Va t~pt~pquqsustptt  ttptPtPtPt4t>ttVLtT}tt#\S*fSS<V[_V_fPPtLtQQt't'Q+QtQQSSSR)RRy/VfxVVVV#SfSSSuuututlS!t !mSmut uthxyuy{u{txPtVVVuu@tQ@AuACuCtO|QuutStSuuTtStTSTUuUWuWtTttTkkt SWSPSP@QSQSPSStptpPPwSSS*VSVV"VW\VxVuuttMMttStjSjltltSOZPrtPPPP9PtuuuwuwttttStStSPPPPPPuubtNtN--bttP't'.R.2P2CRC-t-URPCLW0WbWV"t{CSVCKt{VKNt{-t{-]SV]vt{Vvt{t{Vbt{QVCKV PCFPQQCNQQCNQLW-0WSCJSQQCNQACPRPRPRRCNRRP3;PJLPFNt{[bt{FJS]_S_cQcSPSQSQSRQRbSuuLt P )V+LV (S+2S28PBLSLMuMOuOtLWPWSuutPSSuutt%.P.5SIPSP\P\SVP6V69P9VV19t_\t_RR19t_\t_PDct_c}t_} t_ t_t_t_t_\\P P5PP19t_\t_t_t_=t_QSt_t_19t_\t_t_19t_\t_19t_\#t_#+V+.P.Vt_t_Vt_16V\VVP!VVV19t_\t_Vt_uuttXSSS{SSattttttvttIKW WattUttaSSS=DSDRPRhSSPSHTVTZPZVVPVVPVVIWWW{WWuu?tP5S7=SRQ@AuACuC4t@]]Wt2W24t~(t(t RQuuGt  Pt"PR"'t R')t )4PR4APtAGt uudtIaSdeuegugtdxPxtldxRxthVSW~VVVuuvthSlrSrvtPvt iVxyuy{u{tuut\\|t |DIP6AtHACStLCxSVS;SUSuutuutStStuu t tuuVt IPuuntuu_tPR]VQ\S`auacucrttuuuwuwtuutuutMVMOtOxVxztzVHHOt Ot HHOtOLSOwSzSHOttnsPszttttPttuut-V-/t/XVXZtZV((/t /mmt ((/t/,S//S(/ttNSPSZttttPttuut {ttt EE^t^ss{t{t ttttt7W{WWW7V{VVV7SSS>kSs{SSS7tpR)tp)6R6StpS^R^{tpRtp7tlP)tl)6P6StlS^P^{tlPPtlPtlSSSSuutuu~tFQFntn|Q|~t,S,.t .BSBaRnzSz~R>QPQaPprPtvPx~PFaQ|~QuutQt Q tSt SR S RPPPPPQ Quut>V>@t@_V_ataV=S@^SaSUZPZattttPtt99PZZPPuutStuut!!tcgt CCPRLhPRPRuuLt<V<>t>JVJLt;S>ISLMuMOuOtLYYiPitP^mSSSuut""t7Vt7HVWHLtWLtVWt>tdtd,OPRPRPRJiQmwQQQ$Q3[V/WWRetpemRmtpRtptpXytlytLtlRtlHtlHtLyWWWyVVuthth`thuyPPPyRYRyV[Vuut((tt" tt"t=:tJt(fRQRQRQ&ORQ.\VW&OVWtpN&t@Ot@T&tLOwtLwt`tdotdZpt\pR!t\!&ROt\W_tH!ROtHPVnP&PPPtDtDOtDtDPPOUPPRRPPuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_Pttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttukku,,/R/u ,,uk ku 1FWFkSkqWqSWttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt)u)Q 'S &Ptt~uRuR\\~uRu R\\~u XSX\u\~SYV\mV2W2BupBZWZ\up\~Wttuuu VVWupWupWupttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVttuttZu))Zu%<SVAZSV`atactcu`uSVSVtt utt!utt u Ptt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt&u&R01t13t3=u0<<<P@AtACtCfu@^^fRpqtqsts}up|||PttuRttuWuWuVVttqu33VuV``qu^W^`u `oWoqu ]V`nVttuuttuttu//uhu`hu`hupupWFWWhVjlPtt~u  ~u**Du Dff~u   MWMQuQ~W  JVJQuQ~VGSf~SttuStt6uPu P 6utt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttu !t!#t#)uttu !t!#t#u EEuhuVVACPySttutt uttu !t!(t(4u@AtAHtHTu`atactcuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuWuWPS7[QSSQ{QupQ !t!#t#u CCWuWuCVVttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nulultt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPttiu  5S5>u>iS  :V:>u >iVpqtqsts+upVu+Vp+u p+uS+S01t13t3Qutt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt uttu !t!#t#ruceQttuttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttru""rQ$:S=rSttuttuttuttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9QB~lwBNSeN_I+X44:4G43 4333322t2{2182#/7/"X44:4G43 4333322t2{2182#/7/)I+F))'*)E''':'& 'Y&&%E&E%%$7%d$$"U$""K!!% 6! J@8'oEe4w\ [@ _2=ft2{2))F)c)((''V'`'& '[%%t2{2))((Y((;(F((-(''V'`'& '[%%f @$7%3 4E%[%X++\11X+^+11\1q1++o++,,W3x329371\1H/m/-.G4X43300/4082t2uXuHX3ZAZ0Zh{ e{Pfd||#yOy#LQ#LQ '[f [f'<A<A QnQWdnX]X]X](-(- @ t  [@   ^   z e x K o ^ .FxhhxFU.,  r r '08:[z)iz)szsz5'5s|`%@5@/pIM/pIM/IM2(200o0o --8MCMYx Yx jv;Lzz 8@%.8@%y`lBM+LQ +LQ#  # &  hMT'8 s # s # *PQrC*1Qr$CEP_r1C_r1CJQ ,!,@ZOZxBItbDS 0EC 0ECC0~zzpsxsxjxjx, , u+Au4A"  ?  " e / x } $ / x } d |  !  !    /J:Jc|TtTtTt)u)uGOQ,["$Td##%%%0%m$$##}%%g&&&&.L/40K000//L//040//1111V22|3~3o22|3~322{44r5599 ?I?99'?;;? @i??? ?Y>>t=L>_<<;U<`>>? @`>>? @??>>>>;;??i??? ?t=;>o<<;;;;??i??? ?>;>=>==<<;;==??v@@=ANAGoHHHHH H=HHHHHLHoHIIJJIIJJIIIIIILJjJ~JJKLLPcPOPNOMNMMKKLPcPPPOONONNoNyN6NdNN"NMNMM$LLK L(KKLPcP3O[ONNNNMM9KNKLPcPDO[ONNNNMMPMMM;M|KKhKrK!#35BEsvLO`c|'W*W*.lNY`b`bz @ tev t!,etKT  yDf#+ |||Lp(,,, RTFFu|NP(NP(BP'BP'"`p_"`p_*3*@&(&(*@&(*@*A$p\\,8KT`~X_r02 (:(:@O/25;/hp8X8L0DL]GI$9;57HO`d"*8 *8"8^8EZ^VXT8(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)03.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@t\']@]- ]@ ]6f 5X@X?@F@M@R @ l X@P ]fDu=.h[k76 r0h 0  P'!  I PM x@@@]@ ]@X@@@@ @ @     @@(X@;@H@^@ m$@ t@@ @@@@\@P@!t@@'@)@@($,@16`@)A@Y$@`m @y( @D@@  l @a @P @@` @ @@`H@@rH@&@6@L@D[@Wr0@ |8@ @ 4<@T<@b=@k>@9>@=>@>@d?@'P@@4;@@5L@@WxD@%kE@pI@{@ {@<{@N@A`{@@ `@$@ V@0$0_@>Ia@\a@qyd@d@Og@Xq@@w@\{@1@ }@l@u&@M@@BR[h@ t~ @?L@@@J%1@ : @eIR[eD@Jt@T@|@@ @@ @gH@])@?4@D@Sd@ _@o@r~@ D@w@ @ @@t l@<@H@ T@y@/@e'h@@8@G@T@d@r@@@dx@e@qT@(@~@@t @;   $ @0 ; y@-I P @9Z ` @Pe @p @q @I h@+ @R @I 4@ L@ d@& @ @T l@ @Y( P@AD @ T @g @x @> @ @n L@$ @U @ L@ @ @ @ 4#@ @ % x(@5 D)@F *@P +@Y ,@-j @u @7@ 7@ 8@ X@" H9@+ @ 4?@" X?@ PA@V A@t B@; C@) 4F@$7 XG@F H@V I@d L@z د@ 8W@8 X]@C  hf@ @ @ @  @ @@  8k@   Hn@O0 r@2> F L V x@` h z@@u `{@L @  }@) }@ }@` H~@ @( ~@6 @@ @#@2(@3\@0+@07@5B@ZKP@:W@a @@qL@Ђ@@@@*@:(@Cl@@@ @  @X@@($@d `@@',@f5@`M@@ V$@ f@`{D@ (@ T@a@P@(@@n@Ld@5@Ot~@?<@d!@2,@ @H@ N<@ XD@ h8@ u6@ 0@ @_@@`@0 @  H@ \@ @  &p@ /;D@ KKKKU]ep@ }@ @ @ @ @ @ @@   *3<ENW`ir{@ @ @ %@)@P@I@ @$5?@ K@gU[L@g@ q @@ z@ @ @ @ @ `@ h@ p@ x@ @   @ (@@1@a>@@ I$@ Uc@ k@ sp@K@R@ I p@@ @  @ @@ +7@@@ LR^fr@7@ @@ @ @ @ '+@E29@ B@`M@$ P@\@i@@pyX@y@ @ %@ /9B@ KT@ ^`+@0o@NwX@w@| @`@ xv@\@z@-A@ I@Q8@%(@BE@TZ @c@0u~@p@ |@v(t@&B@0@P@}@%@4]@ 0@9U@`G@\T@tX@x@&[@"@ W@!@DT@0@pF@d@ G@O?@ @ @$@7@F@ WL{@dȴ@|@а@ P@+\m@@ @7L@@-@U4@ AZ@OKX@*e@@P~@H@ x@(@%@@0 @@9@rP@Y#^@ 7@?lw@^L@e$@9H@(̨@@ @[@h@@u@ @ <@9$k@LDo@ed @ sl@ @ 0@ @hA@n@Z@L8@P@R@I P@fI@&@-@WM@T`Y@l]|@pP@ v^@rx@p@@@0@`@+S@cpx@2@ @@@+@l80@|K@]@T@Vj @`@d@Z@ p@ dS@c@p @!@`i@M ^@E Y@1 @ 6 S@ I @P pS@Y t@}z @ p@ S@  @o @ p@" @K \@T P@$ @ @" @q!H@ !@&!@@k !@%!`@75!@@:N!@V!@o!@w!@~!@#!pW@H!p@a!@!S@!0@?!`@ !W@!@!@ !@j!@"@ "4^@ 9"8L@M"G@?U"@/j"Lv@ |"@H@["`@"`@"L@ "@"<@"p@!" @ "P@#X@#@ #0@4(#P@r5#@ <#@1\#@o#@4|#K@#@#|@#;@##/@u#@/#Q@#H@#@x#k@$$u@ $X@4$@ K$ @a$^@!}$p@]$H@$4@%$\@H$@$@$p@$x@_$@t%`@%`@I$%L&@6%`@M%@~Y% @w%` @ %,q@0% @ %ĥ@ %P@'%$@ %x@o%@-%P(@&F@&z@A-&?@6&@<&F@ I&@ X&@>l&q@2&@/& C@&P@_&@&j@ &x@[&U@B&`@ &@&@m'@'l @ 4'@%H'@9P'`R@e'$l@5w'(@ '|@',@ ' %@'@)'й@'\q@'7@'pU@(@j(@ #(@3*(p@DO(PJ@*a(@ h((@ n(v@=(Z@(Y@)(@ (@(@I(P@(4W@(@ (d@ )@@E)@@!)l@6)@I;) O@Q)|@Gg)A@ m)1"@61@1<@ 10@;1pA@1@@1`@1 7@ 10%@*2dg@%2$@nD2p@J2@Y2?@ _2 @ p2@2@@ 2O@+2$@'20@24N@a2@2@& 3@3@ 3@?!3p@)3L@/63E@;3@ C3p@K3@ X3@l3| @3@.3\@73@3R@A3@N3`z@3@v3@>3)@3|K@3F@@ 4I@)4@W14@54p@!D4R@R4p@Ih40@o4h@/4@4`@B4J@m4@ 4@q4@"4!@R4@$5`G@! 5 @!5J@m$5[@_=5D @X5@ _5p(@Gf5[@n5@ w5%@*5@`5@5\%@5@Y5h@ 5H@!5@5p@ 5 @6@>@?6\@36@ Q6 ?@ Y6`@M{6@6@"6@6Q@u6pH@6@I6( @7Xf@7D@ 7@i)7$@?7-@^7\T@17 I@ 7@v7`@ 7m@P7@E7@7@7$r@Q 8@\@z 8@ '8)@d.8pW@ K8@Q8l@d8@A@'p8@z8p@8@A8P@L8XB@)8@8A@8@8T@j9@9 @ 9@79@<9 @ \9P@d9@fk9@~9@@v9p@9@]9pI@`9@9@ 9k@89@9@v9@u::@):T @J:@@ P:@]:S@o:p@:X@ :@#:&@:@:@: @:@1: @ ;@@  ;@ @5;b@ L;(@HQ;I@_;X@Gm;x@;xr@;@I;@.;T@;n@M;@;@^;0S@<X@ <@@#!<\@ <<@D<p@JR<@"_<@l<((@N<@L<@<`f@<l@<@G<@<@@<'@b<@@=@@=@ $=A@+=@D=@K=h@k=@p=@x= L@D=@.=@=@d= @R=$A@*=]@ =@.=@{@ >`I@  >@)> @<> P>|X@'j> :@v>`@>\=@;>@,>X@>@ >!@>@>@?> @ ?4@"-?P@3?@J:? P?]@ n? @u? @y{?@@ ? @'?@+?`@"?@?@;?@ ?l;@?@q@TU@@pN@+@p@ A@@F@P@R@@]@Nj@p*@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startmke2fs.cint_log2int_log10progress_closeinvalid_blockusagesyntax_err_reportzap_sectorget_string_from_profileparse_extended_optspush_stringedit_featureok_featuresget_int_from_profilemke2fs_setup_tdbprogress_updateprogress_initshow_statscreate_journal_devread_bb_filewrite_inode_tableshandle_bad_blockscreate_root_dircreate_lost_and_foundreserve_inodescreate_bad_block_inodeconfig_fndefault_filesutil.cprofile.csyntax_err_cbend_or_commentparse_quoted_stringprofile_free_nodeprofile_free_filefree_listcompstrprofile_create_nodeprofile_add_nodeskip_over_nonblanksskip_over_blanksparse_lineprofile_update_fileprofile_node_iteratorprofile_get_valueconf_yesconf_nodefault_filenameprofile_open_fileprof_err.ctextlinkdefault_profile.cext2_err.calloc_stats.calloc_tables.cflexbg_offsetbadblocks.cmake_u32_listbb_inode.cset_bad_block_procclear_bad_block_procblock.cxlate_funcblock_iterate_indblock_iterate_dindclosefs.ctest_rootcsum.cext2fs_group_desc_csumexpanddir.cexpand_dir_proclast_blk.4076extent.cupdate_pathextent_gotoext2fs_extent_fix_parentsextent_node_splitfreefs.cgen_bitmap.ccheck_magicgetsize.cvalid_offsetgetsectsize.ci_block.cind_block.cinitialize.cinode.cget_next_blockgroupcreate_icacheio_manager.cismounted.cllseek.clookup.clookup_procmkdir.cmkjournal.cbuf.4584mkjournal_procnewdir.copenfs.cread_bb.cmark_bad_blockread_bb_file.ccall_compat_invalidres_gdt.crw_bitmaps.cwrite_bitmapsread_bitmapsundo_io.cundo_io_backing_managerundo_io_read_erroractual_sizeundo_set_blksizeundo_read_blkundo_flushundo_set_optionundo_write_tdbblksize_keyundo_write_byteundo_write_blktdb_fileundo_closemtime_keyuuid_keyundo_openstruct_undo_managerunix_io.cunix_get_statsfind_cached_blockraw_write_blkflush_cached_blocksunix_flushreuse_cacheunix_write_blk64unix_write_blkraw_read_blkunix_read_blk64unix_read_blkunix_set_optionunix_write_bytefree_cachealloc_cacheunix_set_blksizeunix_closeunix_openstruct_unix_manageralloc.ccheck_block_uninitalloc_sb.cbitmaps.cbitops.ccrc16.ccrc16_tabledirblock.cdir_iterate.clink.clink_proctdb.cemaptdb_brlocktdb_transaction_locktdb_transaction_unlocktdb_lock_recordtdb_unlock_recordtdb_converttdb_munmaptdb_mmaptdb_ofs_readtdb_next_hash_chaintdb_ofs_writetdb_rec_readtdb_rec_writetransaction_next_hash_chaintransaction_oobtransaction_brlocktransaction_synctdb_recovery_sizetdb_rec_free_readremove_from_freelistupdate_tailertdb_increment_seqnumdefault_tdb_hashnull_log_fn_tdb_unlockall_tdb_lockalltdb_oobtdb_unlocktdbstdb_expand_filetransaction_readtdb_writetdb_readtdb_new_databaseio_methodstdb_alloc_readtdb_parse_datatdb_findtdb_key_comparetransaction_writetransaction_methodstransaction_expand_file_tdb_locktdb_locktdb_find_lock_hashtdb_exists_hashtdb_freetdb_do_deletetdb_purge_deadtdb_delete_hashtdb_next_locktdb_traverse_internalC.64.4017seen_inserttdb_dump_chainerror_message.cinit_debugdebug_maskdebug_fbufferet_name.cbufchar_setcom_err.cdefault_com_err_procresolve.ctag.cblkid_find_head_cacheblkid_new_tagcache.cdev.cdevname.cprobe_alldevno.cfree_dirlistadd_to_dirlistdevdirsprobe.cfigure_label_lencheck_for_modulessearch_fat_labelprobe_zfstype_arrayprobe_lvm2crctab.3810probe_oracleasmprobe_iso9660probe_swap0probe_cramfsprobe_romfsprobe_luksset_uuidprobe_ocfs2probe_jfsprobe_reiserfs4probe_reiserfsprobe_xfsget_ext2_infoprobe_jbdprobe_ext2probe_ext3probe_ocfsget_bufferprobe_udfudf_magicprobe_swap1probe_hfsprobe_ntfsprobe_fatno_nameprobe_fat_nomagicfs_proc_checksystem_supports_ext4devret.3029last_check.3028system_supports_ext4ret.3010last_check.3009probe_ext4probe_ext4devprobe_gfsprobe_gfs2probe_hfsplusread.cskip_over_wordskip_over_blankstrip_linesave.cgen_uuid.cget_random_fdget_random_byteshas_init.2491state_fd.2414last.2413adjustment.2412state_f.2415clock_seq.2416node_id.2490isnull.cpack.cunpack.cunparse.cuuid_unparse_xfmt_lowerfmt_upperfeature.cjrnl_feature_listfeature_listbuf.4432buf.4372hashstr.chash_listbuf.2393parse_num.costype.cos_tablibgcc2.cctype.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrtol.csort.cstrncmp.cstrncpy.cstrrchr.cstrcasecmp.cmemmove.cstrcat.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idmsleep.cdo_nothingpv.cget_tick_count.cenvvars.cenvvar_listgetenvvarnet.cerrors.1392protocolsservicesh_addr_list.1450ip.1449aliases.1448hostent.1447buf.1416proto_aliases_tcpservice_aliases_httpservice_aliases_imapservice_aliases_ircunlink.csignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_fileaccess.cgetopt.cplace.1334getpid.cmisc.cstat.clost_statinode_numtime.cuser.cwait.cwait_listrpc_child_exitutime.cstrerror.cerror_message.1085posix_dir.cmktemp.cfileid.1150rpc.clost_link.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.casprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexrand.crnd_seedmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cnetwork.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrtok.clast.930memchr.cmount_dirparse_pos_paramsputcharuuid_unparseblkid_dev_set_searchext2fs_reserve_super_and_bgdext2fs_badblocks_copyblkid_dev_nextext2fs_free_generic_bitmapstrcpyasctimeinit_dev_listext2fs_extent_insertext2fs_unmark_generic_bitmapext2fs_extent_deleteunsetenvrpc_send_responseext2fs_extent_replaceyieldext2fs_default_journal_sizeext2fs_update_dynamic_revext2fs_tdb_parse_recordrpc_get_envvarswaitpidblkid_devno_to_devnametmpfileext2fs_badblocks_list_del__divdi3ppb_from_argvuuid_generate_randomext2fs_tdb_set_max_deadext2fs_tdb_unlockallblkid_probe_allstrtok_rfs_paramlist_sizerpc_get_responseinitialize_ext2_error_tablegetgidprintfstdoutvsprintfrandomext2fs_get_free_blocksutimelibrpc_rpc_handlerrpc_get_stringext2fs_tdb_errorblkid_strdupext2fs_write_inode_fullext2fs_read_dir_block2ext2fs_inode_scan_goto_blockgroupext2fs_write_ind_blockblkid_get_tag_valuesync_kludgeext2fs_get_device_sectsizeprofile_set_defaultext2fs_get_blocksungetcvolume_labellist_pushext2fs_tdb_chainlock_markext2fs_create_resize_inodeext2fs_tdb_enable_seqnumblkid_known_fstypequietext2fs_resize_generic_bitmapsigemptysetstrerrorgeteuidinet_ptonext2fs_unmark_block_bitmap_rangerpc_get_intext2fs_u32_list_addmemmoveext2fs_closeext2fs_process_dir_blockext2fs_fudge_generic_bitmap_endsnprintfuuid_generate_timeio_split_dirname__strtok_rext2fs_write_inode_bitmapext2fs_descriptor_block_locblkid_put_cacheext2fs_compare_inode_bitmapprofile_set_syntax_err_cbreset_com_err_hookblkid_find_dev_with_tagjournal_deviceext2fs_read_bb_inodeext2fs_tdb_namemknodatolext2fs_tdb_lock_nonblockblkid_dev_has_tagblkid_verifyparse_journal_optsget_parent_pidip_to_stringlio_seekprofile_get_stringgetenvext2fs_get_generic_bitmap_rangefchmodlist_pope2p_string2featureerrnoext2fs_tdb_transaction_commitblkid_get_devstrtoldgetegidisblanksetlinebufinitialize_ext2_error_table_rblkid_new_devgetsext2fs_tdb_lockall_markio_create_linkext2fs_make_generic_bitmapext2fs_tdb_open_exio_split_filenameppb_get_argcext2fs_compare_block_bitmaptimer_cancelgetprotobynamegetpidgetpagesizeinitialize_prof_error_table_rqsortio_get_absolute_pathfgetsext2fs_block_iterate2ext2fs_tdb_dump_allext2fs_tdb_nextkeygetcv_and_wait_for_rpcmemcpymem_freeext2fs_create_journal_superblockverbosesetvbufwait_for_rpctimer_callbackfs_typesseekdirext2fs_extent_openext2fs_u32_list_delperrorlazy_itable_initcreatreadlinktdb_nullinit_waitpidputsdup2ext2fs_u32_copyrpc_send_string_responseislowerext2fs_read_inode_bitmaptolowergetuidrewinddirinit_execvfeofext2fs_alloc_blockinitialize_prof_error_tablemallocremovelist_is_emptyisattyjournal_sizesleepblkid_get_dev_sizeoptargext2fs_badblocks_list_iterate_endprofile_get_integer_assertext2fs_rewrite_to_ioblkid_dev_devnamevsnprintfrpcext2fs_badblocks_list_createmke2fs_default_profilee2p_feature2stringext2fs_read_inode_fullstrtoul__dso_handleitoaio_channel_write_blk64mktempispunctstring_to_ipopterrext2fs_set_alloc_block_callbackuuid_unparse_lowerext2fs_crc16ext2fs_tdb_firstkeyreaddirext2fs_iblk_sub_blocksget_prognamejvprintfisspaceregister_netcardext2fs_tdb_unlockall_readfflushset_com_err_hookblkid_get_cachelist_get_element_atio_channel_set_optionsregister_intr_handlerext2fs_u32_list_iterate_endblkid_free_tagdirectory_openext2fs_allocate_generic_bitmapext2fs_warn_bitmap2ext2fs_freeblkid_flush_cacheputenv__umoddi3lseekext2fs_extent_set_bmapsigaddsetext2fs_tdb_reopenext2fs_u32_list_createstrncasecmpext2fs_set_inode_bitmap_rangeext2fs_clear_block_bitmapblkid_tag_iterate_begincflagext2fs_initialize__udivdi3bad_blocks_filenameext2fs_set_gdt_csumsetbufferabortprintf_putcext2fs_group_desc_csum_verifygmtime_rchmodsprintf_putcget_tick_countext2fs_flush_icacheext2fs_block_iterateisxdigitext2fs_tdb_fetchalarmext2fs_add_journal_devicecom_err_vablkid_free_devext2fs_tdb_appendmessage_handlerstrtolext2fs_open_inode_scanpipeext2fs_clear_inode_bitmapext2fs_read_bb_FILEstrnlencreate_shared_memoryblkid_get_devnameprogram_nameext2fs_extent_get_infosys_page_sizerenamestrrchrinit_memory_managerblkid_parse_tag_stringfigure_journal_sizeext2fs_block_alloc_statsstdio_inith_errnocallocext2fs_tdb_increment_seqnum_nonblockinit_dev_registerstrtodforceblkid_dev_iterate_beginlist_insertlist_destroy_et_listext2fs_tdb_get_logging_privatewriteatofext2fs_allocate_group_tableuuid_is_nullext2fs_copy_bitmapfstatfprintfext2fs_tdb_lockall_unmarkkillinit_service_registerext2fs_read_ind_blockctimeblkid_set_tagerror_messageext2fs_tdb_log_fndirectory_createstrcatadd_intr_handlerprint_check_messageext2fs_u32_list_iterate_begininit_sync_messagesntohlvprintfext2fs_free_inode_bitmapnoactionext2fs_clear_generic_bitmapmkfifo__deregister_frame_infoblkid_gc_cacheext2fs_flushchdirext2fs_u32_list_equaluuid_generateopen_shared_memorye2p_os2stringext2fs_badblocks_list_iterate_beginadd_error_tableext2fs_badblocks_list_addext2fs_get_inode_bitmap_range__dtor_end__fseekext2fs_get_device_sizesuper_onlyppb_is_validext2fs_fudge_block_bitmap_endblkid_read_cacheoptindmemchrext2fs_tdb_storeext2fs_check_mount_pointjprintf_putcext2fs_tdb_traversestdinext2fs_tdb_transaction_startwaitsend_messageinit_envvarsumaskuuid__generate_timeext2fs_write_dir_blockerror_table_namemktimeext2fs_iblk_setblkid_strndup_startlstatext2fs_group_desc_csum_setferrorsyscall_pblkid_dev_iterate_endrandsignalreadext2fs_extent_header_verifyext2fs_write_block_bitmapext2fs_set_block_bitmap_rangecom_err_hookuuid_unpackstrcollisupperstrncmpext2fs_tdb_map_sizeext2fs_inode_scan_flagsadd_to_error_tablefpurgeprofile_iterator_createext2fs_new_blockstrncpyunlinksetenvmem_allocate_physicalstrcasecmphtonlgetenv_indexext2fs_read_inodeext2fs_get_data_ioext2fs_read_block_bitmapputsncreator_osreallocext2fs_extent_getuuid_packset_undo_io_backing_managerset_rpc_handlerprofile_get_booleanext2fs_compare_generic_bitmapext2fs_tdb_fdrpc_send_dword_responsesync_rpc_response_handlerext2fs_tdb_lockall_readinit_service_getsnprintf_putce2p_string2osstrtoksigfillsetext2fs_allocate_block_bitmapfdopenforkext2fs_new_dir_blockinit_executeisalphaclose_shared_memorylinux_version_codeext2fs_badblocks_list_freesigactionext2fs_badblocks_equalfreadset_undo_io_backup_fileext2fs_set_generic_bitmap_rangeext2fs_allocate_inode_bitmapprofilee2p_jrnl_string2featurestrdupe2p_hash2stringinet_atone2p_edit_feature2list_createis_directoryext2fs_tdb_chainlockstrtoullsymlinkext2fs_get_block_bitmap_rangegettimeofdayblkid__scan_dirinit_messagingfopen__bss_startfs_stridegetoptlocaltimememsetmainext2fs_tdb_openext2fs_tdb_chainlock_unmarkremove_error_tableext2fs_mark_block_bitmap_rangeftell__dtor_start__srandblkid_debug_maskext2fs_get_next_inode_fulljournal_flagsinit_service_get_nameext2fs_tdb_chainunlock_readclearerrext2fs_tdb_traverse_readfclosegetenv_name_by_indexgetcharntohsinet_ntoagetppidext2fs_mkdirtimeopendirisgraphintr_handlerext2fs_dir_iterate2ext2fs_tdb_lockall_nonblockisalnumext2fs_allocate_tablesisprintmem_dma_allocateputcext2fs_expand_dirherrorstrcmpulltoaprofile_get_uintprintf_putsnext2fs_tdb_deleteext2fs_u32_list_freedupcreate_processsyscall_putsnio_channel_write_bytegetcwdext2fs_read_bitmapsgethostbynameext2fs_mark_generic_bitmapcmdline_get_argcresponsesgetservbynameext2fs_set_inode_callbackfgetcgethostnamesprintfasprintfcmdline_copy_argvext2fs_tdb_printfreelistext2fs_resize_inode_bitmapstrtofatexitstrcspnoptresetext2fs_tdb_chainunlockext2fs_lookupext2fs_linkext2fs_tdb_closerpc_get_dwordstderrext2fs_openmkstempext2fs_free_block_bitmapext2fs_write_inodeprofile_releaseext2fs_u32_list_testext2fs_get_generic_bitmap_endsrandomext2fs_set_generic_bitmap_paddingext2fs_extent_gotoext2fs_write_dir_block2ext2fs_get_next_inodemac_to_stringprofile_iteratorsigismemberext2fs_resize_block_bitmapet_list_lockdevice_nameasprintf_putcuuid__generate_randomext2fs_tdb_transaction_recoverext2fs_set_block_alloc_stats_callbackdirectory_closelibrpc_c_rpc_handlerundo_io_managerblkid_tag_nextfputce2p_jrnl_feature2stringparse_num_blocksext2fs_bg_has_superext2fs_u32_list_findoptoptdivmodext2fs_tdb_validate_freelistpreaduuid_unparse_upperlocaltime_rhstrerrore2p_edit_featureext2fs_test_generic_bitmapprofile_initext2fs_tdb_exists__ctor_start__strftimeext2fs_read_dir_blockppb_copy_argvwait_child_addunix_io_managerext2fs_iblk_add_blocksstatext2fs_get_generic_bitmap_startisdigitfwriteext2fs_zero_blocksext2fs_free_dblistext2fs_check_directoryaccessdirectory_read_edatadestroy_processcom_err_endext2fs_write_new_inodeext2fs_test_block_bitmap_rangeproceed_questionext2fs_tdb_lockall_read_nonblockhtons__ctor_end__mem_free_physicalext2fs_tdb_get_flagsext2fs_set_bitmap_paddingrewindfreopenext2fs_read_bb_FILE2e2p_string2hashext2fs_tdb_lockallrpc_send_int_responseext2fs_new_inodeet_ext2_error_tablerpc_response_handlerext2fs_update_bb_inodeexitsyscall_timerext2fs_llseekblkid_probe_all_newext2fs_super_and_bgd_locsigdelsetsetbufext2fs_inode_alloc_stats2blkid_find_tag_devinet_ntopext2fs_close_inode_scanmem_allocateext2fs_tdb_hash_sizeatoiext2fs_badblocks_list_testiscntrlfprintf_putsnfprintf_putcgetenv_countext2fs_tdb_reopen_allext2fs_write_bitmapsfilenoet_list_unlock__moddi3blkid_llseeksyscall_vext2fs_check_if_mounted_exitregister_message_handlertimer_register_et_dynamic_listgmtimeext2fs_add_journal_inodestrlenext2fs_tdb_set_logging_functionopentoupper__init_execstrchrio_channel_read_blk64io_remove_linkfputsext2fs_tdb_chainlock_nonblockext2fs_u32_list_countext2fs_dir_iterateet_prof_error_tabledirectory_seekclosedirext2fs_extent_free_Jv_RegisterClassesext2fs_tdb_chainlock_readcheck_mountvasprintfprofile_iterator_freeext2fs_set_data_iolist_removefcntlext2fs_tdb_transaction_cancelext2fs_open2ext2fs_warn_bitmapext2fs_fudge_inode_bitmap_endext2fs_tdb_get_seqnummkdirmsleep__register_frame_infoext2fs_badblocks_list_iteratepwritecloseget_pidext2fs_copy_generic_bitmapext2fs_tdb_errorstr_signal_default_handlertelldirvfprintfget_cmdlinecheck_plausibilityraiseext2fs_inode_alloc_statsinit_process_exitblkid_tag_iterate_endfreesigprocmaskext2fs_u32_list_iteratejprintf_putsnpackages/e2fsprogs/bin/blkid0000755000175200017520000112654711517101521016003 0ustar tyndurtyndurELF@@4m4 (@@  @ @LQtdSU= @t8vD@ҡD@ut h@! @ÐUth @h@0@tt h0@ЃÐQSP UWVS] H^at&jv胂v苖EE$D$y$`@")ċEt$|$ t$D$$ @=(@s& (@sBwҁ(@rt$<$ád@$#$3É$yǍ")čt$|$t$$oUhr@h~@5H@h@Pk fUVSƅt)h@P5H@hX@S:4$Rfd@Uh@XetRj jPOÐPUWVSE։1ы}Ѝ\5d@uGMt.941v5d@j 脞CC9e[^_9~҉)у5d@j U11UWVS É։ϋEEU UL@L@P~XPEL@gfffmE) U)‰L@ T@ X@\@P@ j1ɋ\@$X@$T@$P@E[^5d@ud@E E e[^_=Af#L@UWVS|ƅ PD EZYjPute[^_à V:E+@E+@E+@P}WEPSi7uVEE@uuEE'@uuEE@uuEE딃 S9EjP]SEPuI@ uE}uSMUEe[^_Ãh@h@@@@p~5d@j-輛Nu5d@j 覛e[^_èt@ߥj@ߥfX@DUWVS,E܉U؉MԅsEEg u9EEEЍvSEPEPu5Eԅt1}؅t*]ԅ~ϋ}1C;]tƒE4W#NuMЅ"B5d@u85d@jjh@贘U1у H׍4'vKtF5d@PD9Gv5d@jjh@MÀwf5d@j^@뢃 uU7uEu j e[^_à u$xe[^_5d@jjh@ɗ15d@uXZ5d@j oW u^_Ph@"e[^_fL$qUWVSQLIEhjRfNEEDžDžDžDžDžDžDžDžRh=@qL+v $$@@@Dž닡`@x8oDž`DžQ]t"5h@j(jh@{QEPUR5`@5 5h@jjh#@蹕:Y`@B`@@DžDžs`@t8u DžG6DžRPhjWL @91)ٍvF9u @ttd@Et P>Et P> ueY[^_ɍa5h@jjh @,EPytV uODžRDž1(@DžtmEt1Pj4uC9uVuuu1M DžDžDžQj4uÃtBEtRuPSA0t) Dž9u13 u[uà uuP1DžuVS{uPuuEt׃ vDžDže STVShp@5h@赆$ɝ5h@j1US]j=ƒtL(XBBB Ћ]ÍvUWVS Eue[^_ÍvE8L(uE tދEt׃ ً} 1Q<ً}1щ $o<ÃtptVu VDY_uS DUBt P8}G t P8EpX 1I V83& P8UVS]tHCBsC9t PW-C9uCt PE8]e[^48e[^ÐUj4j @t‰B@BB f1҉ÐU1ÐUEfUS]j迵CK1҉]fUWVS }u u 1ۉ؍e[^_Ðt9u$9VsBBuEtƒSWÃt@(t7E9tF(SFPRAS,UtF,tPRAumC0EtF0tPuAuIEF,t7MV0t%VWt@(u PfU9E%Eu1EÅ@$ VC{G_;COF,uQF0uWUWVS Nj0t!v^ 654$5ރue[^_UWVS u} tIt1 GP8ÃtPWVS?;؍e[^_f1эy뼐1ۉ؍e[^_UjufUWVSƉjx8Ãt VtCe[^_à S4UWVSXuoƃ 1}I VnƒZ1򮋅)=ẁz.uBt<.vSuh@PY[URPixE%puU 9UtZUi=@^EPRj@E%p=@-U PsU Vne[^_Àz,UWVSEEE`@t1ۍvU(d@Cu}uf]tGCEVWu3GX3/3$'3EuEuƋEEE]uEEe[^_UDH tu9s19w)@ÍvU1ÐUWVSׅ~GtAq 1 v t.1ȉƒ3@ƒ3 @Fu;KuC E̍S!MͿfBF!tA@DDt-ABF!uj&EPh@Epk'1e[^_ËEEƉ]EfUjE(Ph@Ep'1ÐUS]( PSh@Ep&1]fUS]jjh@s&jjh@s&1]ÐUEP0x0tjRh@Ep&1Ív1UEPxtjRh@EpS&1Ív1US8j(EP]S9j(Sh@Ep&1]ÍvUWVSHE։R)t e[^_Ív}WV?*tj%WSu%e[^_û@fUVS]uj@Ph@s%PC1s1e[^fUVS]sЉ9Ct e[^C9Su)C9uݍt-jPh@Ep%MA111ϐUVSuEx$t+X$PF1jSh@v$1e[^f1USMA, u ]Ë] C1;A w,U B@2<v#1jSh@]sc$1뾸뷀ydu1ۍQTMA1-ōYdfUVSu]{lt+Clj Ph@v$S F11e[^f1UWVS E׉ˀyxuJ1jPh@u#Sh1ɋEC\uJ7@t C`te[^_ÍAx볍vjh@h#@ux#e[^_Ð VA'u@E7돐UMA`u fUBU *1fUMA\tAduA`uUBU 1fUM`tA\tAduA`uUBU 1ÐUVSu]jh SPM7t hSP27opnqwaEUPEPh@v!srPPh9@v! UF11e[^Ðjh2@h#@v!농vjh,@h#@v!gUWVS ljUM]1΃~EE;GvPwy1tGEGjuu7$y=1e[^_Ð|wG tT;D3 wMA= 9}jWh@Ep 1ow0q Ѓ?Ȁ)Pq ?Ȁ)Ѓ?Ȁ)OUVSƊtv\uF>tFue[^Ð PlutFUSÊu vCt P1u؋]ÍvUWS1эA;t$< GO;t GPu؍e[_ÐUWVSlEtJjEpBƃx1EPVwIxEU;BtBt V<e[^_Ãh@VBÃtՍPShPn0t*vw>PS)PPnt1эQ\tNJq<#i@Rj>Pƅ1@x>]j<~t5 @ ut G +PƃyPjVu V{j=ƅMF8"8t @@u?Wjj["A b SeUbEBi@ucVjjG@j"POW0 Wv @u!Qjj!A$1IQK`j VUWVS\ME9@PU\EPuEƃWyEhJ@ukE EEE9u }19]ttKtC8/us$s hX@uZC{s9twwh9@uYZ?9uPshB@u?Z19]ux Ub uXcE9EtYo 1}уQÃt-WuhP@P$ 2ZYSuB$'Et' ue[^_Ã=@1e[^_þe[^_Ãju ?xӋE%p= ` 1}уQE>Ruh%@P>XuJÃxyhJ@P<E_XhSB]UU RPh/@uX6E@5@ u0hPAUVSUM ]u [^Ð:L(urB9tFFB1UWVS ׅu 1e[^_ÍvtXp9u9t݃Wsu؍e[^_ÐUWVS U} u 1ۉ؍e[^_ÐtBr9tfÃWptЋ9uƍvUEuËM tu PUtt݃upyÅfUWVS EuEEe[^_ËE t}t uEvU EXx9EE v9tIsuvuFU9P~׃jp.<uËvuFE9uutDUB(8RuEO@(U EE]t&E@ P} uREvUEt8L(t US]tJCBSC BCt P Ct P ]] v]ÍvUS]j ƒtL(XCBЋ]UWVS ]u e[^_Ãj=Sƅt߃ Sǃt)ލ0XP"t#'t St*U :U1뜍XPS_tƃ W jUjjt‰B@BB f1҉fUWVS ]ue[^_ÍvM tuuE~'@u CEu SƃE~uWt3 WEFsEtMU tN1I u14@u S,U] V}sDž u GUW_S { CW:sMʉEtesEH WP GO @u tEsK0MUw?EtO u [MAtMsV N FQ bEt ut WV W@Xu7USjQRP!xPjEPS4]Ð1]ÐUWVSd}EPW;uE%p= EEEEfEUEUEUUMQuݐEU9U|~EUe[^_Ð9EsvEUEUӉ1ډt ]u땐]u댋Eؙe[^_UE U|#~@)Ív=wRuPu2ÐUU1ɊBu Au1UVS։ˍURPUE$EPEPEPEPEPPREPEPuSV@e[^ÐUEU @fUEU @wvUEU @_USM] A Q Q ЉQA fCQA fCQA fCA C fAfC[ÐUWVSTEPu9u Ep 1h@h@_ƃRPhS_PVhS^j Stj S|tuSt&tEPS8uEpu9}u V`WE uh@u 1e[^_à V.WE 1e[^_Ë}Ujju uÐUWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1U1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐU]Ít&'U]]u}CvMs%V tR( @Ѓ, @%=t&ftt]u}])믍t&0 @4 @֋~t11҃9Љw~N1)=@ @D @A)AVF ޭޅttYPtOAtUL @fP +PA +A9R L @G8 @< @]u}]ËVfQ맍v9 H @tQ9 L @t=tABAtA 1)P @T @A $ D$hL @뷋AH @륍'U0VS T @ P @ @ @9s։ D$ $蚇ۉt11҃9ᆳމw1 AqA AAP @T @[^]Ív Ft&P|^~ @t&9t&wv|.~5 @t& @t&w0 @vwv|ލ~ @t&8 @< @$&UWVSt&8 @< @EEEMtыH @! L @5H @Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5L @rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf1hfL QA UQEyACKGDGE1ҍY@ @D @ڃt )ÃfC*[^_]ÉE}tETF^05H @E;11FKAA y]YEAGDGFEH @GG@ GG@GxUGPGMHGDGE1@ @D @GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0FCP X9{<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Í( @Ѓ, @%=t ftu0 @4 @1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$to$V;E\$H)ʉ}9}EE{ƍ4Ct"$ju${u߉M tU :Uth}-@ [^_]Í<0Ct[@D$ED$$|u˃1[^_]Í& tED$@D$$pE @[^_]Ív'U3$b@d@44@&@ =`@uÐUWVS }1=vl@t$$xt&9{ul@t$$x$ƍ [^_]UWVS }1 v9{t+l@t$$oxu [^_]t&l@t$$gx$- [^_]UVSl@$OƋEh@Fh@11&@;Fwl@\$$wul@\$t$$#yE D$F$j^[^]yl@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$z\$D$D$ E D$E$$[]ÍUED$E D$ D$D$E$$ UED$E D$ D$D$E$A$ UED$D$ED$ E D$E$$Ux`@ f@p@Ít&UWVS,EUMI=t@Gt@p@ Eu&)ċE\$#D$D$$ED$ED$C$E\$t$ |$D$$B#t&1 &p@\$$TutF;~up@\$$XuE;u|;~t)&KpV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$\$ƋG 4$D$QG $2<$*]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1$k$c]u]Í&U(E uu}}]EEEzp@t`$dÉ0E{C<$O|$ƋE4$D$*s \$p@$t]u}]%t&뙐U 0]Ít&U j0]ÐUED$x@$vr1tÍv'UED$x@$Fr1tBÉ'UWVS }1]v<$D$t&x@t$$quԃ [^_]0$C$$x@t$$qUWVS 1t&<$D$Jt.x@t$$rqu [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$t9E r݉4$tt$$D$&$t4$E t$맍vUE]utoU1u ]u]ÍvE $5t$ƋE $t4$D$E D$WE tC$1s롸$;tE$s$E $s$҉CthtdE$sD$ED$$E $lsD$E D$C$x@\$$bqx@1$>C$3$+U]]u$#\$D$$@o4$؋u]]É'U(]u}D$=E$N¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&@eUx@$}mÍt&'UWVS,EEE EFEEE}&$qEF$q]]x;D$E$2EED$D$EE$|$FD$]$EEEED$x@$^mlED$ ED$E܉D$E$EE,[^_] 'UWVSRoD$`k@$ @x@$m'u [^_]ÐD$ D$D$ @$EtЉ‹@ tljB9s&<$hp<$D$tt$<$Hp4$>pUDNjB B9r[^_]ÐU]w-UU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@D@BH@Bt\1ۅt.@[^]É\$$@@Ht\$4$4u؃Hu1[^]Í&@@FD@FH@1[^]Í&1 t&Ht\$4$t\$$@@p֍&'US@]uu%@1[]Í&$ti@B$0r@D$@1[]ÐUED$ D$$1Ít&'UED$ D$$_1Ít&'UD$D$$@.D$ D$$@@@t&Pr@=@@u@ U=@]]uu}} G~&@&]u}]Ív tՅt4@@C@C@C @C1t@G@G@G @G@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$@@u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE]8t&]Í&'UU ~ÍD$D$ D$D$E${1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3L@\$$Gfu@ [^_]fL@\$$7f$*uȉ4$ 1[^_]Í&UWVS1ۃ}9~t3L@\$$eu@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$h@\$ D$T@$ ^ 1[^_]Ít&]F9tD$h@\$ D$@$ ^1[^_]ËE cF[^_]ÍUWVS }L@1 f9>tlL@\$$du$Ƹt>L@t$$rfL@>P@FP@FF t&F [^_]u@fU L@tÍSfL@`@$d@$h@$Ðt&UVSL@t519pt#L@\$$cu[^]Ít&[^]bf&'U(Eu]}t;$(D$4$NjED$)t.]Ћu}]f@ލ&Et$ D$D$E $r)D$|$4$(څt떍t&U(Eu]}t;$'D$4$NjED$b(t.]Ћu}]f@ލ&Et$ D$D$E $B+D$|$4$'څt떍t&UE]uu}} #tEt$|$$'t]u}]Í&]u]}]&t&@ÍUEt&D$ ED$D$E $'Í@Í&UE]u\tVD$ ED$D$E $*t]u]Í$8%u@Ӎv@ UE]t&UVS u ]00 D$@$-0$%ft^ErtDaDED$$,t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$@$H,@@됍&15D$@$,uLvEwfvEwE+D$J@$+v$#@UE D$RD$E$0ÐUS]D$@$F+t$Z#1[]f$h t$< 1[]@ːUS d@u @trh@B @h@:# @8 @U::h@D$@D$h@$^?[]Ð @E d@;] @}A @-t @+@[]QA @-h@ta7D$-U @+@$th@-1&?[]Ív @t&yh@D$E$x:t, @`@8u @h@[]Ív @8uh @9E @PE: @+@8: @Dh@D$@D$h@$?U `@ @+@bC @U@]ÍUE]uD$@$(t;D$ ED$D$E $$$s ]u]Í&@ UE D$D$E$ ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$/M<É'U}׉$]ÉuD$4D$G!$D$D$$l $D$t$$GM G1G,w, O0tAG0G]GT@uT@G}1] US] D$@E$Ct[]v@[]Ít&'Uuu]}} D$@4$;&t%$D]u}]Ðt&4$KtI$1KD$4D$<$GAGGT@T@G@농v'U(]]}} u$|$t]u}]Í&$D$@P%tԋG G\$ D$D$$!G0G$)두U1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtGX@\$$Wu@ [^_]$@GٍEt1~t01t&ȍ<$t&t1 ~t&uދE tFU 1fX@\$$LWnU;uݡX@\$$LW [^_]fUED$$D$Í'UVSu1 t&;0tkX@\$$Vu$ D$_D$@$@1D$ gG3CCX@\$$iX[^]&'UWVSE}}Et[^_]1i&;8t X@\$$Vuމ<$1ۍt&;>tVX@\$$Uu1D$ D$D$@$@FUFF[^_]f뿐UWD$0@$@X@,ÐUE D$D$E$GÍ&'UED$D$$GÍ'U$@D1Ív'UEu1}]$tGtL$X$fw7D$F|$$Ɔ<$R]u}]Ív‰'UE$FɃÍU]7FUWVS }<$W4s/|X4t&B)E4$萸 v@UWVSI1ɉ‰EE#E$(HËE$FStdfuC.C E\$$I11vD$xE$GtXC$JƋCt+rǍ&CC뗐t&$X@JƉ떍F$ݺEE$EuE#&tcu :F/<$TmED$E$NFt8_4$\$9$JƋGu/볍&|E$BGE[^_]Í&$ضE$-ED$E$E8$@@E$D\$D$E$FaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$GҍUUE $T$E ÐU@$[@D$ED$n3ÍU`@$Ít&'U]&US$d@]t$D$ $É[]Í&]ED$$Z=؃$[]fUWV1S }'`@$st4$ t7`@$t7 [^_]f`@$u`@$t1fʍ&'US$d@]tE $D$ $É[]Ít&]ED$$z<؃$[]fUSd@]U u$T$N<؃[]Í\$D$ D$$ []Ít&US]$E\$$td@t$ 2[]Ðt&D$p@$;ؐt&UVSD$@$i@ wD$ D$D$4$5 Ƅw`@D$D$x@4$$`@D$ D$D$$D$@${@[ )wD$ D$D$4$ Ƅwd@ZD$D$@4$6$d@D$ D$D$@$D$@$@ wD$ D$D$4$ Ƅwh@D$D$@4$h@D$ D$D$$$cĠ[^]Ð`@d@@h@Ġ[^]Ít&D$@4$ h@vD$x@4$ `@*D$@4$ d@U1]É'U]Ít&'UE@1] U]&US]U taҋCu@CC{%t't#9t$t&c1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$@F$Ɖ]u}]Íu \$KS<$Q6C $f6U|$T$$蓸\$ D$D$@F$ƋC $G6뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$ 4$谫딍US$]u$[]Í&Ct$ELED$ D$D$@C$D$Ë@ D$E$nC $#$E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+31҄u뱍vC!C$螪뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$=$wt&tyvC!C$n:vK9Crt$ED$ $sY&{Cft$ED$CC$Bsv'U]]u$;U $D$T$ D$^$;]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$蓮tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$>0@$Q0@@EED$ D$D$@G$bË@ <9}sE<D$@D$E$1C $$ަ,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$_utRu4ttG!9u܍f]v֍ovɍt͉$vG!9uIvvE<$ED$ D$D$@G$Ë@<9}sE<D$C $.t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$7 )čt$<$69s@a<w%$@vЃ|+uf<$69rE1ۉ$6UT$D$F$ۮE$6t$ D$@$D$豽U$dw t Nun1ۉ<$Le[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$5$FU$T$谭$&ËFCFCF C FCFCFCFCF C F$C%C$$藥D$ D$$D$C%4$v'UD$@$@Ít&UWVS] D$@E$~C$L# D$J@$N84$t$ D$D$<$uNh@D$D$@$4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$1[^_]áh@D$p@$%@eh@D$@@$@11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$~8$t 1҃[]f[]Ít&'UWVS$1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA +@ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@$Ðt&UED$@$Ðt&U@]ÍU@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB$ \$D$D$$D$ 蟴]u}]fUED$ D$D$@$ÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$@C$腒$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$wD$$FFF D$D$$ta$EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$\$UT$M܉ $$~\$E$FU F$E] UMV~HU1fC D$CD$EE$}MC K9}MƋVT$D$U$v}F D$$ 4$rUE ]u$tD$E$^$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx@t9t)ȉ vt̅u@@@뵋5@9|͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$pk9@u,@9|Qu!@vWu1]u}]Í&tq $;p뛐@ȍ&'U]]u1t#1tr$ok9@t]u]Ít&@t@ݐt&@̍t&US]$xu][]o&U$]]urۉƋEFtM u:3C9@t؋u]]Ít&@9E @܍t&U ؃t21빉'US]t$$&rU PC9@t؃[]Í؃@[]ÐU$q@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUMVuS] u t&8utu1҉[^]Í&C)萐U}}]u<$6p4$ptt$|$$ex؋u]}]ÐU1M9t :u)]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐU$^ÍU]7UWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS @t1ېЋ@uX[G Ungueltiger PPB! 12-Feb-20031.0.0%s %s (%s) COLUMNSlabelfs_typeUUIDmount pointLABEL(mounted, mtpt unknown)(in use)(not mounted)%s: ="M-" valuelistfullToo many tags specified -t needs NAME=value pair c:f:ghlLo:s:t:w:vblkidusage: %s [-c ] [-ghlLv] [-o format] [-s ] [-t ] [-w ] [dev ...] -c cache file (default: /etc/blkid.tab, /dev/null = none) -h print this usage message and exit -g garbage collect the blkid cache -s show specified tag(s) (default show all tags) -t find device with a specific token (NAME=value pair) -l lookup the the first device with arguments specified by -t -v print version and exit -w write cache to different file (/dev/null = no write) dev specify device(s) to probe (default: all devices) Invalid output format %s. Choose from value, device, list, or full Can only search for one NAME=value pair The lookup option requires a search type specified using -t @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @w @ @w @w @w @ @ @w @w @w @ @w @w @ @w @w @w @j @ @w @ @ @BLKID_FILE/etc/blkid.tab%s/%s/devices/devfs/devLABELONEEXT_JOURNALext2SEC_TYPEocfs1ntocfsMOUNTNSR0SWAPSPACE2H+HX%016llXmsdos%02X%02X-%02X%02XJFS HPFS /proc/filesystemsext4devext4mdraid+NN+BDoracleasmORCLDISKntfsNTFS jbdSext3reiserfsReIsErFsReIsEr2FsReIsEr3Fsreiser4ReIsEr4gfs2pgfsvfatMSWINFAT32 MSDOSFAT16 FAT12 Uminixh$x$vxfsXFSBromfs-rom1fs-bfs{cramfsE=(qnx4QNX4FSudfBEA01BOOT2CD001CDW02NSR02NSR03TEA01iso9660CDROMjfsJFS1zfshfsplusufshpfsIsysv~swapSWAP-SPACEswsuspendS1SUSPENDS2SUSPENDOracleCFSocfs2OCFSV2crypt_LUKSLUKSsquashfssqshhsqslvm2pvLVM2 001NO NAME  Td n;0&AvQkkXaMDEVNOPRITIME%s-XXXXXX PRI="%d" %s="%s">%s %s.old A?CWDGET_ENVVWarnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c lrwaitpid(-1) wait.cwait_child != NULLCHL_EXITtelldir: Nicht implementiert 1qay2wsx3edc4rfv5tgb6zhn7ujm8ik9ol0prdIO_ULINKlwIO_LINK ..:/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createx@@@h@@@@@@@@X@@@@@@@@@@@0@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZű@@@@@@@@@@@@@@@@@@@@@@@ű@ű@@@@@ű@@@ű@m@ߵ@ߵ@ߵ@ߵ@ߵ@ߵ@ߵ@ߵ@ߵ@ߵ@@b@ߵ@o@o@ߵ@b@ߵ@ߵ@ߵ@ߵ@ߵ@m@m@ߵ@ߵ@dz@ߵ@m@ߵ@ߵ@m@ӿ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@ӿ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@Һ@۾@Һ@k@Һ@Һ@y@__PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 I@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@7@%@%@@%@%@%@@@%@%@%@@%@%@%@%@j@@@r@%@'@%@ @%@%@%@%@%@%@%@@@%@@@%@%@@%@@%@%@~@t@%@X@%@@%@@%@%@@%@@a@e@i@n@r@v@z@~@@@@@@@@@r@@@@@@@@@@@@@@@@@@@@#@+@,@ @3@@@H@Z@Z@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d wdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK zR| dT'AB E<_AB E,@O@ @@@@ @@@@"@@8@@@8@,@@8@(,@@8@@@8@@@4@ @@@4 @ @@@4 @ @@@4@ @@@ @ @@@@@@"@0@'@@"@|0@+@R0@%@+@R6@%@+@6?@%@+@6E@%@+@6N@%@+@W@\)@+@Y@\)@+@[@\)@^@d@^@g@^@j@^@m@p@u@q@z@@@@`@@@@@0@@@@ @X @@ @X @@ @X @@ @X @@ @X @@ @X @@ @X @@ @@@ @@@ @`@@@@@@@@@@@@@@@|1@@O@|1@@R@|1@t@@,"@@\@@ @@@@ @@@ D@l!@(@ 2@l!@(@ <@l!@@ @@@ D@l!@(@ 2@l!@(@ <@l!@@? @@@? D@l!@(@? 2@l!@(@? <@l!@@ @@@ D@l!@(@ 2@l!@(@ <@l!@@ @@@ D@l!@(@ 2@l!@(@ <@l!@4@ F@@@P@V@$@P@V@$@P@V@$@P@V@$@]@h@@o@x@o@}@@@l@@@l@@@l@@@l@@@@@@@@+@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@  x@4 @V>x@*x@@bS4@[9@a<@_j@C@4mtD@GmD@ nD@pE@n)rE@WLvHG@'IypH@|`J@3\R@sT@Q`T@)2U@.@U@>U@-gU@yPW@ X@]@p`@Pb@gf@!Bf@M @m@ lPm@y;r@xz@]i {@;`}@"0~@Ժ @7`@e0@9p@[ @d@0@ 7@@c@|@@L@@@<@@('p@p@@@`@?@8@@@ @fP@S@@@@H@A@*@K@J`@ @!`@9"@)^#@_$jmainprogname^ 6fblkid_gc_cacheblkid_get_cachepblkid_put_cache#blkid_debug_mask4 blkid_dev_devnameblkid_dev_iterate_end1blkid_dev_next~blkid_dev_iterate_beginblkid_dev_set_searchNblkid_free_devblkid_new_devL>Ublkid_probe_all_newblkid_probe_allblkid_get_dev`*`Iblkid_strndupblkid_strdupblkid__scan_dirblkid_devno_to_devname6o6Ublkid_known_fstypeS/blkid_verify#S"blkid_read_cache$[blkid_flush_cacheablkid_tag_nextblkid_find_tag_dev1blkid_dev_has_tagblkid_find_dev_with_tagJblkid_tag_iterate_endublkid_free_tagblkid_tag_iterate_beginKblkid_parse_tag_string2blkid_set_tag%_jblkid_get_dev_sizemblkid_llseekmnuuid_is_nullMn4huuid_unparseuuid_unparse_upperuuid_unparse_lowerpYuuid_unpackG)r#ext2fs_check_mount_pointext2fs_check_if_mountedLv__udivdi3Iy isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperS|?%errnoQ|init_memory_managerfreeZmallocrealloccalloc\dstrtolsostrncpy`dstrrchr2dstrchrdstrcmpdstrcpygomemcpyymemset9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoullibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*nsyscall_psyscall_vBagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars runlinkl7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill;=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatxoaccessRiPlgetoptoptargoptindoptopt+opterr=optreset0iolinkreadlink!symlinki"chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat<ԺgetuidgeteuidgetgidgetegidGvwaitpid,waitXwait_child_addqinit_waitpidYe=seekdiryrewinddirtelldirreaddir3closedir_opendir%_vmktempmkstemp'[Zrpcsend_message4 io_remove_linkio_create_linknyieldR7,io_split_filenameio_get_absolute_pathZio_split_dirnamedcget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"nset_rpc_handler#yadd_intr_handlerJLa)vfprintffprintffprintf_putsn+fprintf_putc}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr# Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6<_exit2abortGatexit{exiti' 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf{ gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF0vprintfcprintfprintf_putsnprintf_putc8sprintf_putcQvsprintfsprintfa_assert;~]snprintf_putcvsnprintf!snprintf8Pdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timerdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name lio_seekVcreate_shared_memoryopen_shared_memoryclose_shared_memory ysyscall_putsnqmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6nwait_for_rpcv_and_wait_for_rpccppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvHlist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspn*ostrncmpostrdupostrlen( Qd__strtok_r strtok!omemchr%"getppidgetpid^#__umoddi3fQ@@q@h"intXI5Lf7e~t](e 'eoy.Z%1H id2# 13# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzp0H:I3[:c-vl3d@@k@@q<b7IY+,32\t@w@oh"intXI5Sf7l~t](l 'ly.a%1?id2#13?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  j %z&         i D+t@@2out*^ V 0@@q;1/:out1^:@@fcpedw:@@.strudZu:yv:8v:lenx:rety: @@'dS0d|~dWddlen:w:7::\@:X@%:T@z:P@L:L@ i@@UdevzR d3d}d?da0d~dcp?len::W o%aOIcpHdlenH:chJS W@@devzDܖ:b:Rި d3d;i:[:_@@m@@ ? :@w@6=: :y[:  tl ={ =w &?th ?td K?tw ?tw!l ltw %:tw"err:tw#il !:H :tw"gc:tw#c:j $ , @%#devvz % "!R #devz  @s @#devz ?Ma&b7&E8& $?& ':'(dH@2?x@ @Nh"intXf~t] (OV)O(O~)O>*O,+O,3-O.O0]y+4`az# b#c##d# xed#wfo#gz#2i#k# Ml#$m#(ln#,no#0o&4aO&#F'#(a#=)#*#+3#,z# -#$.O#(/#,e0#0 lr ]#^#_#`#XaO#b###>U\?#@#4A#B#EC#E`x@@:  af p  st @@dev2&arg%O3@|@ MbNM N; Pa@ha'x3pXwt|@ @ # sa SX~d@@devSpd @@tagUS d, @@badU"3 @G @v@h"intXf~t](O0]yo&4FO&#F'#(F#=)#*#+3#,d# -o#$.O#(/#,e0#0 QW ]#^#_o#`o#XaO#b#i&k3#lF#&m#n# poC#CC#C#>\?#@#4A#B#EC#EI MX VC WC 9 @+@?  dev8 `,@L@k 1R /3L@@ xR Xx$ dev s@@Z rF Rt 3@@ R & > Oe1 L:dC'x3N XwC @C@=devi@@)$@@f1*B@@tag+vD@v@dev&Fx@x@oh"intXf~t](V0dy%&4IO&#F'#(I#=)#*#+:#,k# -v#$.V#(/#,e0#0 TZ ]#^#_v#`v#XaV#b### . add+ , - k:x@@DU jIpj:R:@@Iret::@@Iret: K addJ XJ3@x@2I}2=`)2:dev4tmp4p55v\G@T@LJ@T@L %fy\x@@oh"intXI5Sf7l~t](l 'l (lV)l(l~)l>*l,+l,:-l.l0zy.a%1id2#13#pid4#.5# 7#8#>9#:H#4<#A=#! % HO> +4`a# b#c##d# xe#wf#g#2i#k# Ml#$m#(ln#,no#0 /!X"Z#?## % DIR& 6 7 # # aRx@@C*QC+dpSTSg %@ @zs$$:ret&L %7 @2@s6 ?4@@7>*>Cdp@?_@@*-]V]*]C}^ dir`dpa1bwc:std    %n@@c8*tpOtl}thdir8  N >`@k6 P@4@foh"intXI5Sf7l~t](l)"z 'l (lV)l(l~)l>*l,+l,:-l.l0zy.a%1id2#13#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>$]4 +4 ` a#  b# c## d# x e#w f# g#2 i# k# M l#$ m#(l n#,n o#0U SH , ZF 8l2 bsu sA&   4 O &+#F '+# (#= )# *# +:# ,#  -#$ .l#( /#,e 0#0       ]+# ^+# _# `#X al# b#   %   T T# T# + ,e Su u fd:##dev#b# #buf## Sk" : x # 6%#+&z#'l# (l# )#J*# %3!4#5#6#w 7#  8#9#:# ;!# <1#8 =#:>A#<Z?#\K @#`aA#dBe#hCQ#x Da# E#5F# G#[H#GIq#J#LK#L#M#xN#O#! P#Q#R#S#T#U#V#W#; X#Y# Z#[#\#o]#^##_# 1 u SA u Q u %a u %q u?  u  u  u  u #i  i #{# ##F y #me#  #0M  #lg y #x# ## Sy u  u  u % u `tl ##E#= # K#L #{ l #3#, | #. #4 l #@e#T3Q#d | u  u S u < "e#  # e#ze#$#4  u   i # #5 ## ##X#a## # e#e# e#  u   #y #e# S u ta crcѾ#MҾ#@Ӿ#ZԾ# i@ & #e8̾#`);#ξ# q q# # 7q#0  u 3 P ۾#ܾ#5ݾ#e#  Q#.P #, # S` ut  #B  #1#  # ##1#1#%S#####V# #$ #(##*(#,#0#2 #4#@i #C#G #R*#Z 1# S u   u  u S* u S: u v # #k1# # " # # 1#q 1#  S##:#^ ### #$=i #'#+ #66v#>x1# S u 979# # ; # #Z #!#T"###($#%#e8&# I u @;G* <#=# >#M?# 8@#N A#B#5 C#e8D# E#$F#(G#,H#0I#4yJ#8K#< T Ui #Vi #q W#X#Y1# S u % u^\P]#~^a#0%_1#p `e#rDa1# S- u/`mq n #o#p#qa#re# S u S uO|@|$ }#~# a #( % u % u % uu`S#g # S#`)S#n# #( #H #P? #X S u S uB# #####jO- #h ### ## #$ #(#,##0##@O##P|a#`3a#V T #[# #  #$#(@#0+#8w #@#A#D#Ea#H| #P  u  u  u &#h # #lsn# ###`)### L #len#S## 1# `)# u### U###A # %##id#fq ###0 # # #@#,####7##"% #$~ f#% #@ #D  #Fr#J#No#R#T #XL#\:#|9#~ # v uU##  #p !# "# %## h&F '#(#)#*# +#,#!/0#1#2#U3# u67#8#oP<.=#># ?# @# ( uCq D#%E#JF# G#%H# LI#J# K#L#M# N#$6O#( P#,Q#0/R#4S#8T#<m U#@.V#DW#HXL#PY#pZ# [#g \#}]# @e(idg#h#i#j# k#m(# 8 u(:@@~'len':end) S :@@5 ΄aP@@tdir :i: `(:@#@<U &!id&!buf'"q  :$@l@h}  #id $ l%buf&e8l#il#crcl'&( 6@ ) :l@@ idbuf"(:t@*~ Npwq( Dilbl+@@,-.@@/0/  %! u'":@@ Y! !id!buf#dlY! ]:@@L! !id!buf#iso!*~x p b:@/@" _!id`!bufabS:0@`@|" P!idQbufR#csbT|"*~U a D:`@@7" A!idBbufCc#rosE"*~F   7:@@H# 4!id5!buf6(8 L1@"@#dev.tagb2str#G %# u$ :$@^@$ !id!buf#osb$ -^ :`@@n$  !id buf#jsn$*~$  X :@ @B$n!idbuf#rs4$'~  c: @@Q% idbuf&#rsQ%'6l*~  :@@%!idbuf#xs%*~K 1@@i&&devidbufes&&3~P :@@n& !idbuf#es&&z:@@& x!idxbufy#es{&&`:@?@ .' ^!id^buf_H #esa&&:@@T@s ' !idbuf 4ovhG|4ovl~*" d6T@V @! (pr4J!off5 ~!len5!3G7!58:X @k!@"(3"idS"bufs"4j:thbs:"(!tl#m(  k:l!@+"@"(h"idi"bufj(##swsl(  eF:,"@"@H#j) C!idDbufEt##hfsGj)("Hp)[*I#  %) uSg:"@%@#*d#!idebuff $#nsh*#mfti*' j*("kp)W(8 k*~cpk@$*l:t$* l:$*8m:$*m:$'m:inl%*nl$%* nlM%'o:*pv%offq %* r%#valr    %+ u@:%@\)@E&,q&!idbuf&#vs,#ms,#dir(,V'~*,J'#tmp*'*%:'*:(*n*('*%H(* (''?:'*(* ('p*4)''6'* ''" ' : ` : %, u !>:\)@)@h)4-;)id<)buf=)#ms?,:*@f+@*- B*2f-t2buf-cpb*7t  %- uO :h+@+@*-now*(  @4ret: @8:+@(,@*I.now*8 $ @2ret: @@7:(,@,@ +. 5!id5buf65+#es8&& :,@,@k+. !idbuf+#es&&9Ha:. ,/-/ -6@///%/?0/_$0%val:|0@0@j-O1-!idbuf-#sbdO1*~.@00@0@41-0!.+00@0@-0?. O:0@|1@].1.!idbuf.#sbdO1*~.@0 1@1@1-0/+0'1@.1@-02/$2%valA{&q2%str$&]$:%buf%&%:#i':#j':#c(lP \:|1@4@P/5Y|/!idZbuf[/(]'^5*J_5#0key`560'V a5sbdbj)_0'Xcl'<dl'&eloffflr0*6gl1'hl* il/1*~jlM1'kl*Nllv1'ml*nl1* ol1'%plextq:1'or*r1("sp)[(~s5{@01@1@=4,0@01@2@W4,0@0*2@42@q4,0@142@:2@4-212@0:2@D2@4,0@0`2@k2@4,0@0k2@v2@4,0@12@2@4,2@03@3@|5,0@13@3@}/5-2O2@13@3@~M5-2b2@03@3@k5-0u2@13@3@5-22>2h,F2-:22,.2,"260R22/\2/f2 v  F ( %5u l6 u5( 6@ -6 u( 6 @ #O6 uV(?6@B Y: 4@9@oh"intXI5Sf7l~t](l 'l (lV)l(l~)l>*l,+l,:-l.l0zy.a%1id2#13#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 +4`a# b#c##d# xe#wf#g#2i#k# Ml#$m#(ln#,no#0&   4 JO &#F '# (J#= )# *# +:# ,#  -#$ .l#( /#,e 0#0  U [   ]# ^# _# `#X al# b#   # #   E4@85@I3' cpDu3chF%3 >85@m5@3R cp=3 Yp5@5@4XH4pZX:WJWcpWdevYretZ: :DJdevcpDtmpend7ret: :ocpDp:cpD1:0Jdev0cp0D7233ret4::"7D3DcpDend}5@9@q4|J4~4buf_fd:4:st6@ devF5endlh5!"5## $%6&h]### %B6%6$!09# ## H$!xc### % 6%6$"%-k7$8'oi7@7@ӻ#(J6@6@#[ %e7 )%*!!9@<@soh"intXI5Sf7l~t](l 'l (lV)l(l~)l>*l,+l,:-l.l0zy.a%1id2#13#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 +4`a# b#c##d# xe#wf#g#2i#k# Ml#$m#(ln#,no#0&   4 JO &#F '# (J#= )# *# +:# ,#  -#$ .l#( /#,e 0#0  U [   ]# ^# _# `#X al# b#   # #   >>\ ?# @#4 A# B#E C# EI  ' x:l X w A: dev ptag.> /::9@<@79J&8p;F8tmp<8(=8 >8?9fd@:W9ret@:9stAL;@devyl|}(8::@:@:@L;@7 % Y:b<@>C@ h"intXf~t](O0]yo&4FO&#F'#(F#=)#*#+3#,d# -o#$.O#(/#,e0#0 QW ]#^#_o#`o#XaO#b# &3# dev# p*#**#*#>\?#@#4A#B#EC#E0 . add+* ,* -* MX V* W* Oe L:d* .3<@<@w:\R,: -\:3-\:tag/bhk<@3=@;jFC; jbl;Xl;tmplpm*;:F4=@=@;1devE< EbU<pG*<d=@y=@tmpM<X3=@=@<devV< Vb@=3Wb`=tagY=JN=@E?@=JKF= Lb=3Mb>XO5>devPi>priQ3>pR*>S3>|qb>@>@tmpc>>H?@h?@?uR=1? .h?@?@\?tag-?v?@?@6 !{?@?@f"?"?!?@?@7 !?@?@f"?"@y?@?@,@K#devX@$R#3?@@@@b@%h%7@30Acp&@@q@@@@c@@@@A tagA K2 addJ* XJ* 3@@>C@AdevB7bGB3bBqBtCXCvalCD'B@ B@+B@ % !B@+B@L "RD  LB@hB@V % !UB@hB@L "D"D! B@B@ % !B@B@L "D 3m@C@tD@h"intXf~t] (OV)O(O~)O>*O,+O,3-O.O0]yous:+4`az# b#c##d# xed#wfo#gz#2i#k# Ml#$m#(ln#,no#0`>3@C@C@ Efd=38E f=aE ch?s wLC@tD@yEfdK3E MM3 YQV e8R \SElowSEH st$D@hD@midFtD@D@<h"intXf~t]yous:r}tD@D@)Ffd~3f~}UF~3 Y3_D@D@h"intXf~t]y'3D@D@Fuu&Gcp(Ri)3Q A0D@}E@+oh"intXI5Sf\6e7w~t]y%23l#4Z#5Z#e6Z#;7# H  @4D@;E@ GR uu3RLG out3_G fmt3]}G 5`XSc%OJ*l,+l,:-l.l0zy.a%1id2#13#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 +4`a# b#c##d# xe#wf#g#2i#k# Ml#$m#(ln#,no#0  z  % :fbuf cpL ret: %#E@0G@KH!wH!W"": $ %fd&:`(HwH :Q0G@GG@HPP a HG@oH@int~]ohf" % , X t   !    low`#\`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k!_HG@oH@ In^LId^lI`A7-LWbmIxI)JkJKDKbKt`G@G@KG@oH@KK6-!5!pH@UJ@8Y!4AAc3Ainti!9Adc8A! AcA!*Ac)A!HAcGAq!MAcLAdpH@~H@Lva!%AH@H@ALc$AH@H@mL; L!/AH@H@Lec.A%H@H@L7HI@I@'MZQ!>A I@NI@SM c=AM!CAPI@I@M cBAMI@I@MI@I@N3y!RAI@I@AN cQAmN I@I@Sv 1 HI@I@S %!WAJ@J@N cVAN!\A J@5J@N c[AO!aA@J@UJ@"O c`ANO; !!XJ@XJ@ 7@int="!`J@R@h"intXf7Z~t&"yZ](Z"IJ#K#h#Lh#e8Mh# Nh#OM#!OMYM#ZM#[#&\Z# e8]h##^h#M#s30"z3 {" s cO nz i3  " ptrh#3 5# h#3~ c"d s1 s2d nz!k!#kS"x"xjqoZ " s c3 nz i3"`J@eJ@mO"pJ@L@OptrOminMPmaj;P-hoPSJ@J@`J@J@mK@K@~K@K@PhK@K@D#hz#h K@K@!# L@M@PZ"e8hP#sthP maj lL@L@$ Q%mH~$`1Q&!>M@P@ZQ'#=zQ!?3QD#@aQpAVRBhRmajC SminDMS "EMpTe8FzT`M@M@ZSM@M@P`N@N@`5O@@O@px`Dh)U`O@O@LP@P@hRU&:Q@VR@pUpU'e8zUptrXVminMV" zV.h WS.Q@3Q@0`PQ@UQ@m( qs.$$7BM(WXU@h"intXf~t]#+U@>U@T[p*[ch*3[c,Qo$#@U@~U@h"intXf~t] $*3@U@~U@[s1)[s2)-\o $#U@U@h"intXf~t]$#U@U@L\to"x\$"\#$o -$#U@IW@Ainth"Xf~t](Ol"AU@IW@\($:\6$:]:d.]dstB{]srcC]tDd^;$}pV@   o    @$#PW@X@h"intXf~t](OI$#AP$%Oy"<PW@X@^($:^c0:3_:d"_ t=dM_ c?z_ dstA_ o5 $5! X@]@Yh"intXf~t](O$#d X@YX@`s"G`l$"df`len$d`  o g$/`X@X@`Cn.O`s.C`#.Oa st0IKi1OFay;Oa t5O YY $]X@XY@astraV$3]b3:b c$`Y@gY@Xbstr $3pY@yY@b1s1s2$Y@Z@b$ɸbendc˽]$̽_#ͽ^neg3Hc_$3qcoutZ@  C$ Z@Z@c$ end  $Z@Z@cK$ends$EVZ@O]@c$Dd#Dd#D3dFVdnegG3eout[@$3P]@s]@es|$1]@]@f1$##3y"%C%]@n`@ h"intXI5Lf7e~t](e 'e%0Zzo y , 7-# (.#  $/%k]@&_@:f$jZff`8jZf&jgil3|gk%qZg&rZup$e0_@J_@g>%dAh(dA%F4P_@&`@$h47%EPh(E0%GdiHZph4HZht%z%90`@n`@h^i:Z$6d@&4`@  !01` @   %2@C#%C%p`@a@!h"intXf7Z~t](Z';(#e8)o#%%*zo  %&%'#%(O#  &ap`@`@h2 %`Oi&b2ic3/i %O`@Oa@Biy %NOni&P2iQ3i%,OPa@a@i %+i%+Oid-O&j%529j&<2i=3Lj%#l@%$Oh@O$'C%Pb@f@o"h"intXf7Z~t](Z 'Z%0|Ooz 3 pid4O# &5O# *&6o# &7z# s&8 '$ ;(*# e8)o# %$%*Ao 6&tpids|&sO4u3J'v&rPb@b@_jpidp|&pOJ'q;&bb@b@jpida|&aOJ'a3L&Sb@c@jgpidQ|&QOJ'ROA'Cc@@c@jpidA|&AOlenAo&B; &A@c@\c@k&`c@d@;k{pid|gk3';k*&ok&;k&Ok~&{J'K0g\Hrl}A H!"'1d@d@!lpid0|3'0;*&0o&0; "J'2!d&;d@Ue@Ml#pid|yl$3';l$*&ol$&;l%3;l%J' m%S'Om&&3`e@e@2mpid|^m3';~m*&om&;m33mJ'm&&Oe@f@%nppid|Qn3';qn*&on&;n3OnJ'߉n'&L f@f@o$J|Do&JOzo*&Koo&KzoJ'M&Nzo(&3Ot@)&:*'.p@0&'^'f@f@#h"intXf~t]o'f@f@p' f@f@/p|&(f@=m@ $h"intXf7Z~t](Z 'Z3pid4O#&5O#*&6o#&7z# s&8 o   ';(#e8)o# % %*y(V7)#3*#P(+1 k(f@g@[p43p(͙ V ' g@Gg@p43p(G(CPg@g@p7BqiD3Uq(E'g@7h@sqd7qi3q(q 7@h@[h@r70r(Prd(e`h@h@cr"dre8dor3hr I(3h@Oj@s_7Gs3gs(3s(s i@yi@  (3Pj@j@s1't3(t0(#3j@?k@;tstr"gtsep$tp'.ot7/#(3@k@Uk@t 7(\`k@cl@t!pidZ|u&ZO;u"`8Zo"&[z #J']zud#'^ouh#'_oulY(_o[u$i`3up(a '6pl@=m@nuU/=|ul@5m@'AUul@5m@>Cu7K3Lu #'-lx@ % Y3(((@m@Im@%h"intXf~t]yo('3@m@Im@u 'k\))(Pm@r@&h"intXI5Lf7e~t] 'ey (#A )~)   3 )(#)#])3#0))(o(3Pm@m@*vs(sVv)3v 2)3m@m@v(sv)3$w)&3m@9n@Zw(%)%3w )>3@n@2o@w^=3w(=6x)=sxi?3x)os@o@o@yB)ns1yidpZ@(3o@o@sy(sQ)3o@o@y(s(3p@ap@yi43)3pp@Jq@ycsig3#z)cYzoldrz i) J)Pq@q@z)3z()>{<)H3q@!r@\{)G3{([{)g0r@Dr@{f){Pr@rr@|<)z3K|-)k3r@r@k|w pidjz)j3|G!)+w@!%),@@!)-@t%" Y39=+*(r@z@~'*!0*:oh"intXI5hf7~t]()" '>*,Oy.v%1uid2# 13u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * r* * * * ' ; (# e8 )# % % *b*'8 *(8#fd)O# )*+O# *,O# dupOr@r@|kfdO$*Or@s@|fdOz*O17Os@s@}fdOF}I*iO} *Os@t@}fdO}cmdOp~I*~iO~t@Dt@sap%argO$Pt@|t@ap%argO7)POt@^u@J*O8vI*\i]O2*:`u@u@ *~8u@v@7fd}O*!I*iO^)v@v@|fdObufȀ" "f#8@#*^ret| $\*v@lw@ZfdOсbuf" "f1#8i#*retpw@w@΂fd~O"f~"~Og#8fw@9x@݃ fdeO Hee8e#g8)1oKH@x@x@GfdGOs"HG"e8Gׄ#I8#1Q9U*8x@x@W%fdO& ':i7Ox@z@ `)O(*l*>fdOg#%8)af 8y@y@|f8׆*f8+:,-@ :Oz@z@? 99(*0L@ (*3OP@.C*68.b78.E88. YO-*(z@{@)h"intXI5Lf7e~t](e 'eyo.Z%1?id2#13?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K *&3z@{@k 1%%3f)dir-  V d Y3L.+( {@[}@*oh"intXI5Sf7l~t](l 'ly.a%1?id2#13?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % +C: {@[}@  +@:L #+A +Ba oliE?H)+D? @  ?E8 V4?`@1: @/+2:h@ +0: @*3:d@ev/-(`}@"~@+h"intXI5Lf7e~t](e)"s 'eyo.Z%1Jid2#13J#pid4#.5# 7#8z#>9z#:A#4]4V  !-+3`}@t}@q ?+* W+*  6+K}@}@1JɉbufJJ O+JzlenLN a G+:3~@"~@%[ ?+9 W+9 Y3m0+(0~@@,h"intXI5Lf7e~t](e 'e (eV)e(e~)e>*e,+e,3-e.e0sy+4`a# b#c##d# xe#wf#g#2i#k# Ml#$m#(ln#,no#0o.Z%1p id2#13p# pid4#.5# 7#8z#>9z#:A#4]4|  v+430~@7~@Q 3 3  u+C3@~@G~@} B3 B e+3P~@Z~@N  ޾ +3`~@j~@Պ    _+p~@z~@ ) +3~@~@- 1 ̾+R3~@a@YDfQDl+QJposSs   +3p@@ԋ3l+J fDb +y3@v@  xl+xJ+z3;{Dd@v@dir  | +3@@ ׍l+J3DfDbր@@buf}|+(T@ Y31+( @W@ .h"intXf~t] (OV)Oy+#d @'@+)d0@7@+/o@@G@؎+5oP@W@2+(`@&@j.h"intXf7Z~t](Z 'Z';(#e8)o#% %*o y + )  pid*|#++ #+,3#t% 9,BCCpidA|iC3+DC ,nvpidm|io3+pCM,|`@^@0&pid|\+&+3+Cx@@#.57I @T@VaSj 3+|`@@qX+&*,T@"@pidS|ɐ+VCoutf@@Ă@V#0.7,0@@qpid}|>&}O`8}o&~z+Cˑ HK#`.7!#.7"H,9@&@#,0X@ $ Y3 4,(0@i@/h"intXI5Lf7e~p,8wt](e 'e0~y.Z],/A%1Yid2#13Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> /!X"S#?## _  DIR&l%"7&"# '#e8(l#)#P*#+# _2 ,-,t0@R@Fsdirssfs~ ,i`@@rdirhsy,]~@@dir\sU,C'@7@ʒ'dirBs,D-,J4,P'h w 2,53@@Z@_dir4s,*s`@i@7) _[55,(p@@0h"intXf~t](Oy,,p@@ޓ,+ len/d@i03^numB3,.3\@ o,^3@@?,]fd_3* len`dP bufa? N N Y3V6":^' @@21h"2>intXf7e~t]orpc" @;@Hpid!Zt #ZP -2>@@@Dpid0Z k%0Z &0Z len1Z* &1zU 33P -:Th ZT D6-@+@1h"intXI5Lf7e~t](eo 'ey.Z%1?id2#13?#pid4#.5# 7#8z#>9z#:A#4]4K  Z-[#t-\#^z#7_#  a-`dct-d#fz#7g#  a`-h -3@@t{-3-?ul-?C/-U@&-a=-ze8zH1  V  a  -33@+@F-1ݗ{-1--2˘43-5a&-6-G?-H?/-@-@R-@k@+@=-mzOe8nzbHo1rt%  a  Y37.^'0@<@2h"intXf~t]o-0@<@(8;.@@@-3h"intXf~t](Ooyo';(#e8)d#%%*  & . i/ ]. .0./ .1&.2#/3# .5&# o6.p*pcwd}L.vu/3.*p1/pcwd}L.vu/(3i)3.Fv .DlenEd.E/EL.Gv of.i@@w@1h*hp:/h3#.jugposkBu/luh.mulL.nvT.wd˛ !!!!"#~@Ȍ@(!!!!0"#Ȍ@@[!!!!H"$(@w@!!!!`"t%%.}@*@]&1L.v'.p(@@'}ǜ'd.@*pi3).3L.v)X/:d*9pe8;di<3L.=v._*]pH]}G.^ib3L.cv%C/}0@@Z&1$L.v*.pudu/3'e8d}'x.}+6@@r!Cx,N"Y"d-|!,Ν,", ,(-!, \,),4+@@@!!RH"^,jΞ"t.@@!!!x,, / /}@@&1J'-}j**pul'e8d'L.v-@+!R"^,jܟ"t.@s@-!!!,,$:/^'@|@4h"intXf7Z~t] 'Z (Zo/'o@ @7 pid(oc/8o@#@v pid7o 9o/Vo0@Q@m /TO uidTz p0T /Uo pidWo /k`@l@/zp@|@ {Ln;/^'@@5h"intXf~t]o/@@_$%; 0^'@@5h"intXf7Z~t]o0!@@>% O];<N0u0@@I6*!0*:oh"intXI5hf7~t]( 'y.v%1Tid2# 13T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`0  O :0  O  O  :70   0v# D0#arg#h0##fp$## k.04O@@fp3#3ap3%p05 tX06h/0<O@!@fp;#;ap=% >OP0/O0@z@%arg.%;#.[n.O  0(O@@arg'%c':ݢm=0u0@z@07h"intXI5Lf7e~t](e 'ey.Z%18id2#138#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 03 0@ԕ@-Yo@@(13@ @T* d03@^@,c3@@V@cs>u{28`@@"8pos3Dc3bo 03@>@c3* @6@cs>u{03@@@ nestrYPP23@ @7strY0/@z@~ 10 11~~e82zT>V>V1)@C*$`@b%d@E&h@ Y3 !?1u0@<@8h"intXI5Lf7e~t]o(e 'ey.Z%1?id2#13?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#&5Z#*&6#&7# s&8a 7id8#69#:#1;Z# *1<?Iid@#6A#B#1CZ# &DI# AX <2EOyidP#2QcUidV#1W Kt%  z2& zres {K#i2 |#%&2* Vt12%e8113E*%@@}c8@@23@@զ*<_3@ɚ@ ^23К@@-_*YH?3e8 "1_2 ?out8@ 2R3@@+*Q2M3@@W*LHL?e8LU2G3 @N@*FHF?c1P@K@srcۨ6*6`8b212'@@&  A  Xb23P@ȝ@ĩ7*e8&23Н@1@Du*p 1yp!13@@Ğ@"*Ҫ#Z2hsО@Z@&*gR 1npos'w ]1N3`@ڟ@ҫd*MfMs4M3`$2@@*2@v@&6$*q`8O283@ҡ@:%str7*7/2%3@%@)c$3U*$&ch&zu{5230@@tc3*֮2E!u2@@ ""8"6|""*#1P 1\'8 'e8(P )'h '*e8,@@*i3+2E1F3@B@( *ET,cGz2]?P@@u "\?ֱ\3 *\,,i^3L,c^3j!\2K @V@ " J"JԲ-1L?up.msgR + SE*iW3#'~4#*R/ +"1_ z 02`@|@|1l3@I@ȳ ?+kW+k Hm _1nK1o,srcqJ,dstxs/  A 1!l1P@<@M "1ߴ""D1#T1U+1V-<1-@-'.Z@-{2/@2E82 Y3A3u0@@h@E<h"intXI5Lf~t](Zoy';(#e8)o# %%*  ,e@@@s d3 msggd 3'hzV+i,A, 33E@ī@3M3Ы@@sk%Lus  ,1 @h@ 03B@@Z@i43mk%5u 3(@ Y3 C3u0p@e@=h"intXf~t]*!q*{o03 d {03 d 3 { 70  0# D0# argd#]V44<3~434;3 3V3 Q30 33l3:3Ok3V433{   4 #3 ]#3}'3|buf|4|O32Vp@Ԭ@31V)31O131 b33Vrem4OO3L@@5.3KVabufKK3KO3KO޷pMuX3N.u`,OV3PO613QOup 33@ǭ@Imp0muc{H43Э@j@ոp0m#!n3A i3043 43p@@!3"43#4-@@'!,S$ap,fջ%4.ud" /3\%403ul"b403"n403ܼ"|3131"423p&i33#43@e@ܽ !p0m!@$apf$&t "043"`){h" Oi"4!O""O" 4#O,',$O">4%3<"4&x(4?@) &ret23) &ret=3) '"#4)H &len3&pad36)x e&ret3F*U@@&ret3) &ret3*6@a@&ret3P*@@+ret3P) &ret3,@(@&ret3,@@&ret3D*ܴ@@E&retX3) -bufl %3m]) &ret~3.( }/01])P +buf "+43)  &len3*@@+ret13P*Һ@@!&retH3h*k@@?&ret 3) Y&ret#3*@@w&ret?3*(@M@&retC3C*M@y@&retE3l) &ret-3) &ret3,(@U@&ret)3*׸@@ &ret^3~) : "3:)P T "3V*ػ@@r &retS3< &retY3p) &c{ &ret3,]@j@+retc3P2{ 3 45{6 BE4u0p@@@h"intXI5Lf7e~t](e 'e0sytm$".T6#3#6$3#U5%3#5&3# b5'3#5(3#5)3#5*3#6+3# o.Z%1 id25#13# pid4#.55# 7#8z#>9z#:A#4@]4 )  5 4 45 5 @5 O6 @6 [6 5 r5 J6 P5 Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec E6 l6 6 5 ]5 4 5 Sun Mon Tue! Wed" Thu# Fri$ Sat% 5& E5' 5( AM) PM* i5+ 6,4|p@ @5{C{c5536635}&@  5`@7@-6__u6bu|q6o@@[@ -6n95`@{@@655@@lb5b htm@@-6ԋ5@@-6݅$6z@S@str/5zT5tmbi.c.e8z&nzO5&5Hw5i .3..5D`@@tCEut5G h  3& tm"@`6%L@ 5&L@r,53@b,,GO0u0@@B*!0*:oh"intXf~t]y0O :0O O : 70  0# D0# arg#4<O@6@c;ap;%Y0=l00CO@@Z@BapD% EOP0,O`@@arg+#+n+OKlen-O0%O@@arg$c$:QH6u0@Q@ C*!0*:o0LRggn:int 0{gng : 70  0A# D0p# argn# 6  H!# 04" #:~{6&g@@Karg%Kc%:6-g@/@H,$,Oap,%op0.l6/` 0g6<g0@Q@H;;ap=% >gPI6u0`@@Coh"intXI5Sf7l~t](l 'ly.a%1?id2#13?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K 6'`@@ 6% %% %:P 6&:{  % E8 Vz5J7u0@@=Dh"intXf~t](O*!|*o03 o 03 o 3 70   0# D0# argo# 6 "W H#W# 7$d# 04%d#7)3@@arg(c( 6C3@k@?!HBWke8BdBapBqp0D d6EX F36U3p@@HTWe8TdTapVq W3PZK77u0@@Doh"intXI5Sf7l~p,8~t](l 'l0y.a],/H%1`id2#13`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %7&# '#e8(s#)#P*#+# %  ,-_7$!!-#' l -%'7*:P*)!@@@nn7C@@l-B'*Dt% w2@@DC7P@0@?-O'.dirQ!N@@Q)e2@,@S7>:0@9@l*=!f==:P70@@@*/!5 L%^'@@Eh"intXf7Z~t]o7!@@% O% OM7@@;Fh"intXI5Lf7e~t](e 'eo 3 pid4Z# &5Z# *&6z# &7# s&8y 8HJE 7KE# L3#@ \8Mz#D 8NU#H U? Ad73@@Dres3pJ'83 @J@deve8z7P@@Sp0ؒ[:S:z9pos3dj83@-@wp0!:3uppos3t%70@@p0:3 supret3[: %K8C@@3Q7B&8l@4@_;cmdk#k3pidm28pzuh7q;8rul7z-8z@~&J 1S7Ydir 7z>8h J Y h w8X@@@W37YmsgZ{81@@7072msg3 8N@@1pidMN8@F@Gh"intXI5Lf7e~p,8wt](e 'ey.Z%1Cid2#13C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#fJl#K3# 9Ld Vt% 8.@F@] *- f-l -3 8/dOQ9^'P@@{Hh"intXf7Z~t]v9%zoa9OP@c@ e8O idO8*9zp@@K idO k ow =9@@ idOFP9^'@@ Ih"intXf~t]otd~93@@nOsniP9^'@@BIh"intXf7Z~t&"yZ]:$hv9%o&9'#9(z#9) :! e8 O `) O ptr" @@.  h91 @>@e80O`)0O ptr28 2P p97@@[@:e86O:/6O`)6O ptr89G3`@|@f39Fe8FOHOt%9U@@9Te8TOQ:^'@@Jh"intXf~t]o.:@@(: @@Ri:@@TJh"intXI5Lf~t](ZK;)3 'Zo :$ ;; `; H: ) *# 3+z# len,o# :/& num0o# :1&#5 :4z ppb5z# ;:6o# :7o# :8o# :QoldP`:Po;PonewRA:>b?5:Y@,@)YppbzUofoleno ;o*i3Qt%:30@@Hppbztoi3R:3;@@+ppbzo)[:+:3 i3Qarg 3I-;b3b` `3alenao :co 4d3newe!"""!#$q:3bshm3 e8opi3 :3 fz L:R:3@`@\9[:9bshm3p9%h & #%1 "a"V"K"B& 'lH#w#(9@@k"""& #)"& ##'f'''#?U;`@@*Ţ[:9shm30retȇC+ Y3=T;<@@Kh"intXf~t](O';(#e8)d#%(##3$o# %*q <N@@V *Mt%  ;Vd@@7 *U v;@y@ *; 43Rzn3 ;o@@ * 439;ݿY<o@B@lH*433 o;&@;(- ;oP@@a *;3o;B@@ *A M<@w@8' *d 43 3oD<X@w@; ;h@@2n *g^ 3goL.m ;6@@*7l;+@;,3@;-@Uh<#@@Lh"intXf~t](OY<&zy`<%d@@s$r<$8s1*c bit+o tbl,Lidx-3v  o ofVz<#@ @JMh"intXf~t](O<%3@ @s1#s2#n$d!oV<#@Z@Mh"intXf~t](O&@Z@@str%llen'd<( o  bW<#`@~@Mh"intXf~t](O<$d`@~@str#s%R oMW<#@R@WNh"intXf~t]<2@*@s14<1<1<3tok3:c43nsc43 <@ o   <`0@R@ s_<_<a@X<#`@@Nh"intXf~t](O<)`@@s&c'3$n(dfXp+R    AOY<(@@Oh"intXf~t] 'Oyo<1d@@<'d@@Y a @+@lOint~]ohf" % , X t   !    low`#\`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k=S@+@uR vRwTpVA7-LWbtPmx)I,?<@@@k@+@% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .: ; ' @: ; I: ; I4: ; I.: ; ' I@4: ; I 4: ; I4: ; II!I/ .: ; ' : ; I1X Y11 41.? : ;' I@: ;I 4: ;I !4: ;I"4: ;I #4: ;I$ : ;% U&4: ; I? < '4: ; I?  % $ > $ > : ; I : ;  : ; I8  I.? : ; ' @ : ; I 4: ; I 4: ; I 4: ; I 4: ; I.: ; ' I : ; I&I.? : ; ' I@: ; I 4: ; I1UX Y 1: ; I1UX Y  14: ; I?  % $ > $ > : ; I I : ;  : ; I8  : ; I8 .: ; '  : ; I .? : ; ' I@ : ; I &I.? : ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I1X Y 11X Y 11UX Y  .? : ; ' I@4: ; I% $ > $ > : ; I I$ >  : ;  : ; I8 .: ; '  : ; I : ; I .: ;' I@ : ;I: ;I .? : ;' I@4: ;I .? : ; ' I@: ; I4: ; I4: ; I4: ; I U1X Y 11&II!I/ 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I.: ; ' @: ; I4: ; I4: ; I.? : ; ' I@: ; I&I: ; I 4: ; I.? : ; ' @: ; I 4: ; I 4: ; I4: ; I !I/ U% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  < I !I/ $ > ' II&I : ;  : ;I8  : ; : ; : ;I8 !I/.: ; ' I@: ; I: ; I4: ; I.: ;' I@: ;I: ;I4: ;I : ;I !: ;I ".? : ;' I@#4: ;I$.: ;' I %: ;I&: ;I'4: ;I(4: ;I )&*4: ;I+1X Y,1-1. /410411.: ; ' @24: ; I 34: ; I44: ;I 54: ; I6 U74: ; I84: ; I 9.: ; ' I :: ; I;: ; I< : ;= : ;>1UX Y?41 @1X YA.: ;' B4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > .: ; ' I@ : ; I4: ; I: ; I4: ; I.: ;' I : ;I: ;I4: ;I.: ; ' I : ; I: ; I4: ; I4: ;I.? : ;' @: ;I4: ;I4: ;I 4: ;I : ; U!1UX Y"1#1$41%41&1UX Y'1X Y (1X Y )I*!I/% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  .: ; ' I  : ; I : ; I4: ; I .? : ; ' I@: ; I4: ; I4: ; I4: ; I  : ;  U1UX Y 1 U41 414: ; I&I4: ; I? < % $ > $ > : ; I I : ;  : ; I8  : ;I8 : ;I8 .: ; '  : ; I : ; I .? : ;' I@: ;I4: ;I&I.: ; ' I@: ; I4: ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ;I4: ;I : ;.? : ;' @.? : ; ' @1X Y  1!1X Y "1#: ;I$4: ;I%: ; I & : ;' : ; % $ > $ > : ; I : ;  : ; I8 .: ; ' I@: ; I : ; I 4: ; I .? : ; ' I@ 4: ; I 4: ; I4: ; I U &I% $ > $ > : ; I.? : ; ' I@: ; I : ; I: ; I 4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > &I .: ; ' I : ; I4: ; I4: ; II!I/.? : ;' I@: ;I: ;I 4: ;I4: ;I1UX Y1 U4141 41.? : ;' I@% $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I &I: ; I: ; I 4: ; I4: ; I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I 4: ; I 4: ; I I !I$ > 4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I$ > .? : ; ' I@% $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3~ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include../lib/et../lib/blkidblkid.cstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.hblkid.hgetopt.ht@*gMuu  p-fu912iZzKc;X˟gggiYYYK!spf  fg=g=K"uuYh"<yK J%/Dxusg]=~<4v =Y=hua/<yvii$X(v/ ^'tL+JxF+*u>=p.lw*v4<Juu =(.KB0Tt<#ˡG2Յ,@Zuw)[.gvn)#=> q ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syscache.clist.htypes.htypes.hstat.hblkid.hblkidP.hx@M\[xtMYB򄼄nXt3 3xw3 0[Y.guF@tz g//}#Y!ׁ2u@i3i=Y=h ."iz$KL=hu歠בh-z0>zxo -s|!Y!=!=!=gAr )qiEgk.iEg8.tYeJkl<tffYjJf7 hnJ gguu tuuK?S |<t|[u|<tw>K?S?"\{{<{< ufA{XNMvX X]"{tf[ /|) >Y24?{<t{tf~֭/Yx.<~Z!pX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidread.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.h4@wY!_u fk<[vVYC{>-[1'H}?h(ױ>Tf-fO= Y=1tKuhKKS<K+ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidsave.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.herrno.h9@9 P#Nt6.vt1خ,X|Ku僭 u0X</ɭuzH f(^. ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systag.clist.htypes.hblkid.hblkidP.h<@ggQYxXNYY~M .sM"RJM6uM1* P[w.w*J'tyT{'?4gxf f=oJ{ycXfg,h}X7JsX= .sf=_.uu=Iug=itJYf?vYgΑwYv=> X~i#Yyf5fJ\wYlك] uKXsY g<c<=Y=.׼tc=g=t&sdOv<c<=Y=tur /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidgetsize.ctypes.htypes.hblkid_types.hblkid.hstat.h@C@=wa3l .D .v$pJ ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cblkid_types.hblkid.herrno.htD@vAyX: isnull.cD@&<]s+1n /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.hD@3B gzJgzgm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.hE@&=uuuH /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etismounted.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hcom_err.hE@S1u!=!=3&XH$gA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hHG@}Y/g?LNf~= uZ!LM  ctype.cpH@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h`J@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.hR@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDZ: ../../includestrncpy.cstddef.hT@)Xg[ye_< rindex.cT@*xG=v,02; index.cU@*z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.hp`@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.hPb@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.cf@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.hf@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf 6 unlink.c@m@&?y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.hPm@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.hr@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]9 ../../../includeuser.ctypes.h @"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h`@i+G ../../../includemktemp.cstddef.herrno.hp@+?82Y t2,I,Ii.i. >绾;/w X hC ../../../include/arch/i386rpc.cstdint.h @!X@Kxx< [T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ 3 sleep.c0@=xM ../../includelost_path.ccollections.hstddef.h@@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c@=gP ../../../include/arch/i386add_intr_handler.cstdint.h@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h@@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hp@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io\T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.h@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h`@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.hP@?Dx ?Dx =3 puts.c@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.h@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h@$>9LV2z S9 ../../includestrdup.cstddef.h@%$T9 ../../includestrlen.cstddef.h`@##+.?>\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h`@(JgKwp@W; ../../../includegetpid.ctypes.h@0gt>A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@&AB Y. 4@<AB B`.4@,AB H. 4@AB Fg.(4@+AB F.q.R.(4@AB FN.-.[.$4@&AB Fk..X4@D  F AB Dl...K.W.j..T.P.R.Z..P.|  x@\AB Fg.(@AB BJ.e.\.p.X.$|@AB FO..| , @ AB ,,@ AB X. ,L@\AB FA.,@=AB DE. ,@AB FE. ,@[AB B_.k.,D@2AB G.| x@AB @AB  @&AB DE.P.(@AB Fx.).Z.|  x@@AB FS. @hAB FU. @AB H. 4@LAB FF.(@XAB IC..T.$@AB FS.}.| @)AB @AB @`AB C@AB $@HAB Be. l@6AB F.@#AB W.@2AB D_.@3AB DO.0@0AB ].`@0AB ].@5AB DO. @ZAB FH. $@:AB BW.P. `@AB BW.S.@@AB Bg.  @AB DI.f. @@AB BZ.M.(@AB FZ.M.G.q.@*AB @:AB @CAB $@@AB HS..^. T@AB Fe.$X @AB Fk.. (l!@AB FJ..b. ,"@AB F_. "@(AB If.4%@dAB FI.. U..H.U. \)@AB F. *@fAB FM.h+@`AB E.o.+@`AB E.o.(,@aAB D,@PAB D$,@AB IP.q.|0@AB DA.0@AB DA. |1@nAB Ik.|  4@LAB Bn. 85@5AB D[. p5@OAB Bu.< 5@AB IR..E.U.C.L.T.a.b.|  | 9@AB Fx.|  <@PAB B <@OAB Fp. 4=@MAB Fp. =@ZAB _., =@eAB Fm.X.@.{.e. H?@ AB X. h?@]AB Dg.b. ?@0AB DE. ?@AB FZ. @@2AB G., @@fAB Fg..U.u..| L @C@?AB DG.$L C@AB FH.Y.|  tD@GAB y.|  D@ AB |   D@_AB EI..@ AB A| \U@-AB A| U@AB F| PW@AB F|  X@9AB `X@AG FX@hAB B`Y@AB pY@ AB Y@AB FZ@ AB Z@ AB Z@oAB FP]@#AB ]@!AB |  0]@vAB FIF00_@AB  0P_@AB AFF00`@>AB | p`@dAB F`@oAB FPa@AB E| 0Pb@:AB D0b@1AB 0b@1AB 0c@0AB 0@c@AB 0`c@IAB F0d@AB A0d@AB ON0`e@YAB X0e@YAB X 0 f@AB IFF| f@ AB f@AB | f@&AB  g@'AB Pg@AB Fg@gAB AG@h@AB `h@AB MFh@_AB LPj@GAB FFj@AB L@k@AB `k@AB Fpl@AB F| 8@m@ AB | dPm@IAB Ddm@IAB Ddm@IAB Dd@n@AB Ed@o@_AB Ddo@%AB do@%AB dp@aAB  dpp@AB MFFdPq@WAB Ddq@qAB Dd0r@AB dPr@"AB dr@IAG | r@AG r@AG s@yAB Cs@ AB Ct@AB F`u@KAB u@RAB AFv@AB Ov@AB Opw@tAB LFw@IAB @x@AB Lx@ AB x@AB Ez@"AB | z@]AB D|  {@;AB D| `}@AG }@qAB L~@"AB | |0~@AD |@~@AD |P~@ AG |`~@ AG |p~@ AG |~@AB  |~@AB FHE|p@EAB D|@AB FI |@AB IFF|  @AD 0@AD @@AD P@AD | `@AB C`@#AB @AB E0@AB F@&AB | 0@"AB `@#AB @AB @AB IH@@AB `@ AB | hp@AB Fh@AB F|  @AD @@DAB E| @dAB F@+AB JI| \0@ AB | @@7AB C@AB F0@AB F@AB F|  @ AB  @AB  0@!AB D `@ AB  p@ AB |  @AB |  @AB | !@;AB !@!AB !0@JAB IF!@"AB | !@$AB !@AB !@ AB !@NAB D!`@AB BF!@NAB D!@@\AB D!@kAB D!@jAB H| "@AD "@AB "@AB "@ AB "К@AB D"@+AB "@-AB " @.AB "P@AB FK"P@xAB D"Н@aAB D"@@AB FF"О@AB D"`@zAB D"@#AB  "@fAB IFF"@RAB FF"@EAB D"0@UAB FF"@UAB F"@RAB D"P@AB II" @6AB C"`@AB "@AB I"P@AB F| %@@bAB E%@AB %Ы@GAB % @HAB B|  &p@dAB FLG&@AB F&@'AB &Э@AB F&p@EAB A&@0AB F&@uAB C| &p@AB F&@'AB &@@AB &`@AB &@ AG &@ AG &@AD &@AB AG&`@AB E| '@6AB '@@AB '`@@AB FF'@AB | p(@ AB Dp(@OAB Gp(0@!AB | (`@?AB |  )@dAB FGG)@[AB H)p@(AB | p)@AB p)@0AB p)@ AB p)@0AB p)0@ AB p)@@`AB FF| *@AB | H*@QAB AH* @*AB H*P@mAB FH*@mAB BCH*0@rAB FIH*@7AB DH*@DAB FH*@@AB DH*@AB PFH*@+AB | +@fAB D| +P@AB +p@AB +@AB |  ,@AB | 8,@AAB LF8, @AB 8,@@AB 8,`@AB 8,@AB | ,@ AB ,@ AB | -@lAB C-0@VAB C-@jAB F-@`AB F-`@HAB L| -@AG -@!AB -@yAB HF-@AB  -@AB FFF-P@lAB FF-@)AB D-@AB MF-@OAB D-@!AB | .@AD F| (/@KAB DD| \/@JAB FI| /`@AD | /@AB BD/0@"AB | 0`@9AB A| 80@AB 80@ AB | |0@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutpretty_print_devmtpt_lenoptargshowpretty_print_lineget_terminal_widthlookupmax_lensafe_printmainblkid_struct_devGNU C 4.2.2usageoutput_formatprognameretvalpretty_print_wordsearch_typeblkid.cdevice_lenstderrterm_widthmtpt/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscblkid_tag_iterateerrcode_tfs_type_lenleft_lenblkid_struct_tag_iterateblkid_dev_iteratedevicesoptindblkid_cachenumdevnumtagblkid_devfs_typeoverflow_nlprint_versioniterprint_tagsoutputblkid_struct_dev_iterateblkid_struct_cachesearch_valuemount_flagsfirstbit_namesbid_prilist_headblkid_tagblkid_gc_cacheblksize_tst_ctimebic_devsbic_filenameblkid_struct_tagst_nlinknlink_tbit_namebid_namebid_tagsbid_devsbic_flagsret_cachest_blksizest_gidino_tbic_timeblkid_debug_maskbid_labelst_atimeblkid_get_cachebit_valdev_t/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/blkidtime_tst_inolist_emptysafe_getenvmode_tbit_devst_mtimegid_tbit_tagsbid_uuidst_blocksst_uidst_devcache.cbid_devnoblkid_put_cachebic_tagsbid_typest_rdevblkcnt_tbid_timebid_flagsbid_cachest_modeprevbic_ftimepnextblkid_dev_devnameblkid_dev_iterate_beginblkid_dev_nextnew_typedev.c__list_delret_devblkid_dev_iterate_endblkid_new_devblkid_dev_set_searchblkid_free_devnew_valueblkid_probe_all__list_addlist_add_tailonly_if_newdev2blkid_probe_all_newblkid_get_devdevname.cdevdirsadd_to_dirlistdirentdir_listblkid__scan_dirnew_listd_reclenfree_dirlistblkid_devno_to_devnamecurrentblkid_strndupdevno.cdirlenblkid_strdups_dummy5s_mmp_intervalmodify_datereserved1nr_diskss_journal_inumxs_dummy2rs4_dummy2blkid_loff_t__pad1embed_first_blocksystem_supports_ext4patch_versionoem_idprobe_cramfsleaf_offs_def_hash_versionsb_validprobe_gfsvd_typeprobe_romfsms_sysidvs_hiddens_jnl_blocksoffset_xlvol_bkupocfs_volume_headerbytes_allocatedbuf_mftvolume_idext_block_startmd_magicswap_id_blockos9_folderrs_orig_journal_sizedl_idvd_idnext_cnids_free_blocks_countbim_lensws_volumexs_dblockss_algorithm_usage_bitmapsb_bsize_shiftfs_nameuuid_tsect_countprobe_ext4devreiser4_super_blocklvm2_pv_label_headerfat_entry_offatrbleveltime_creatxs_dummy1probe_hfsplusms_headsxs_dummy3blkid_known_fstypevd_versionms_ignoredsystem_supports_ext4devs_stateprobe_swap1sectors_per_clusterminor_versionlast_checkjumpret_uuidlast_mount_versvs_cluster_sizes_reserved_word_padjs_sizers_journal_blockset_uuid0probe_reiserfs4no_addrheightcluster_per_mft_recordmsdos_super_blockxs_ifreecat_fileromfs_super_blockfile_attributesequence_numbers_prealloc_dir_blocksdir_countbuf_sizesb_multihost_formatrs4_dummynext_sect_offlabel_strvs_sysids_feature_incompatprobe_jfsusa_ofsprobe_swap0checksumvol_idleaf_blockdepthudf_magiccheck_for_modulesusa_counttotal_blockswr_cntvs_flagsbios_parameter_blocksws_badpgerrnojs_versionvs_pmagicattrlvm2_calc_crcno_formal_inos_min_extra_isizexs_fnamentfs_super_blockattr_filesignaturers_dummy2rs_dummy3rs_dummy4no_namevs_ignoredcrctabprobe_ocfs2vfat_super_blockjs_loguuidblkid_verifyjs_l2bsizers4_uuidembed_blockcountprobe_luksrs_magichfsplus_catalog_keys_prealloc_blockss_journal_uuidvs_total_sectget_buffers_mmp_blockunicode_16be_to_utf8unicode_lensb_master_dirsb_bsizehfsplus_extent__u16not_persistents_first_data_blockvs_magicmount_lenparent_idattr_lenvbm_stvol_seq_numvs_versionsws_padblkid_magicgfs2_meta_headernon_residentreiserfs_super_blockinstanceext_block_countisosbfuturemdp_superblock_ss_raid_stridefound_typebytes_per_sectorsws_versionms_fat_lengthprobe_lvm2checked_datevalue_lenleaf_node_sizeprobe_fat_nomagicrs_labelalloc_first_blockleaf_node_headout_lenprobe_hfsnum_root_dirsstart_filelink_countosx_foldervalue_offsetvs_dummy2ms_cluster_sizecluster_countprobe_ext2xs_fdblocksmaster_file_table_recordclp_sizes_free_inodes_countxs_magicssize_tname_offsetms_serno__u32create_datealloc_block_sizecramfs_super_blocksb_lockprotoros_magicms_hiddenhfs_mdbfs_proc_checkleaf_node_countrs_uuidcrc_xlvs_insfo_sectormaxloophfs_finder_infoattr_offin_lenmh_magicdate_creatfigure_label_lennext_allocms_secs_trackcheck_mdraidunicodeprobe_iso9660blkid_probe_tset_uuid2nm_flsls_Modprobe_udfroot_startjs_labelopen_errmh_typevs_fat32_lengthset_uuidms_unknownms_magickey_lenjs_bsizerecord_countjs_magicct_clump_sizeuuid_strmft_mirror_cluster_locationret_readdisk_lockfilesprobe_zfsgfs2_inumcramfs_infovs_headsprobe_ocfsros_volumemh_formatstart_apppv_uuid__pad0__pad2space_sizers_free_blockssb_fs_formatvs_backup_bootjs_dummy2jfs_super_blocknumber_of_sectorsbim_kboffsws_nrbadescape_sequencessearch_fat_labels_feature_ro_compatiso_volume_descriptorext2_super_blocks_hash_seeds_free_blocks_hinext_offvs_sernos_inodes_countextentsname_lenjs_l2bfactorstart_blockms_labelms_mediavs_reservedprobe_oracleasm__u64mft_record_size__s8editionhfsplus_bnode_descriptorsystem_idms_pmagicvs_unknownleaf_countvol_sernotype_arraysb_headerprobe_gfs2rs_blocks_counts_jnl_backup_types_first_meta_bgdiffs_last_orphanocfs2_super_blockdl_tagval_lenvs_root_clustergvalid_wordsrs_root_blockprobe_ntfsocfs_volume_labelstart_data_sectal_blk_sizersrc_clump_szmountcat_blockdate_accxs_icounts_mkfs_timeros_dummy1js_pads_default_mount_optsvs_secs_trackcluster_lows_last_mountedleaf_tailxfs_super_blockrs_blocksizemft_cluster_location__u8time_accprobe_reiserfsxt_clump_sizeencodings_bmpunusedhfsplus_vol_headergfs2_sbprobe_ext3ms_fatss_r_blocks_count_hibim_sboffvs_reserved2vs_labelvs_dir_entriesopen_folders_want_extra_isizevs_mediatotal_sizeembed_startblockbim_probecluster_highvolume_serialhfsplus_forktry_againalloc_files_blocks_count_hibim_typefat_sizeblkid_probeset_uuid1s_volume_nameset_uuid3sws_lastpagevs_sectorscluster_per_index_recordvs_fat_lengthrs4_magicvol_labelms_dummy2probe_fatattributesboot_folderjs_l2pbsizexs_uuid__s64xs_blocksizeblkid_swab16vs_sector_sizeget_ext2_infofree_bksal_bl_stmd_minorrootvs_fatsnr_clustersattrs_offsetext_filexs_rblocksroot_dir_entriessector_xlms_reservedwrite_countembed_sigvol_id_lensb_root_dirs_reserved_gdt_blocksms_sectorsoracle_asm_disk_labelms_total_sectleaf_headbuf_maxbim_magicfolder_countdata_clump_szbytes_in_usefile_countms_dir_entriesprobe_jbddescrsws_uuids_r_blocks_countdate_writesb_locktablealloc_ptrbnodeprobe.cjs_pbsizesbbufhfsplus_bheader_recordblkid_swab32cr_datenewbufjs_uuidtime_writenum_recsval_offs_log_block_sizeattr_typeprobe_xfss_raid_stripe_widthvfat_dir_entryraid_disksmajor_versionbackup_datenm_al_blksnxt_cnidprobe_ext4rs_journal_devs_feature_compatms_sector_sizers4_labelparse_devblkid_read_cacheskip_over_wordparse_tokenblkid_parse_lineskip_over_blankdev_pparse_tagparse_enderroutparse_startread.clinenostrip_linesave.copenedblkid_flush_cachesave_devblkid_find_dev_with_tagtag.cret_typevlengthblkid_tag_iterate_beginblkid_tag_iterate_endblkid_dev_has_tagprobe_newblkid_find_head_cacheblkid_tag_nextblkid_set_tagdev_varblkid_new_tagblkid_free_tagret_valblkid_parse_tag_stringblkid_find_tag_devvalid_blkgetsize64valid_offsetgetsize.cblkid_get_dev_sizeoriginllseek.cblkid_llseek/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/uuidisnull.cuuid_is_nullfmt_uppertime_midtime_hi_and_versionuuid_unparse_loweruuid_unparse_xuuid_unparseuint16_tclock_sequuid_unparse_upperfmt_lowertime_lowunparse.cunpack.cuuid_unpackext2fs_check_if_mountedext2fs_check_mount_pointst_bufmtlenis_swap_device/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/ext2fsfile_devismounted.c/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex doubleisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockpagesl_pageCountmajSizeendptroverflowbasestrtol.cstrtolstrncpy.cstrncpy/home/tyndur/tyndur/src/lib/stringstrrchr.csavestrrchrstrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cdst0memcpy.csrc0donememset.cu_charu_intpositivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_index/home/tyndur/tyndur/src/modules/lib/posixunlinkunlink.cSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flags__builtin_va_listold_posio_resposix_files.cF_GETFLflags_sizefd_to_filefd_listnext_fdaccess.caccessoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptreadlinkoldpathsymlinkbufsizenewpathumaskmkfifostat_buffchmodinode_numlost_statmknodfstatstat.cstatuslstatmkdiruser.cgeteuidgetuidgetegidgetgidrunningwaitoptionswait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidreaddirio_direntry_type_tuint64_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirfileidmktemp.cmkstempmktemptemplatesend_messagemetadataio_create_linklink_dirend_free_pathlink_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlinkyieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tfputssetbuffopenfflushfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftellsetbufferatexitexit.catexit_listabortptr_typedivisorremainderulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexaFebtime.caFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namerpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_topen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrdup.ccopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrgetpidgetpid.cgetppid__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu&t!P()u)+u+dt(;P;ZVZdP9ZSbdSdeuegugtyPPuu tP tlRV VQS tS SWW W !u!#u#Kt 2P2S/KS 8R8V/KV HQH)W/KW 55Ktp ;;KtlQQQgQ/:QLMuMOuO tLhPhVVlVoPVVVV&Sotp tpotl tlkot tot tot tot tV=oth th8=PO_P  u u2t EPEt\P%t\%*P*2t\ &R&2tX &Q&2tT 0Yt%tHt`%t`Ytp%tpYtl%tlY\S S35S%SM VtVVYWWR R WW "S"(P5RSRtS48u8>Q>?u?AuA t4SqS tw4\q\ twV V V V > V S V  V U SU \ tw( S  tw S tw twPP  PR r P P U S4 S S \ t`S t` t` U S S P  Suu\tZWZ\t$S$&V&XSXYVV$P$NVNTPTYVY\P\]u]_u_t\yySt St St SPuutWtWtBtpIVuu t u u,t ,P,,t,-u-/u/t,EENSNRtRS,EEOVORt RVuutStuuttt tuu#tSt S #tR RRPV$%u%'u'Vt<NRRVRuutP u u tuu>t@AuACuCt@SS]W]_t_W@SSUVU_t _Vt Vt @U[SSPSSSPSU\V\_RfSVRSSVUWPW_tptpPtpfwPzPUWPPPuu@t!P!>W>@P =V<S@AuACuCt@SSVtVVt@SSWt Wt Wt elSllPlSSuutuutPVVRWW u  u `t))6t?`t&&=t =`&t&`)V)1P1NVNQPQ`V?IRKVRVaPaR=FPQ`R`auacuct`tuu)t P )Q R R P 'P,-u-/u/3t,1P45u57u7t4BPBQ4ORO_W_qRqWRWRWMSSuutuutVtVtuutt tt*S.SSQRVW!,W1W!.Q5SPSeQePQuu?t@AuACuCrtJpStuuuwuwtuutPtPRRuutPtPRR u  u =t@AuACuCt@VPVt@@VRVbVeVV@VQVaSeSSuutuuWtStWS1PSWPXYuY[u[tXiiVtVXiirPrtPuutt QtQt Q tQSSSuu\t--TVTVtV\V--SSSVtV\S0@PZ\P\]u]_u_ t\rPr tp\rRrWW W\QQlrSrQSQS StPP  u u6t 2Q26t89u9;u;rt8GGnQnrttuuuwuwttQtuut..VtV..t"7PPPuutP-W/WWYWRQthQtht%'PADPv{PPuu t t\ tX tTx W W u u t   t   + W+ t   t u u F t  F t PR . PRH I uI K uK ptH g g t ptH s s ptl } P P PPe W + W Wz R R t~ pt~ We WpWl r R Rl S S!S Vl VpV PR PR PR t~ t~pt~ P t~a v P  P; N t~N U Va t~pt~pquqsustptt  ttptPtPtPt4t>ttVLtT}tt#\S*fSS<V[_V_fPPtLtQQt't'Q+QtQQSSSR)RRy/VfxVVVV#SfSSSuuututlS!t !mSmut uthxyuy{u{txPtVVVuu@tQ@AuACuCtO|QuutStSuuTtStTSTUuUWuWtTttTkkt SWSPSP@QSQSPSStptpPPwSSS*VSVV"VW\VxVuuttMMttStjSjltltSOZPrtPPPP9PtuuuwuwttttStStSPPPPPPuubtNtN--bttP't'.R.2P2CRC-t-URPCLW0WbWV"t{CSVCKt{VKNt{-t{-]SV]vt{Vvt{t{Vbt{QVCKV PCFPQQCNQQCNQLW-0WSCJSQQCNQACPRPRPRRCNRRP3;PJLPFNt{[bt{FJS]_S_cQcSPSQSQSRQRbSuuLt P )V+LV (S+2S28PBLSLMuMOuOtLWPWSuutPSSuutt%.P.5SIPSP\P\SVP6V69P9VV19t_\t_RR19t_\t_PDct_c}t_} t_ t_t_t_t_\\P P5PP19t_\t_t_t_=t_QSt_t_19t_\t_t_19t_\t_19t_\#t_#+V+.P.Vt_t_Vt_16V\VVP!VVV19t_\t_Vt_uuttXSSS{SSattttttvttIKW WattUttaSSS=DSDRPRhSSPSHTVTZPZVVPVVPVVIWWW{WWuuPtPRPQ$S$'t'PSPQuQSuStPaPi|PPP_R_gWgiRipWp|R|WaaPP_eSsSuuttRtWt WPPPSSuuJtPtPJt  Jt !!JtP#3PBEPLMuMOuOtL\\tLuut L||tPP\lPP\nthth\ntltlcjSeS\ntptpVVuutPtuu1t#S#)t)/S/1tRPR R)RP45u57u7dt4NNbSbdtdeuegugtdttySytSttyPyWWPWy}SPSPSPSPSuuBt(:R>BRDEuEGuGtDTT]S]ataSDYYat akkt %t 35t Ft t t t DtD tY_WVW%VF]V_fVfnWnyPyWVVWVYPYWYathththVthuthYatl|tlYatp%tpAtptptptpYaRRRRYaQQQQYaRRRRRDVRuu?tP5S7=SRQ@AuACuC4t@]]Wt2W24t~(t(t RQuuGt  Pt"PR"'t R')t )4PR4APtAGt uu t tuu_tPR]VQ\S`auacucrttuuuwuwtuutuuntuu@t@tBMVM`P`V5V.W6W;@W@AuACuCWtuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt)u)Q 'S &Ptt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttu !t!#t#u EEuhuVVACPySttuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuWuWPS7[QSSQ{QupQ !t!#t#u CCWuWuCVVttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nulultt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttu !t!#t#)uuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P   !#35BEsvLO`c|'W*W*.lNY`b`bz @ tev t!,etKT  yDf#+ |||Lp(, 8@%.8@%y`lBMBP'BP'*3*@&(&(*@&(*@*A$p\\,8KX_r02 (:(:@O/25;8X8L0DL]GI$9;57HO`d"*8 *8"8^8EZ^VXT8(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)03"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'T@T-`@`b 5@\? @ F(@(M0@0R@@@ X @l ] f uI7'e&MZ P00X) =ef*^lhq# O@@T@`@@ @(@0@@@ @     @(@(@;0@H@^ @ mD@ t@ @ $@,@@0@,@P@!t@&@<@,@&@+8L@ HT@ WX@ h\@ xP@ @@&x@x@@4@L`@ @) @@`,@6@( Al@6L@@X@#h@2v@30@0`@0@5@Z$@:`@@@ @@@@@*@:@C@@'T@2X @< @  Fl!@R,"@\"@(g%@dq@y\)@*@fh+@` @  @ +@` @ $ @ (,@a,@P|0@0@&|1@n4;4@LJ85@5Zp5@Oelr<@O@@2@C@?D@_@@ &( @ 30 @ F@ @ NL @ X8 @ gH @ qP @ } L@ @ d@  l@ h@ -5b@B9b@W^`c@Igt@ ~x@ g@g@@  @ 0r@p@a@ @ L@ P@ `u@K!u@R,5> @ IPW~@aT@ kryX@ 0@\@ @@7!+3@ >EP@N@ W@ ^@ fm@ yp@E@`@$ @@@   * 9 A H @yY @ c @ n @ x      @   @0 @N 6 @6< @H {@;O@@YPW@`@eО@k(@z @ @+@@@f@&@@`@`@ J@` @  I@.pH@@A@N@U@>%@,`@@9r@=0@!L@Z`h@a@mrp@ |@R0@!P@mZ@ Ы@G@d@ e@Yh@ @m@I@ ]@v <@P@Eh@ %p@d,v@2PE@E@'Q @`@i@jw@@H@@fz@]@@` @`@ l@(@@@#P@b@1`@ %`}@* @H/@=@Qm@I[ @.b4=@Mu @P]@#H@0@J@"@k@t@tD@Gf@0G@@@bP_@ Pa@`@"`@)x@.@J@6@DBU@.I@dX@R^0@ m@@v @s@ ~@ v@s@y@ Pr@"@@;p@ q@q@@H?@ 0pJ@5@n@AЭ@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startblkid.cprint_versionusageget_terminal_widthpretty_print_wordpretty_print_lineterm_width.4265label_len.4263fs_type_len.4262device_len.4261mtpt_len.4264pretty_print_devprint_tagscache.cdev.cdevname.cprobe_alldevno.cfree_dirlistadd_to_dirlistdevdirsprobe.cfigure_label_lencheck_for_modulessearch_fat_labelprobe_zfstype_arrayprobe_lvm2crctab.3810probe_oracleasmprobe_iso9660probe_swap0probe_cramfsprobe_romfsprobe_luksset_uuidprobe_ocfs2probe_jfsprobe_reiserfs4probe_reiserfsprobe_xfsget_ext2_infoprobe_jbdprobe_ext2probe_ext3probe_ocfsget_bufferprobe_udfudf_magicprobe_swap1probe_hfsprobe_ntfsprobe_fatno_nameprobe_fat_nomagicfs_proc_checksystem_supports_ext4devret.3029last_check.3028system_supports_ext4ret.3010last_check.3009probe_ext4probe_ext4devprobe_gfsprobe_gfs2probe_hfsplusread.cskip_over_wordskip_over_blankstrip_linesave.ctag.cblkid_find_head_cacheblkid_new_taggetsize.cvalid_offsetllseek.cisnull.cunparse.cuuid_unparse_xfmt_lowerfmt_upperunpack.cismounted.clibgcc2.cctype.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrtol.cstrncpy.cstrrchr.cstrchr.cstrcmp.cstrcpy.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarunlink.csignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_fileaccess.cgetopt.cplace.1334link.cstat.clost_statinode_numuser.cwait.cwait_listrpc_child_exitposix_dir.cmktemp.cfileid.1150rpc.clost_link.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indextime.cmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrdup.cstrlen.cstrtok.clast.930memchr.cgetpid.cparse_pos_paramsputcharuuid_unparseblkid_dev_set_searchblkid_dev_nextstrcpyasctimeinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidblkid_devno_to_devnametmpfileppb_from_argvblkid_probe_allstrtok_rlist_sizeprognamerpc_get_responsegetgidprintfstdoutvsprintflibrpc_rpc_handlerrpc_get_stringblkid_strdupungetclist_pushblkid_known_fstypesigemptysetgeteuidrpc_get_intsnprintfio_split_dirname__strtok_rblkid_put_cacheblkid_find_dev_with_tagmknodatolblkid_dev_has_tagblkid_verifyget_parent_pidlio_seekgetenvfchmodlist_poperrnoblkid_get_devstrtoldgetegidisblanksetlinebufblkid_new_devgetsio_create_linkio_split_filenameppb_get_argctimer_cancelgetpidio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatreadlinkinit_waitpidputsdup2rpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_emptyblkid_get_dev_sizeoptarg_assertblkid_dev_devnamevsnprintfrpcstrtoul__dso_handleitoamktempispunctopterruuid_unparse_lowerreaddirjvprintfisspacefflushblkid_get_cachelist_get_element_atregister_intr_handlerblkid_free_tagdirectory_openblkid_flush_cacheputenv__umoddi3lseeksigaddsetblkid_tag_iterate_begin__udivdi3setbufferabortprintf_putcgmtime_rchmodsprintf_putcisxdigitalarmblkid_free_devmessage_handlerstrtolstrnlencreate_shared_memoryrenamestrrchrinit_memory_managerblkid_parse_tag_stringstdio_initcallocinit_dev_registerstrtodblkid_dev_iterate_beginlist_insertlist_destroywriteatofuuid_is_nullfstatfprintfkillinit_service_registerctimeblkid_set_tagdirectory_createadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infoblkid_gc_cachechdiropen_shared_memory__dtor_end__fseekppb_is_validblkid_read_cacheoptindmemchrext2fs_check_mount_pointjprintf_putcstdinwaitsend_messageinit_envvarsumaskmktimeblkid_strndup_startlstatferrorsyscall_pblkid_dev_iterate_endsignalreaduuid_unpackstrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopeninit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullsymlinkblkid__scan_dirinit_messagingfopen__bss_startgetoptlocaltimememsetmainftell__dtor_start__blkid_debug_maskinit_service_get_nameclearerrfclosegetenv_name_by_indexgetchargetppidtimeopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnoptresetrpc_get_dwordstderrmkstempsigismemberdirectory_closelibrpc_c_rpc_handlerblkid_tag_nextfputcoptoptdivmodpreaduuid_unparse_upperlocaltime_r__ctor_start__strftimeppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_process_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerlinkexitsyscall_timerblkid_probe_all_newsigdelsetsetbufblkid_find_tag_devmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenoblkid_llseeksyscall_vext2fs_check_if_mounted_exitregister_message_handlertimer_registergmtimestrlenopentoupper__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClasseslist_removefcntlmkdir__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitblkid_tag_iterate_endfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/logsave0000755000175200017520000062477611517101521016364 0ustar tyndurtyndurELF@@4p4 (@@ܧܧ@@4QtdSFU=@@t8v@ҡ@ut h@!@@ÐUthD@h@@tt h@ЃÐQSP UWVS] t& v4vAEE$D$y$ @rjU")ċEt$|$ t$D$$ @=@s& @sBwҁ@rt$<$á@$F$[U=É$vǍ")čt$|$t$$TvoUWVS Ɖ׉˅t)u<t@~>QWVP*e[^_f1эytfPWVj*뵐\@P5`@1 t`@\@RWVP =\@e[^_ÐUWVShSP*ǃ~Sh@tTƄ=ހ>t-l@tFjVC t,pl@>uӉe[^_ùe[^_ÃjV Åt#1҉sl@u1҉we[^_ÐL$qUWVSQxqEREPh2@VSS,t3st"vtau܃eMfd@Mh@븋,@90B9%U,@EWhuR)@E07@(ۋM1Ҹ9@Ut)]vM1nM1Ҹ@_Cu݋M1Ҹ0@F jnE}<$jM1$M1Ҹ0@E$-mv-Ãv @ u%#u EpPjVS-t @EM u"uM1Ҹ0@} jmE<$iM1^M1Ҹl@O=`@tn,r@y/Qhuu/(@$@xR5\@5`@P'X5`@ 5@"4$P6h@m$PM1Ҹߞ@M1Ҹ0@ jlE}<$hM1cM1Ҹ0@T1ۃv1t|11u+Cܡ@tt hA@9$P1m1ҋ]PVhQ@]Sn1҉6 hL@a9$Od@ VO hF@19$O hK@9$|Oju [^jus Yu XZu]3+(X38$7Ouh@GlhU]Ít&'U]]u}CvMsV tRp@Ѓt@%=t&ftt]u}])믍t&x@|@֋~t11҃9Љw~N1)=@@A)AVF ޭޅttYPtOAtU@fP +PA +A9R @G@@]u}]ËVfQ맍v9 @tQ9 @t=tABAtA 1)@@A $ D$u@뷋A@륍'U0VS @ @$@$@9s։ D$ $tۉt11҃9ᆳމw1 AqA AA@@[^]Ív Ft&P|^~$@t&9t&wv|.~5$@t& @t&w0$@vwv|ލ~$@t&@@$&UWVSt&@@}EEEXMtы@! @5@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf&1hfL QA UQEyACKGDGE1ҍY@@ڃt )ÃfC[^_]ÉE}tETF^05@E;11FKAA y]YEAGDGFE@GG@ GG@GxUGPGMHGDGE1@@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0F CP X9 <$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&xx [^_]Íp@Ѓt@%=t ftux@|@- 1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUEM 8ut&8t ҍt&u1]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]$t&]Eu}]t&FED$$|W1 f?[D$E @D$U$MxuɍFD$ ED$E<$D$U(@FD$ ED$E<$D$@v'UUE @U]+UW V @S1ۃED$D$$PzD$ED$E$wt&߃ t;>t[ @D$ED$$Mwu˃1[^_]Í& tED$ @D$$`wE (@[^_]Ív'UU*$@@* @&@ =@uÐUWVS }1 v@t$$Dst&9{uᡬ@t$$Hs$ƍ [^_]UWVS }1 v9{t+@t$$ru [^_]}t&@t$$r$m [^_]QUVS@$ƋE@F@1&@;Fw@\$$,ru࡬@\$t$$sE D$F$Qa^[^];t@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$.v\$D$D$ E D$E$[]ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$q UED$D$ED$ E D$E$2Ur@@@Ít&UWVS,EUM=@G@@ Eu&)ċE\$#D$D$$sED$ED$C$6E\$t$ |$D$$rt&1 &@\$$otF;~uᡰ@\$$oE;uL;~t)&f&떍#vދE;u֍ e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $uÍ@$\$ƋG 4$D$ArG $r<$j]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$ $]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEJ@t`$É0E{C<$|$ƋE4$D$s \$@$Fo]u}]t&뙐U]Ít&'UV1SiM֍&9ws [^]fÍ&9Ív鐐t&֍UV1SiM@B$@։L$t&k9w)&s1[^]Í&9ÍvcƐU 0]Ít&U j0]ÐU(0]ÐUED$@$k1tÍv'UED$@$k1tBÉ'UWVS }1Mv<$D$zot&@t$$rkuԃ [^_] $&C$$@t$$RkUWVS 1t&<$D$nt.@t$$ju [^_]Ðt& [^_]É'UE1҅tPÐt&U$̝@]]uu1ۉ؋u]]Ðt44$o9E r݉4$ot$$D$q&$n4$E n$7맍vUE]utoU1u ]u]ÍvE $n$ƋE $mn4$D$E D$E tC$e1s롸$tE$n$E $n$g҉CthtdE$mD$ED$$GE $mD$E D$C$#@\$$j@1$C$$U]]u$y\$D$$̝@o4$E؋u]]É'U(]u}D$=E$>¸tR+ueF)ĉt$E\$$~D$63D$}$|$te1]u}]Ít&@eU@$fÍt&'UWVS,EEE E6EEE}&$lEF$k]]x;D$E$EED$D$EE$D|$FD$]$.EEEED$@$flED$ ED$E܉D$E$EE,[^_]m'UWVShD$ !@$Н@@$u [^_]ÐD$ D$D$Н@$EtЉ‹@ tljB9s&<$j<$D$tt$<$j4$jUDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@B@Bt\1ۅt.@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@]uu%@1[]Í&$(ti@B$'@D$@1[]ÐUED$ D$$?i1Ít&'UED$ D$$i1Ít&'UD$D$$@hD$ D$$@h@t&(@=@uĴ@ U=Ĵ@]]uu}} G~&@&]u}]Ív tՅt4@@C@C@C @C1t@G@G@G @G@1rfKUS]=Ĵ@t=G( t#M @ @[]Í&[]Ív[뼉'US]=Ĵ@t=GH\$$@u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE].t&]Í&'UU ~ÍD$D$ D$D$E$ 1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3@\$$_u@ [^_]f@\$$_$ uȉ4$a 1[^_]Í&UWVS1ۃ}9~t3@\$$W_u@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$@\$ D$@$^ 1[^_]Ít&]F9tD$@\$ D$ܝ@$I^1[^_]ËE cF[^_]ÍUWVS }@1 f9>tl@\$$0^u$>Ƹt>@t$$`@>@F@FF t&F [^_]u@fU @tÍ_@@$@$@$Ðt&UVS@t519pt#@\$$/]u[^]Ít&[^]bf&'U(Eu]}t;$[D$4$NjED$t.]Ћu}]f@ލ&Et$ D$D$E $2D$|$4$lڅt떍t&U(Eu]}t;$D$4$NjED$"t.]Ћu}]f@ލ&Et$ D$D$E $!D$|$4$څt떍t&UE]uu}} #tEt$|$$}t]u}]Í&]u]}]t&@ÍUEt&D$ ED$D$E $Í@Í&UE]u\tVD$ ED$D$E $t]u]Í$u@Ӎv@ UE]t&UVS u ]00 D$b@$"0$ft^ErtDaDED$$"t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$b@$"@@됍&15D$b@$!uLvEwfvEwE+D$t@$!v$@UE D$RD$E$0ÐU@]ÐUS @u0@tr@B0@@:#0@8(@U::@D$Q@D$@$^?[]Ð,@E @;] 0@}A0@-t0@@[]QA0@-@ta7D$-U0@@$t@-1&?[]Ív,@t&y@D$E$x:t,0@@8u,@@[]Ív0@8uh,@9E,@PE:0@@8:(@D@D$h@D$@$ ?U @0@@bC,@U]ÍU1]É'U@]ÍU@]ÍUE D$@D$E$Y1ÐUWVS1ۃ }u@t&9ljEtG@\$$+Uu@ [^_]$@@ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f@\$$TnU;uݡ@\$$T [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$Tu$ D$_D$@$@1D$ @3CC@\$$U[^]^&'UWVSE}}Et[^_]1&;8t @\$$BSuމ<$1ۍt&;>tV@\$$ Su1D$ D$D$@$@?UFF[^_]f뿐UUD$05@$@@ ÐU1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$@ v@UWVSM1ɉ‰EE#E$KËE$kJStdfuC.C E\$$L11vD$xE$JtXC$uOƋCt+rǍ&CC뗐t&$Ş@4OƉ떍F$EE$IuE#&tcu :F/<$mED$E$Jt8_4$\$9N$NƋGu/볍&|E$KE[^_]Í&$E$HD$E$I8$@@E$H\$D$E$JaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE@@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$LҍUUE $T$E ÐU@$Ȟ@D$ED$n3ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$Z=؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$z<؃$[]fUS@]U u$T$N<؃[]Í\$D$ D$$ []Ít&US]$NJ\$$t@t$ 2[]Ðt&D$0@$;ؐt&UVSD$b@$֞@ wD$ D$D$4$5 Ƅw@D$D$@4$$@D$ D$D$$D$b@$@[ )wD$ D$D$4$ Ƅw@ZD$D$e@4$6$@D$ D$D$@$D$b@$@ wD$ D$D$4$ Ƅw@D$D$e@4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$e@4$ @vD$@4$ @*D$e@4$ @U1]É'U]Ít&'UE@1] U]P&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$@F$gƉ]u}]Íu \$KS<$Q6C $f6U|$T$$c\$ D$D$@F$ƋC $G6뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$z4$`딍US$]u$[]Í&Ct$ELED$ D$D$#@C$D$Ë@ D$E$>C $ӽ$˽E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+31҄u뱍vC!C$N뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$7B$wt&tyvC!C$:vK9Crt$ED$ $OsY&{Cft$ED$CC$sv'U]]u$i@U $D$T$ D$^$D@]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$CtӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;ȼ@v/ļ@Eܣȼ@$>0ļ@$Q0@ļ@EED$ D$D$,@G$Ë@ <9}sE<D$@D$E$C $薹$莹,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$裿_utRu4ttG!9u܍f]v֍ovɍt͉$v賸G!9uIvvE<$ED$ D$D$,@G$gË@<9}sE<D$C $.t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$; )čt$<$;9s@a<w%$P@vЃ|+uf<$U;9rE1ۉ$D;UT$D$F$諾E$ ;t$ D$5@$D$!U$w t Nun1ۉ<$e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$M:$貸FU$T$9$&蔸ËFCFCF C FCFCFCFCF C F$C%C$$GD$ D$$D$C%4$ϴv'UD$>@$B@Ít&UWVS] D$b@E$~C$L# D$t@$N84$t$ D$D$<$uN@D$D$,@$4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$?1[^_]á@D$ܟ@$%@e@D$@$@<@D$@$4$ @ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$@4$"6]$t$D$ D$D$$O$%f&'U$~ÍU̼@tED$̼@$]31Ð3̼@u@É'UVS1ۃ̼@uu!&Ѓ̼@\$$0uu[^]U(}}EU u1]]EUt\$t$ $T$iCEU\$t$ $T$%B]u}]ÍUWVS,E ]Et@E܋EuEP@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$,~8$t 1҃[]f[]Ít&'UWVS$蛱1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|h@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA + @ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@$Ðt&UED$@$Ðt&U@]ÍU@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB\$ D$@$D$O[]É'UWVS,]D$@$EU)čD$ET$\$$UE$EtD$$SUe$譍$@$o)č\$t$$D$@$2EE(&D$@$e܅e܉<$UƍD)č\$|$$[3/ED$D$DD$$du$$ E\$1ۉ$ e܋EetjU$tƍx@#)ċE\$$D$U TE$_\$ |$D$@$St$5e[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$!@$$!@$D$!@D$$!@tUT$D$$ړ$!@ND$A\$D$D$$D$ []Í&U($*@]uu}4$D$L$*@$D$*@D$:4$$*@WT$t$$$\$D$D$$D$ ?]u}]fUED$ D$D$3@$gÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$<@C$$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$XD$$FFF D$D$$ ta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$ \$UT$M܉ $\$E$FU F$E] UMV~HU1fC D$CD$EE$qMC K9}MƋVT$D$U$FF D$$ 4$ńUE ]u$tD$E$^$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-@ [^_]Í<0C %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c tyndurwaitpid(-1) wait.cwait_child != NULLCHL_EXIT..:/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createR@R@R@R@R@R@R@R@R@R@R@R@R@R@R@R@R@Q@R@R@R@R@R@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZ5]@0\@0\@0\@0\@0\@0\@0\@0\@0\@0\@0\@0\@0\@#]@#]@0\@0\@0\@0\@0\@0\@0\@5]@5]@0\@0\@(\@0\@5]@0\@0\@5]@d@Oa@Oa@Oa@Oa@Oa@Oa@Oa@Oa@Oa@Oa@d@c@Oa@a@a@Oa@c@Oa@Oa@Oa@Oa@Oa@d@d@Oa@Oa@7_@Oa@d@Oa@Oa@d@Ck@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Ck@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Bf@Kj@Bf@i@Bf@Bf@j@__ APM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 s@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@s@s@p@s@p@p@p@vs@?s@p@p@p@4s@p@p@p@p@p@s@ s@r@p@r@p@{r@p@p@p@p@p@p@p@ir@Wr@p@Or@8r@p@p@Wr@p@r@p@p@q@q@p@q@p@q@p@q@p@p@Wq@p@q@Ѣ@բ@٢@ޢ@@@@@@@@@@ @@@@@"@'@.@8@@@I@R@U@X@[@^@a@d@g@o@v@@@@@@z@@9@p@@ʣ@ʣ@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK ?telldir: Nicht implementiert IO_ULINKlwIO_LINK zR| 'AB E<_AB E @@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@@3P@.@#@P@0@g@p@!@ k@M"#@y'(@/p0@00@; 32@4`3@1806@d96@ :6@;Ap?@|B?@C@@$D0@@G A@yKE@XV@(YW@cm@wjpt@l0u@nu@?pv@sw@vx@w0x@|P~@f~~@S @o@@܂@u0@  @*@A@A @@#@KP@Qٓ@>@-M @J p@ږ@+p@9@ @F@  @]@9x@v\@'s@_ojmain^outfdpoutbufsizeoutbufverbosedo_skipskip_modechild_pidG?%errnoQinit_memory_managerfreeZmallocrealloccallocPdstrchromemcpy#librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses#msleepsleep*nsyscall_psyscall_v!get_tick_countkagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars"7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill'=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreat/execvpR0Plgetoptoptargoptindoptopt+opterr=optresetK 3fgetpagesizeisattyforkpipegethostnameG4vwaitpid,waitXwait_child_addqinit_waitpid'18Zrpcsend_message9nyieldR:,io_split_filenameio_get_absolute_pathZio_split_dirnamed;Aget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"Bnset_rpc_handler#Cyadd_intr_handlerJ$Da)vfprintffprintffprintf_putsn+fprintf_putcG}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#yK Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6X_exit2abortGatexit{exitiY 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf{c gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeFwj0vprintfcprintfprintf_putsnprintf_putc8lsprintf_putcQvsprintfsprintfna_assert;p~]snprintf_putcvsnprintf!snprintfsPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read vysyscall_timerwdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name|lio_seekV~create_shared_memoryopen_shared_memoryclose_shared_memory ysyscall_putsnqommem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6܂nwait_for_rpcv_and_wait_for_rpccuppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper*dstrtolAlist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_create strcspn#ostrncmpostrncpyٓdstrcmpdstrcpyMostrdup ostrlen(ږQd__strtok_r strtok+omemchrmemset 9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoulFrunlinkoaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4x io_remove_linkio_create_linkv__udivdi3s__umoddi3fQ@@q@h"intXI5Lf7e~t] (e 'eoy.Z%1H id2# 3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzHI3=c-vl3d@@k@@q<b7IY+,3t@q@oh"intXf~t] 'V0dy%%z7t@@2 H6^ c6: u6: n8 uN:@@H fdM:& cO:9HPH_ cpPb sepP%YY-u,L: c::x:=w fdsy;z: rcz: pidz:H{:Y%YO:@q@D : =1 c:u pid: rc:Պ cppB:tp:t: tx X \@@i uPh5t!i':!Y:"+$:@"%:\@"d&k`@"}':d@"\(:h@"1):l@"k*m @;t@t@o7@int&@@h"intXf7Z~tyZ] (Z{ILJ#cK#QLh#6Mh# Nh#pOM#OMLYM#cZM#[#9\Z# 6]h#^h#+s3z3 Y s cO nz i3  m ptrQ3  Q3~ Ad s1 s2d nzkk1xxjqoZ  s c3 nz i3@@v@3 @ptrminMBmajk-hS@@`@ @m @; @~ @; @ @ @"hhh  @ @!@ @ @Z"6h#sth maj  @ @$C%m~$a&> @@'=z?3"@apABhmajC;minDM EM 6Fz ` @ @ZS @ @P` @ @`U @` @p`DhY ` @ @L@@h & @v@ p '6z$ ptr minM  z .h: SN@S@0`p@u@m( (qs.$$@7BMX Xl `@@i`N@X@^& @@ '? z '6 z 3p ~@@@@)R*7b@*c@+eM,3*Wf3$@*g:@*Qh:@*k:@*l:p@*m:x@-Dq.A}@@h"intXf~t]v+@@ p*+ ch*3V c,Qo}@@4inth"Xf~t] (OJA@@j : : $:d dstB#srcCWtDd}@   o   8@N@h"intXI5Lf7e~t] (e 'e~0Zzo y , y-#  .#  /k@@<jZh1jZwjil3~`qZrZupe@*@3dA dAF40@@&4,ER E%GdiHZrHZio9@N@^i:Z6@4@  1@  2 @8P@@h"intXf7Z~t] (Z';(#6)o#*zo  &'#(O#  aP@@2 `Ob2ic31 O@/@Dy NOpP2iQ3,O0@@ ++Oid-O(52;<2i=3N#@$O@80@@h"intXf7Z~t] (Z 'Z~0|Ooz 3 pid4O# 5O# 6o# w7z# h8 '$ ;(*# 6)o# $*Ao +tpids|sOu3?v|r0@j@apidp|pO?q;bp@@pida|aO?a3AS@@gpidQ|QO?RO6C@ @pidA|AOlenAowB; A @<@@@@={pid|i(;ow;Os{?KXg\pr}A H!1@@#pid0|(0;0ow0; "?2!Y;@5@O#pid|{$(;$o$w;%`;%?%HO!&3@@@4pid|`(;ow;`3?&O@@'ppid|S(;sow;`O?߉'L@@J|FJO|KowKz?MNz(3O@):*.@0 S@j@ h"intXf~\8at]oq+@@j#@@1e"] $V}y k.O@j@ sec-O /V |p@@ h"intXf~t]op@|@ @@E |@@ h"intXf7Z~\8lt]o!a@@qeax"Oedx"OR|| ^@"@% h"intXf7Z~t] (Z 'Z3pid4O#5O#6o#w7z# h8 o   ';(#6)o#  *y(Vy)#`*#+1 @@3G͙ V @@3(GC@@HyBtiD3GED@@dyi3G; @@YyGe @@d6do`hR 3@ @p_y`T3G @9@ N3 @W @>j3}u#3` @ @str"sep$#.oy/h3!@!@ |\ !@#"@D!pidZ|pZO"1Zo"w[z #?]zud#^ouh# _oul_o$i`3upGa +60"@"@U =|p"@"@AU "@"@>C" yK`L@ #8-l@ %Y3 #@y(@ h"intXI5Lf7e~t] 'ey  #A      3  # #r 3#0  o3#@I#@S ss , 3 G 3P#@#@ s!, 3M!# &3#@#@!%, %3!  >3#@$@!^6=3"=_"% =s"i?3# os$@O%@.#W nsZ#idpZ@3P%@u%@#sf 3%@%@#s3%@&@#i43 3 &@&@ $csig3L$ c$oldr$ i _ '@W'@$, 3%  g%Q H3`'@'@%, G3% [% g'@'@&{ {(@"(@H&<, z3t&B k30(@y(@&w pidjz, j3&G!/ +w@!: ,@! -Ĵ@i"Y39u (@b0@^  !0 :oh"intXI5hf7~t] ( " ' * ,Oy.v%1uid2# 3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * A  #  I  ' ; (# 6 )#   * '8  (8#fd)O# h +O# ,O# dupO(@(@&kfdOc O(@(@'fdO OO(@9)@C'fdOo' iO' ] O@)@J*@'fdO'cmdO( (iO))@)@sap%argOM)*@,*@ap%argO`): POP*@+@s) O8) \)i]O)q :+@[+@) 6 ~8`+@+@'*7fd}OS*! iO*3 +@l,@*fdO*buf*";+" 1+#68i+# +ret+ $ p,@-@+ZfdO+buf,";:," Z,#68,# ,ret,  -@-@,fd~O#-" ~C-" ~O-#68-f-@-@. fdeO2.He6e#6g8R.oH-@q.@p.fdGO."HG."6G/#6I8D/#Qb/ 8.@.@/%fdO&6 ':BO.@40@//u O10(Q l+ g0fdO0#6%80)af 80x/@/@|f81*f8)1+:,-A :O@0@b0@h1969(G 0@ (O 3O@.V68.b78. 88. YOW p0@0@h"intXf~t]yokk^ ,3p0@0@1+{=+r Y3L\ 0@2@oh"intXI5Sf7l~t] (l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g %  C:0@2@1 z @:1 A<2 u Ba2 oliE?2 D?0@  ? 8 Ve 4?@i1:,@ 2:@ 0:(@l 3:@b= 2@T3@h"intXf~t] (O 'Oy '32@2@3 032@2@=3k/3 8o2@3@i3 A33@$3@3 6@ 3 J303@T3@3K bufIK lenIdQo Y3 `3@&6@h"intXf7Z~t] (Z 'Z';(#6)o# *o y )  pid*|# + #;,3#i 8 BCCpidA|iC3 DC  nvpidm|io3 pCL |`3@^4@3&pid|4;&4 34 C4x3@3@#.47I 4@T4@V a5j 3 |`4@4@.5X;&) T4@"5@Z5pidS|5 VCoutf5@4@4@V#8.57 05@5@5qpid}|5}O1}oH6w~zh6 C6 PK#h.67!#.67"G 96@&6@6# 0@ $Y3V|06@6@h"2>intXf7e~t]orpc"06@K6@7pid!Z/7 #ZP T 2>P6@6@N7Dpid0Zz7 `0Z7 0Z7len1Z7 w1z8 33P a :Th ZT DT|6@6@%h"intXf~t]oj 6@6@/8( 6@p?@\h"intXf~t] (Ooyo';(#6)d#*  & N   1  / A 1&U 2#} 3#p 5&# o6 p pcwd} v 3u  p pcwd} v (3i)3: Fvp DlenEdU E} E Gv o i6@8@[8h8 hp8 h38^ jugposk8 luhU mul nvN9 wdl9 !!!!"#7@88@(!!!! "#88@8@[!!!!8"$8@8@!!!!P"i% }8@9@9&*: v' pJ:( 9@9@'}h:'$d:f @ pi3 3 v) :d 9p6;di<3 =v _ ]pH]} ^ib3 cv% }9@d=@:Z&: v* pud 3'6d;' }1;+6:@U:@r!Ch,N\;"Y"d-|!,o;,;",;,;-!, ;,)&<,4F<+@<@`<@!!R8"^,jo<"t.n<@<@!!!h,<,</ }p=@p?@<&<'} =* pul'6d6=' vT=-@+!R"^,j}="t.V>@>@-!!!,=,=`|p?@?@+h"intXf7Z~t] 'Z (Zo+'op?@|?@= pid(o> 8o?@?@> pid7o 9oC>3Vo?@?@V>m TO uidTz T NUo pidWo>  k?@?@>Bz?@?@> {>1e|?@@@h"intXf~t]oU?@@@?w|@@#@@ h"intXf7Z~t]o!@@#@@,?3 O]0@@A@x !0 :oh"intXI5hf7~t] ( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`C  O :9  O  O  :   0v# #arg###fp$## k4O0@@k@@X?fp3#3ap3%5 t6h<Op@@@@?fp;#;ap=%>OP/O@@@@?%arg.%?.?n.O2@  #(O@@A@R@arg'%c':~@0n A@E@_h"intXI5Lf7e~t] (e 'ey.Z%18id2#38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K T3 \ A@DA@@Y YoPA@eA@@N3pA@yA@@  dL3A@A@!A,c3MAA@A@cs>u{8A@RB@A8Apos3Ac3Bo+3`B@B@!Bc3MB B@B@cs>u{3B@ C@B neBstrYB3C@{C@3C7strY_Cc/C@E@C~0C1~~62zC>V>Vv)@V$@b%@ &@Y3  E@V@h"intXI5Lf7e~t]o (e 'ey.Z%1?id2#3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#5Z#6#w7# h8a 7id8#9#:#8;Z# <?Iid@#A#B#8CZ# wDI# AX EOyidP#QcUidV#W Ki  z& zres {K# |#%  V2%6113E %E@E@Dc8F@F@JDQ3F@!F@vD _30F@9F@D^p3@F@!G@D_ DH?^E63E6 _8 ?out8cF@ R30G@[G@E QM3`G@G@E LHL?6LG3G@G@$F FHF?G@H@PFsrc|FFF F1GX!GoC4GgH@H@wRG  A  X3H@8I@eG7 G6G+3@I@I@Gu H wyp!F3I@4J@GH" sH#ZHhs@J@J@H gH ]npos5IwUI N3J@JK@sId MI MsI M3J$PK@sK@-J xK@L@YJwJJJ K1_K83L@BM@K:%str7 7%3PM@M@Kc$3K $&ch&zu{3M@M@Lc3AL wLeE! N@UP@L "L"M"UM" M#M j\'( ;N6NN(@)'X *N6,N O@O@*i3N+eEMF3`P@P@N  EN,cGz+O]?P@Q@KOu \?wO$\3O \O,i^3O,c^3 P!KQ@S@)P "JUP"6JuP-SL?up.msgR +SE*iW3P#~P# P/x+_ z 00S@S@=Ql3S@U@iQ kQkQ Hm _no,srcqQ,dstxR/$6R A 1!U@V@TRM "R"6R"R#R+V--@-'.Zļ@-/ȼ@2 82 Y3!V@W@th"intXI5Lf~t] (Zoy';(#6)o# *  eV@W@S d3@S msggd (hzV;i,A, 3E W@4W@_SM3@W@W@Ss`Lus  1W@W@S 03SW@W@i43T`5u (̼@Y3 "W@m@7h"intXf~t] !q {oC3 d {93 d 3 {   0# # argd#]~0} 0 3:OVMYT{g b W q#` ]#m}'`|buf||Os2VW@DX@!T1VMT1OT1T3Vrem4OOzLPX@ Y@T.`KVUbufK3UKO_UJKOUpMuXDN.u`OVUfPOUQOup 73Y@7Y@UmmVc{@V3@Y@Y@vVmVVn3Vi3/W3BW 3Y@%Z@`W!W"3W#l-0Z@`^@W!,W$ap,fvY%r.ud"/3Y%03ul"03(Z" 03}Z".13Z"C23[&i33_[#3`^@m@}[ !m[![$apf\&t^"3`"u { a"( O b"!OFb"$"Ob"#Oc'$O"%3d"r&e(?`^@)&ret23be) &ret=3e)'"e)8 &len3*f&pad3f)he&ret3g*l@l@&ret3Gh)&ret3h*_@_@&ret3h*Gl@Il@+ret3P)&ret3Fi,xm@m@&ret3i,f@g@&ret3i*L`@`@E&retX3/j)-bufl %`m])&ret~3nj.}/0j1])@ +buf "3Wk) &len3gl*bm@xm@+ret13P*Bf@pf@!&retH3 m*i@j@?&ret 32m)Y&ret#3fm*`j@j@w&ret?3m*j@j@&retC3m*j@j@&retE3 n)&ret-3+n)&ret3n,m@m@&ret)3n*Gd@ld@ &ret^3o): "`:=o)@T "`Vuo*Hg@dg@r &retS3ox&retY3p) &c{Pp&ret3np,e@e@+retc3P2{ 3 45{6 B%m@jt@ h"intXI5Lf7e~t] (e 'e0sytm$".#3#$3#%3#&3# '3#y(3#)3#*3#+3# o.Z%1 id25#3# pid4#.55# 7#8z#>9z#:A#4@]4 )           $   Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec        Sun Mon Tue! Wed" Thu# Fri$ Sat% ;& ' q( AM) PM* + ,|m@{o@pX{p{qH$qM3Mq3kq}& @  `o@o@q__'bu|#oo@o@q no@o@q6Xbo@o@ rbHb htmdp@ p@9rԋjp@p@er݅z p@s@rstrrzristmbsi.utc.t6ztnztPuH)i .3..HDs@jt@utCuEut1G  v  3& tm"@%L@&L@r,F3`@b,&pt@)u@" !0 :oh"intXf~t]yCO :9O O :   0# # arg#<Opt@t@2vc;ap;%=lCOt@t@^vBapD%EOP,Ot@u@varg++vn+Ovlen-O$%Ou@)u@"warg$c$:Nw(`0u@u@;# !0 :oCLRggn:int 9{gng :   0A# p# argn# J  H!# " #:~-&g0u@Pu@mwKarg%Kc%:W-gPu@u@wH,w,wap,%x.l:/`0g0xX<gu@u@CxH;;ap=%>gPH)uu@v@#oh"intXI5Sf7l~t] (l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K ~'u@v@ox %x 6%x I%:x j&:y  % 8 Vz)v@w@l$h"intXf~t] (O !| oC3 o 93 o 3    0# # argo#  "W H#W# $d# %d#)3v@tv@9#:H#4<#A=f#! % HO>]4l %y&#q'#6(s#d)#*#+# %  -8$!!#' l -%*:P )!w@+w@znGC0w@`w@ {B'9{ DY{i w2`w@iw@w{DPpw@w@{?O'{dirQ!{vw@w@Q)e2w@w@SX>:w@w@ | =! = =:)0w@x@9| /!e|5| t,|x@%x@ &h"intXf7Z~t]og!x@%x@| O O,0x@K~@j&h"intXI5Lf7e~t] (e 'eo 3 pid4Z# 5Z# 6z# w7# h8y bHJE yKE# qL3#@ -Mz#D NU#H U? Ad30x@x@|res3}?$}3x@x@B}dev6zx@-y@n}Sؒ}=S}z}pos3~;30y@y@~D~o~3uppos3~iy@z@~3~supret3= %C z@Wz@~QyBl`z@|@;cmdk,#k3npidmpzuh#q;rulzzsJ~Ydir(zQh J Y h wX|@Y}@zW3uYmsgZL1`}@~@y0u2msg3 pN ~@K~@ҀpidM.P~@~@'h"intXI5Lf7e~\8wt] (e 'ey.Z%1Cid2#3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI# Jl# K3# Ld Vi .P~@~@  -* -ll -3 /dX/3|~@@(h"intXf7Z~t]X%zoCO~@~@6O idOف z~@~@ idO o @@+ idO 0n| @<@:)h"intXf~t]otd`3 @<@WnOsnir0|@@@q)h"intXf7Z~tyZ]$hX%o&'#u(z#) ! 6 O u  O ptr" @@@.  hz1@@60Ou 0O ptr2( 2@ p7@@ۂ66O 6Ou 6O ptr8G3@@3F6FOHO3iU@@FT6TO1|@,@B*h"intXf~t]o@@r   @,@1K0@@*h"intXI5Lf~t] (Z-)3 'Zo t$  B * ) q*# `+z# len,o# /& num0o# 1&#5 4z ppb5z# 6o# 7o# f8o# QoldPBPoPonewRA>b?5Y0@@ʃYppbzoC oclenoo˄i3Qi3@@ppbzo@i3R3`@j@s+ppbzoʅ=+3 i3Qarg 3b3b`q``alenao oco d3newe!"""!#$S3bshm3 6opi3 3 z .43p@Ѓ@9=9)bkshm3p9%X &p #%1 "a"V"K"B& 'l#w#(@ @k"""& #) "& ##''''E'e#?7Ѓ@@*6Ţ=9shm3чretȇ+Y34^f @@+4AAc3Aint9Adc8AN AcA*Ac)AHAcGAMAcLAd @.@v%A0@>@#c$A@@o@O; {/Ap@@ec.A%@@݈7H@τ@ Z>AЄ@@5 c=AaCA@/@ cBA0@D@ˉP@d@3RAp@@# cQAO {@@Sv 1 H@@S VWA@Dž@n cVA\AЅ@@ c[AaA@@ c`A04@@q,h"intXf~t]#]@@Ostr"{" "3d$]%3&'3? o Y3h5j@1@ -h"intXf~t] (O';(#6)d#(c##`$o# *q N@@h Mi  Vd@1@7 Uߍ @@@! M 3Rn3֎ #o@ۈ@ + 3Kvݿko@@~H 3` ov&0 M(? Wo@@s 7`oՐ{B@)@ A 0@@J' v 3 `o@@M& `h@@Dn gp `go m 6@1@Ғ 7+@B,3@q- @6 }@@@.h"intXf~t] (O&zy%d@@@s$*$Js1*u bit+o tbl,Lidx-3  o o7}@K@.h"intXf~t] (O(%3@K@s1#Ǔs2#n$d3o80}P@@/h"intXf~t] (O:*P@@Rdst)~src)n)dH d,Qs-R o  8B}@@^/h"intXf~t]K*3@@9s1)es2)o8c}@@/h"intXf~t]W#@@ƕto"R"^$o e9l} @j@/h"intXf~t] (Ou& @j@<str%hlen'd|( o  9}p@@20h"intXf~t] (O$dp@@str#s%R oMp:}@b@0h"intXf~t]2@:@s10113tok36c43jsc43} @ o   `@@b@ s__a@N;}p@@0h"intXf~t] (O)p@@s&c'3 n(db` p+R    A;}@~@D1h"intXf~t] (O#A%Oy<@~@:c0:3$:d t=d: c?z dstAҚ o5l<Df@@1h"intXf~t] (O2#d@@s"4"dSlen$dr  o /@B@Cn.Os.Cܛ.O st0IKi1O3y;Or x t5O YY :]P@@str3]$3' cT@ǐ@Estrg3А@ِ@q1s1s2%@@?ɸɝend˽]-̽_ͽ^neg353^outb@ b CM @ @q? end ~ @@@K?endEV@@@ɞ?DDmD3FVnegG3out@Y3@Ӕ@Ϡs1@@1?3y=e @@2h"intXf~t]yo^'3@@''k=>n @}@73h"intXI5Lf7e~t] (e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K w&3 @}@S %6%3f)̡ dir-  V dY3*? @@4h"intXI5Lf7e~\8wt] (e 'e0~y.Z/A%1Yid2#3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> !"S### _  DIR&l%"y&"#q'#6(l#d)#*#+# _2 -t@@sdirss s~ i@ӕ@4dirhs]~@@`dir\s~C'@@'dirBsD-آJP'* w 253@@H_dir4s*s@@ty) _S@@[@5h"intXI5Lf7e~t] (eo 'ey.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z[#U\#^z#y_#  a`dcUd#fz#yg#  aAh f3@$@\̣3%?ul?o@ z6zɤHo  V  a  330@[@ݤ'1 \1Y24356G?H?<@u͘@3˜@@[@mz{6nzHoori  a Y3fA\@@t6int~]ohf">%=,oXnt~vg bZlow`# `#  s llv R EM nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0k_\@@n^d^ `A7- LWbm7xèީt`@@4@@]B@@7int~]ohf">%=,oXnt~vg bZlow`# `#  s llv R EM nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0kS@@uR۪vRwT VA7-0 LWbtPmxhʬ@@=T@@[y% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ >  : ; I I&I.: ; ' @ : ; I : ; I 4: ; I .: ; ' I@ 4: ; I4: ; I I!I/$ > .: ; ' : ; I.: ; ' I 4: ; I!I/ .? : ; ' I@4: ; I1UX Y1 U41 41411X Y  1UX Y!4: ; I? < "4: ; I?  % 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > : ; I$ > .: ; ' @.? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ >  I$ > &I.? : ; ' I@: ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syslogsave.ctypes.htypes.hgetopt.herrno.ht@6MZZ puguY哓=vנYL=zX0sK== KKgbgYi=寘yfKXu fY?=!YmY/~K@fu7tH.uZzgtXɽ~ɽɻ$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ; index.c@*>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.hP@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h0@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=lsC ../../include/arch/i386msleep.cstdint.h@*<xK-!ĠK-Ksg&zX3 pv.cp@=xi=eN ../../../include/arch/i386get_tick_count.cstdint.h@ >{ ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h#@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h(@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hp?@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c?@=gP ../../../include/arch/i386add_intr_handler.cstdint.h@@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h0@@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h A@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.hV@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hW@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io\T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.hpt@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.h0u@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hu@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.hv@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hw@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hx@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h0x@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h~@?Dx ?Dx =3 puts.c @>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h0@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c @XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.h@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.hP@)Xg[ye_= strcmp.c@)J;iu-/8 strcpy.c@"JiS9 ../../includestrdup.cstddef.h @%$T9 ../../includestrlen.cstddef.hp@##+.?>\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.hp@(JgKwp@G ../../includememset.cstddef.hbsdtypes.h@;fr<zT ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h\@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F|  4t@AB Fa.04@AB IM.`.c.q.U.Z.t4@iD  F AB D_..V.X.Z.P.a.Q.J.Y.K.].J.U.K..Y.X.W.d.P.N.U.| @AB @AB FI@ @AE E @?AB F @VAB F@3AB D| @.AB |  @AB F|  @@vAB FIF@@AB  @0@AB AFF@@>AB | P@dAB F@oAB F0@AB E| @0@:AB D@p@1AB @@1AB @@0AB @ @AB @@@IAB F@@AB A@@AB ON@@@YAB X@@YAB X @@AB IFF| @AB @JAB AC@jAB AF| p@ AB @AB | @@ AB | l@&AB l@'AB l@AB Fl@gAB AGl@AB l @AB MFl@_AB Ll @GAB FFl` @AB Ll!@AB l !@AB Fl0"@AB F| #@IAB DP#@IAB D#@IAB D#@AB E$@_AB DP%@%AB %@%AB %@aAB   &@AB MFF'@WAB D`'@qAB D'@AB (@"AB 0(@IAG | p(@AG p(@AG p(@yAB Cp@)@ AB CpP*@AB Fp+@KAB p`+@RAB AFp+@AB Opp,@AB Op -@tAB LFp-@IAB p-@AB Lp.@ AB p.@AB Ep@0@"AB | 4 p0@AG | ` 0@;AB D|  2@ AG  2@AD  2@AG  3@AG  03@$AB |  `3@AB C `4@#AB  4@AB E 05@AB F 6@&AB |  06@AD  P6@DAB E|  6@ AB | 8 6@7AB C8 8@AB F8 9@AB F8 p=@AB F|  p?@ AB  ?@AB  ?@!AB D ?@ AB  ?@ AB | \ ?@AB |  @@AB |  0@@;AB  p@@!AB  @@JAB IF @@"AB | 0 A@$AB 0PA@AB 0pA@ AB 0A@NAB D0A@AB BF0`B@NAB D0B@\AB D0C@kAB D0C@jAB H| <E@AD <F@AB <F@AB <0F@ AB <@F@AB D<0G@+AB <`G@-AB <G@.AB <G@AB FK<H@xAB D<@I@aAB D<I@AB FF<@J@AB D<J@zAB D<PK@#AB  <K@fAB IFF<L@RAB FF<PM@EAB D<M@UAB FF<N@UAB F<`P@RAB D<P@AB II<Q@6AB C<S@AB <S@AB I<U@AB F| 0V@bAB E0 W@AB 0@W@GAB 0W@HAB B|  W@dAB FLGPX@AB FY@'AB @Y@AB FY@EAB A0Z@0AB F`^@uAB C| m@AB Fo@'AB o@AB o@AB o@ AG p@ AG p@AD  p@AB AGs@AB E| pt@6AB t@AB t@@AB FFu@AB |  0u@ AB D Pu@OAB G u@!AB | u@?AB |  v@dAB FGGv@[AB Hv@(AB |  w@AB  0w@0AB  `w@ AB  pw@0AB  w@ AB  w@`AB FF| x@AB | 0x@QAB Ax@*AB x@mAB F0y@mAB BCy@rAB FI z@7AB D`z@DAB F|@AB D`}@AB PF ~@+AB | 0P~@fAB D| `~@AB `~@AB `@AB |  @AB | @@AAB LF@AB @AB @AB @AB | |@ AB | @ AB | 0@lAB C@VAB C@jAB Fp@`AB FЃ@HAB L| t @AD t0@AD t@@/AB tp@AB t@AB t@AB tЄ@.AG t@/AB t0@AB tP@AB tp@4AB t@AD tЅ@AB t@AB | @AB F|  @AG  @!AB  @@yAB HF @AB  @AB FFF @lAB FF @)AB D 0@AB MF @OAB D @!AB | <@@AD F| p@KAB DD| P@QAB B| @>AB A| @-AB A| 8 @JAB FI| lp@AD | @AB BD@@"AB | p@9AB A| @AB F| H@9AB H@AG FHP@hAB BH@AB HА@ AB H@AB FH@ AB H @ AB H@@oAB FH@#AB H@!AB |  @ AB |  @]AB D|  @"AB  @#AB  @AB  @AB IH @AB  @ AB | !@dAB F!0@+AB JI| !\@'AB E| "@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutoptindsend_flagsend_outputusageoutbufsizeGNU C 4.2.2mainprognametime_tbad_readlogsave.cdo_stdinoutfn/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscrun_programoutfdskip_modestatusopenflagscopy_from_stdindo_skipoutbufchild_piddo_readverboseerrno/home/tyndur/tyndur/src/lib/stdlibcerrno.cdiffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountnextmajSizefirststrchr/home/tyndur/tyndur/src/lib/stringstrchr.cdst0memcpy.csrc0donecaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_lenmsleep.cuint64_tmsecmsleepdo_nothing/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cget_tick_count.cget_tick_countgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initfdl_elementoffsetfdopenlseekoff_tpreadmode_tfd_list_elementF_GETFDnewfdfile_flagsstderrorigin__builtin_va_listold_posio_resposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdexec.cexecvpoptargoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptmisc.cgetpagesizeisattygethostnamepipeforkrunningwaitoptionswait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidsend_messagemetadatayieldtextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipuid_tget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsretvalputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexaFebtime.caFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closeio_direntry_type_tatimeio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cinit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigitendptroverflowbasestrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrncpy.cstrncpystrcmp.cstrcmpfromstrcpysavestrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrmemset.cu_charu_intpositivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoiunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuutP7V7:P:HVRVR8W8MRMWQ6S:SuutP$$P<<PPVP)V<<P<AVDVuQuutqWSWBqB]S]qq.V.BtB]V]tPPBQPiBVnVV#Bt]tBtltliBthnththt~PPPPPtBSS>]Sttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0Ptt.u,P,.uttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVttuttZu))Zu%<SVAZSV`atactcu`uSVSVtt utt!utt u Ptt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttuttutt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPtt uttu !t!(t(4u@AtAHtHTu`atactcuttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcutt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_Ptn>n>Bt8*3*@&(&(*@&(*@*A$p\\(:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)03X_r02 0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@l' @ - @ _ 5@\?@F@M@R@ X@@4l ]4fuzD7H"0 ?JH 0p ^@@ @ @@@@@@ @@     @@(@;@H@^@@ m@ t@D@ @ @ا@@@P@!t@@ p@ #x@ 6@ >@ H@ W@ a@ m@ @$@ @ @ @ @@ @@I@ -6@AFWa@ m@gw@  @ '@%@a@ Ĵ@ @ @ +@K`+@R0@  @ *05@9?GS6@7ev@ G@ȼ@ ļ@ @ ̼@ Y@E @`@$ @)@6`@=FPYdpw~@@y@ @  @  !*3<EN@ W`ir{0Z@0A@N@-o@ 0x@Q@@06@  !@ `3@S@p@`+@"4@!>@Ot@V@ ]Pu@Of@y@M@U@O @ %@%@@Yv@(p=@@P@h?@P~@f@@l @ @p@#0G@+.A@30@+B8@T@VaP@dn2@ z9@P@pA@  @ @@d@ @F@@ @o@" A@$@0@"6@& C@k(@0@:.P@6Ѕ@>@#HЃ@HS@I@aX @?_0F@ f@t2@{@j@ u@?v@[06@@!@ @p@4(@ @`^@u@@/H@x@@ w@ ` @' @_1 -@t7 #@IA \@'K `G@-U W@[ u@g m@p 0u@ } @  @/ $@_ @ @ 3@ @9 ~@ S@ @ C@j @3 x@* @  0@& @)3 -@I9 @> p@@!F 0(@IK `}@a p@ g 0w@0x @@ @ pt@6  @G ~@ @ J@z 0@l ,@ p@9 Y@' @  `4@# P6@D( 0"@5 p@< @@ C E@J p@ T '@W[ -@` А@ h 0@p @Kx F@ P@Q @  @_ @ @' B@\ @V ?@ @1 @ z@7 v@d' @@". P%@%9 .@ @ 2@E y@rR @Z @n &@x N@U~ @J @! pw@0 @@o @> Q@6 4@ 0@; o@ @ l@ @i @J@ @ ~@+ F@# @ ) I@0 @&E PA@M s@R @ Z @b @ o Є@.w @ @@A `B@N @> PX@ t@@ (@ ?@! @ @ 0y@m @ `P@R 03@$u@! x@m@ &@W@G-@@5@ >@YL@ Sh@ [#@Ig`w@ w@v`@ PM@E@ W@dp,@o@'@ p@@j4@@K@f @]w@`4@?@ *@/@<@NPK@#UU@]p@1s@ W@Hx@P#@IG@.@@#0@@@J@@"!@P*@@V@b\@ 0@)0@8o@?p@F.@K@S`z@D_@.f@duL@R{p0@w@ @ @@)@ @J +@(@yp?@ (@" @0@@;?@ '`'@q-|@?@D#@P@Y@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startlogsave.csend_outputdo_readerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrchr.cmemcpy.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idmsleep.cdo_nothingpv.cget_tick_count.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_fileexec.cgetopt.cplace.1334misc.cwait.cwait_listrpc_child_exitrpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indextime.cmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrncpy.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cmemset.cstring.cunlink.caccess.cposix_dir.clost_link.clibgcc2.cparse_pos_paramsputcharstrcpyasctimeinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileppb_from_argvstrtok_rlist_sizerpc_get_responseprintfstdoutvsprintflibrpc_rpc_handlerrpc_get_stringungetclist_pushchild_pidsigemptysetrpc_get_intsnprintfio_split_dirname__strtok_ratolget_parent_pidlio_seekgetenvlist_poperrnostrtoldisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelgetpagesizeio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freeverbosesetvbufwait_for_rpctimer_callbackseekdirperrorcreatinit_waitpidputsdup2rpc_send_string_responseislowertolowerrewinddirinit_execvfeofmallocremovelist_is_emptyisattysleepoptarg_assertvsnprintfrpcstrtoul__dso_handleitoaispunctopterrreaddirjvprintfisspacefflushlist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddset__udivdi3setbufferabortprintf_putcgmtime_rsprintf_putcget_tick_countisxdigitalarmmessage_handlerstrtolpipestrnlencreate_shared_memoryrenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroywriteatoffprintfkillinit_service_registerctimedirectory_createadd_intr_handlerinit_sync_messagesvprintf__deregister_frame_infochdiropen_shared_memory__dtor_end__fseekppb_is_validoptindmemchrjprintf_putcstdinwaitsend_messageinit_envvarsmktime_startferrorsyscall_psignalreadstrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopenforkinit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullinit_messagingfopen__bss_startgetoptlocaltimememsetskip_modemainftell__dtor_start__init_service_get_nameclearerroutfdfclosegetenv_name_by_indexgetchartimeopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcgethostnamesprintfcmdline_copy_argvstrtofatexitstrcspnoptresetrpc_get_dwordstderrdo_skipsigismemberdirectory_closelibrpc_c_rpc_handleroutbuffputcoptoptdivmodpreadlocaltime_r__ctor_start__strftimeppb_copy_argvwait_child_addisdigitfwriteaccessdirectory_read_edatadestroy_process_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenosyscall_v_exitoutbufsizeregister_message_handlertimer_registergmtimestrlenopentoupper__init_execstrchrio_remove_linkfputsexecvpdirectory_seekclosedir_Jv_RegisterClasseslist_removefcntlmsleep__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/filefrag0000755000175200017520000052500411517101521016463 0ustar tyndurtyndurELF@@4\4 (@@@@ DQtdS节U= @t8v@ҡ@ut hH@! @ÐUth$@hH@@tt h@ЃÐQSP UWVS] O t&;v#!v-EE$D$Ly$X@BA")ċEt$|$ t$D$$L@=@s& @sBwҁ@rt$<$Vá@$C2$ AC*É$iDǍ")čt$|$t$$CoL$qUQ5@j)jhl@4$@U]Ít&'U]]u}CvMsV tR@@ЃD@%=t&ftt]u}])믍t&H@L@֋~t11҃9Љw~N1)=X@\@A)AVF ޭޅttYPtOAtUd@fP +PA +A9R d@GP@T@]u}]ËVfQ맍v9 `@tQ9 d@t=tABAtA 1)h@l@A $ D$Id@뷋A`@륍'U0VS l@ h@@@9s։ D$ $:Hۉt11҃9ᆳމw1 AqA AAh@l@[^]Ív Ft&P|^~@t&9t&wv|.~5@t& @t&w0@vwv|ލ~@t&P@T@$&UWVSt&P@T@ EEE Mtы`@! d@5`@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5d@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf 1hfL QA UQEyACKGDGE1ҍYX@\@ڃt )ÃfC [^_]ÉE}tETF^05`@E;11FKAA y]YEAGDGFE`@GG@ GG@GxUGPGMHGDGE1X@\@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0F} CP X9k <$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Í@@ЃD@%=t ftuH@L@ 1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$"QW1 f?[D$E@D$U$KuɍFD$ ED$E<$D$UȜ@FD$ ED$E<$D$@v'UUE @U]& UW V@S1ۃED$D$$`OD$ED$E$Kt&߃ t;>t[@D$ED$$Ju˃1[^_]Í& tED$@D$$JE Ȝ@[^_]Ív'U$@@@@&@ =@@uÐUWVS }1=v@t$$Ft&9{uᡌ@t$$F$ƍ [^_]UWVS }1 v9{t+@t$$Fu [^_]t&@t$$F$= [^_]UVS@$_ƋE@F@11&@;Fw@\$$lEuࡌ@\$t$$FE D$F$q6^[^]{G@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$I\$D$D$ E D$E$,[]ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$ UED$D$ED$ E D$E$rU%F@`@@Ít&UWVS,EUMI=@G@@ Eu&)ċE\$#D$D$$FED$ED$C$fIE\$t$ |$D$$t&1 &@\$$BtF;~uᡐ@\$$BE;u|;~t)&;V떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $JÍ@$\$ƋG 4$D$EG $B<$:]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1${$s]u]Í&U(E uu}}]EEEz@t`$tÉ0E{C<$_|$ƋE4$D$Fs \$@$B]u}]%t&뙐U 0]Ít&U j0]ÐUED$@$@1tÍv'UED$@$?1tBÉ'UWVS }1]v<$D$Ct&@t$$?uԃ [^_]0$C$$@t$$r?UWVS 1t&<$D$JCt.@t$$?u [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$dC9E r݉4$TCt$$D$D&$0C4$E "C$맍vUE]utoU1u ]u]ÍvE $B$ƋE $B4$D$E D$CE tC$1s롸$KtE$jB$/E $RB$҉CthtdE$/BD$ED$$WCE $ BD$E D$C$3C@\$$?@1$NC$C$;U]]u$\$D$$@o4$؋u]]É'U(]u}D$=E$N@¸tR+ueF)ĉt$E\$$~D$FB3D$}$|$te1]u}]Ít&@@eU@$;Ít&'UWVS,EEE EFEEE}&$^@EF$M@]]x;D$E$BEED$D$EE$TA|$FD$]$>AEEEED$@$:lED$ ED$E܉D$E$EE,[^_]'UWVS<D$@$@@$=u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$?<$D$tt$<$>4$>UDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&@@獴&UU S]G) ʃ) 1[]Ðt&@@獴&UU SG,Ћ] ʃ)[]Í@@䍴&UVSUMu t`@d@Bh@Bt\1ۅt.@@[^]É\$$`@Ht\$4$4u؃Hu1[^]Í&`@Fd@Fh@1[^]Í&1 t&Ht\$4$t\$$`@p֍&'US@]uu%@1[]Í&$ti@B$`@D$@1[]ÐUED$ D$$/?1Ít&'UED$ D$$>1Ít&'UD$D$$@>D$ D$$`@>@t&@=`@u@ U=@]]uu}} G~&@@&]u}]Ív tՅt4@Ĕ@CȔ@C̔@C Д@C1t@GĔ@GȔ@G ̔@GД@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$`@u@t$Ѓ1[]Ð1[]v빍@@ U$nÍUEwE]"t&]Í&'UU ~ÍD$D$ D$D$E$1ÐUWVS1ۃ }u@t&9ljEtGl@\$$+4u@@ [^_]$@p#ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1fl@\$$3nU;uݡl@\$$3 [^_]fUED$$D$Í'UVSu1 t&;0tkl@\$$3u$ D$_D$@$@1D$ "3CCl@\$$4[^]N&'UWVSE}}Et[^_]1 &;8t l@\$$B2uމ<$1ۍt&;>tVl@\$$ 2u1D$ D$D$@$@!UFF[^_]zf뿐U4D$!@$ʃ@l@ÐU1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVS,1ɉ‰EE#E$*ËE$k)StdfuC.C E\$$+11vD$xE$)tXC$.ƋCt+rǍ&CC뗐t&$փ@d.Ɖ떍F$EE$(uE#&tcu :F/<$mED$E$)t8_4$\$i-$-ƋGu/볍&|E$*E[^_]Í&$E$'D$E$(8$6@@E$'\$D$E$)aU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU@@$ك@D$ED$ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$*؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$J؃$[]fUS@]U u$T$؃[]Í\$D$ D$$ []Ít&US]$n*\$$t@t$ 2[]Ðt&D$h@$|ؐt&UVSD$@$@ wD$ D$D$4$5 Ƅw@D$D$@4$$@D$ D$D$$D$@$@[ )wD$ D$D$4$ Ƅw@ZD$D$ @4$6$@D$ D$D$@$D$@$ @ wD$ D$D$4$ Ƅw@D$D$ @4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$ @4$ @vD$@4$ @*D$ @4$ @U1]É'U]Ít&'UE@1] U]G2&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$&t$u\$ D$@F$Ɖ]u}]Íu \$KS<$!C $6U|$T$$C&\$ D$D$@F$ƋC $뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$-@F$*4$딍US$]u$[]Í&Ct$ELED$ D$D$6@C$D$Ë@ D$E$$C $S$KE뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$1҄u뱍vC!C$뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$W"$wt&tyvC!C$:vK9Crt$ED$ $/"sY&{Cft$ED$CC$!sv'U]]u$ U $D$T$ D$^$d ]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$@$!@@EED$ D$D$?@G$Ë@ <9}sE<D$@D$E$C $$,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$#_utRu4ttG!9u܍f]v֍ovɍt͉$v3G!9uIvvE<$ED$ D$D$?@G$Ë@<9}sE<D$C $t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$ )čt$<$9s@a<w%$d@vЃ|+uf<$u9rE1ۉ$dUT$D$F$E$@t$ D$H@$D$U$w t Nun1ۉ<$|e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$m$2FU$T$$&ËFCFCF C FCFCFCFCF C F$C%C$$D$ D$$D$C%4$Ov'UD$Q@$U@Ít&UWVS] D$@E$~C$ D$ @$N84$t$ D$D$<$uN@D$D$@@$'4$ $@@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$!1[^_]á@D$@$'@@e@D$@$&@@<@D$@$&4$ @@ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$ʃ@4$B]$t$D$ D$D$$?$wf&'U$~ÍU@tED$@$M1Ð@u@@É'UVS1ۃ@uu!&Ѓ@\$$uu[^]U(E E0D@EC@ED$ED$E$|+Ív'UE D$E$ÍUuu ]]4$69~tu ]]u]9u EUE $ÐU}MU EtÐD$T$ L$D$d@@$#AUED$@$Ðt&UED$@$w1҅t $U]w&UED$@$71҅t $IU]W&Uuu]u1ۉ؋u]]Í&4$u$t$ D$D$É$"UFu u0]ÐUSD$ D$D$@$t@ MZ$Ǽ؃[] UED$@$D$ E D$hÍUWVS E}D$+@$U v2t&D$+@$U 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$ t<U$ Ɖ<$:9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$|$\$E$\$4$ ËE$=؋u]}]Í&'US]$\$ D$@$D$/[]É'UWVS,]D$+@$EU)čD$ET$\$$UE$ EtD$$CUe$]$@$)č\$t$$$D$@$d2EE(&D$@$4e܅e܉<$LUƍD)č\$|$$3/ED$D$D$$Tu$$轼E\$1ۉ$\e܋EetjU$ƍx@#)ċE\$$D$!U TE$\$ |$D$Å@$3t$Ue[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$̅@$»$̅@$D$̅@D$$̅@UT$D$$$̅@D$\$D$D$$D$ []Í&U($Յ@]uu}B4$8D$$Յ@$D$Յ@D$J4$$Յ@ WT$t$$$ \$D$D$$D$ _]u}]fUED$ D$D$ޅ@$GÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$@C$$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$D$$FFF D$D$$ ta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ@@EE؃<[^_]ÍvEE@@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$ \$UT$M܉ $ \$E$FU F$E] UMV~HU1fC D$CD$EE$ MC K9}MƋVT$D$U$V F D$$ 4$uUE ]u$tD$E$^$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx顰@t9t)ȉ vt̅u@@@뵋5@9|͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$k9@u,@9|Qu!@vWu1]u}]Í&tq $諭뛐@ȍ&'U]]u1t#1tr$dk9@t]u]Ít&@t@ݐt&@̍t&US]$xu][]&U$]]u%ۉƋEFtM u:3C9@t؋u]]Ít&@9E @܍t&U ؃t21빉'US]t$$薯U PC9@t؃[]Í؃@[]ÐU$N@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUMVuS] u t&8utu1҉[^]Í&C)萐UVS]utU t&tu[^]Í؃tu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$tt$|$$U؋u]}]ÐU1M9t :u)]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]7&UWVS ]} &$Ju+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$u<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$HAEEs{xC{$~EE UED$ D$$oÍ'UED$E D$E$AÐU]WUS]D$@$t$1[]f$Xt$,1[]@@ːUE D$D$E$Í&'UED$D$$Í'U$@n1Ív'UEu1}]$tL$$hfw7D$F|$$Ɔ<$]u}]Ív‰'UE$ɃÍU]gUWVS]$E$AƋE D$@E$e4$P UP()ԍ\$CHCL$t$$\$ ED$@D$G$ĭtm3tNe<$k4$ÝU$踝e[^_]Ítu@@t&븍@@롍&@@ 뉍&@@yt&@@aU8}]] u}$̿$Bt|txD$@E$UED$@<$:EUBU;B@@ E$#U$@@4$Y<$Q؋u]}]f@@΍&@@딍&$D$@{tE1ۉ$ht$ D$D$U$:4$blt&e4$-PUP,)ԍ\$CHC L$t$$?UUC\$ ED$"@D$UB$/tB&vt ev@@ftu@@t&@@ 뷐U(EEh@EEEEED$E D$E$7Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$]u]f4$ҍUUE $T$UÐU(}}EU u1]]EUt\$t$ $T$EU\$t$ $T$]u}]ÍUWVS,E ]EP@E܋EuE,@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$~8$t 1҃[]f[]Ít&'UWVS$1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|D@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UWVS ]f$u<+E<-<0E}1EmfB;EJ~-$to$ V;E\$H)ʉ}9}EE{ƍ4Ct"$zu$u߉M tU :Uth}-@@ [^_]Í<0C@=@=@>@=@=@=@=@=@=@=@x>@=@=@=@=@=@=@=@=@=@=@P>@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK A?telldir: Nicht implementiert IO_ULINKlwIO_LINK 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZn@m@m@m@m@m@m@m@m@m@m@m@m@m@n@n@m@m@m@m@m@m@m@n@n@m@m@m@m@n@m@m@n@u@/r@/r@/r@/r@/r@/r@/r@/r@/r@/r@au@t@/r@r@r@/r@t@/r@/r@/r@/r@/r@u@u@/r@/r@p@/r@u@/r@/r@u@#|@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@#|@"w@"w@"w@"w@"w@"w@"w@"w@"w@"w@+{@"w@z@"w@"w@{@__zR| 8'AB E<@_AB E @GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@1@3  @ @@g@!J0@M@y! @D%"@d&@#@ "'P#@N.,@|/,@0,@71,@+51@A`B@(CC@EPD@?GD@KE@-LE@IQK@fLS@L@SjTL@UL@WM@XM@]Q@aS@AdV@eW@KfW@QgPX@.ihX@>iX@-iX@Jj@Y@jk`Y@l@Z@9mZ@n \@o\@sb@ tb@]vb@9z0d@~g@yh@h~@@'|ȁ@_jamainQinit_memory_managerfreeZmallocrealloccalloc librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*nsyscall_psyscall_vJagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killG!vwaitpid,waitXwait_child_addqinit_waitpid'D%Zrpcsend_message&nyieldR"',io_split_filenameio_get_absolute_pathZio_split_dirnamedN.get_pidget_parent_pidcreate_processmdestroy_processget_cmdline"/nset_rpc_handler#0yadd_intr_handler71}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#+5 Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6A_exit2abortGatexit{exitFC0vprintfcprintfprintf_putsnprintf_putcEa_assertGPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read Kysyscall_timer-Ldinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_nameIQlio_seekVLScreate_shared_memoryopen_shared_memoryclose_shared_memory jTysyscall_putsnqUmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6Wnwait_for_rpcv_and_wait_for_rpccXppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv] isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper`?%errnoalist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createdstrcspneostrncmpfostrncpygdstrchrihdstrcmpidstrcpyiostrdupjostrlen(jkQd__strtok_r strtoklomemchrmomemcpynmemseto9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoulsrunlinktoaccessYv=seekdiryrewinddirtelldirreaddir3closedir_opendir4z io_remove_linkio_create_linkJ~a)vfprintffprintffprintf_putsn+fprintf_putciy 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintfhdstrtol__udivdi3|__umoddi3fX@@q@o"int_P5Lm7e{d,(e'ev.Z%1H id2# 3# pid4# 55# 7# 8z# E9z# :A# ;d4N 3/{ f0} {GP@q@-*FZ,ppbFLFzwHI3sc-vl3d@@k@@q<i7IY+,3pt@@vo"int_P5Sm7l{d,(l'l.a%1?id2# 3?#pid4#55# 7#8#E9#:H#;<#H=E#! % HV>d4K :t@@2 |8 V$@ @~o"int_m7Z{OyZd,(ZIJ#K#Lh#lMh# Nh#OM#OMYM#ZM#[#\Z# l]h#A^h#vs3Yz3  s cO nz i3   ptr3 ^ 3~ d s1 s2d nz(kJk|x.xjqvZ  s c3 nz i3;@@u@c@ptrminMmajC-hwS@@`*@0@mP@k@~P@k@@@mhh 6@M@!/p@@Z"lh#sth maj @@$%m@~$X9&>@O @b'A=z?3m@apA^BhmajCminDM3EMxlFz`.@:@ZSC@H@P`9@;@`@@pp`Dh1`@@L@ @hZ&P @ @xp'lzptr`minM z.h S~ @ @0` @ @m( qs.$$7BM0 XD `3 @8 @i`~ @ @^&  @ @X ' z 'l z 3p ~ @ @ @ @)R*b`@*cd@+eM,3*f3@*g:h@*h:X@*Ok:P@*l:@@*im:H@-q.A28 @ @o"int_P5Lm7e{d,(e'e~0Zzv  , -# .#  /k @f @ jZ gjZ~ wj il3 `qZ7 rZupep @ @v 3dA dAF4 @f @ 4,E E%GdiHZ oHZ+ io9p @ @I ^i:Z6@4@   1@  2@Y8 @?@o"int_m7Z{d,(Z'T(#l)o#*zv  &'#(O#  a @@u 2 `O b2ic3  O @@ y NO P2iQ3M ,O@?@k  + +Oid-O 52 <2i=3 #@$O@e8@@o"int_m7Z{d,(Z'Z~0|Ooz 3 pid4O# 5O# 6o# w7z# h8 '$ T(*# l)o# $*Av +tpids|sOou3?v|r@@ pidp|pO?q;b@@(pida|aO?a3AS@A@TgpidQ|QO?RO6CP@@pidA|AOlenAowB; A@@@@{pid|(;#oBw;aOs{?Kg\r}A H!1@ @pid0|(0;0ow0; "?2!Y;@@#pid|$(;6$oV$w;v%9;%?%HO&3@@pid|(;o;w;[93{?&O@Y@ppid|(;o.w;N9On?߉'L`@@J|JOKo7wKzm?MNz(3O@):*.@0S@!@"o"int_m{dv@ @ @!@|0@}@Yo"int_m7Z{d,(Z'Z3pid4O#5O#6o#w7z# h8 v   'T(#l)o#  *(V)#9*#V+1 q0@V@o3$͙ V `@@Do3pMC@@BiD3E@w@d<i3e @@je@-@)d,ldob9h O30@@_9 3<h`@@C 3@@ 3,#3@@str"sep$$.oB/3@@` 3\@@!pidZ|ZO"gZo"w[z #?]zud#^ouh#_oul__o$i`3upa 6@}@ U$ =|7@u@AUJ @u@ECj8K9L #-l@ %Y3 @@ o"int_P5Lm7e{d'e #A P   3 q#]#/3#0v3@@ss3 3@@3s_3&3 @i@%%3 >3p@b@9^=3e==s i?3M~osp@@vnsidpZ@3@@s#3@%@s30@@<i43q3@z@hcsig3tcoldr iq @@63beH3@Q@G3[F{g`@t@d8{@@<z3k3@@w pidjzj3 G!+w@!,`@!-@i"Y3   @"@ o"int_m7Z{d,(Z'Z'T(#l)o# *v   )  pid*|#+ # ,3#i U BCCpidA|iC3 DC 7 nvpidm|io3 pCi | @ @3 &pid|_  & 3! C! @; @#P.8!7I @ @VpaV!j 3|!@#!@t!X &F T0!@!@!pidS|! VCoutf!@H!@d!@V#.!7 !@"@"qpid}|A"}Og}o"w~z" C" K#."7!#."7"d 9"@"@##- 0l@ $Y3V:S"@4#@ o"2>int_m7e{dvrpc""@"@I#pid!Zu# #ZP q 2>"@4#@#Dpid0Z# `0Z# 0Z $len1Z+$ w1zV$ 33P ~ :Th ZT D S@#@L#@ o"int_m{dv @#@L#@u$( P#@,@R o"int_m{d,(Ovo'T(#l)d#*  & s   V  / f 1&z 2# 3# 5&# o6 ppcwd} v 3 p pcwd} v (3i)3_ Fv DlenEdz E E Gv o iP#@%@$ h$hp$ h3 % jugposk)% luhz mul nv% wd% 8!!!!P"#$@$@(!!!!p"#$@(%@[!!!!"$8%@%@!!!!"i%1 }%@:&@D&& p& v' p&(%@$&@'}&'$d& @pi3 3 v) :d9pl;di<3 =vC _]pO]} ^ib3 cv% }@&@*@&Z&  ' v* pud 3'ldd'' }w'+6&@&@r!C,N'"Y"d-|!,','",',(-0!P, C(,)l(,4(+@(@)@!!R"^,j("t.)@)@!!!,(,(/ }*@,@)& 1)';}Q)*pul'ld|)' v)-@+!R"^,j)"t.*@+@-!!!0,), *u? S,@,@!o"int_m7Z{d'Z (ZvP 'o,@,@* pid(oJ* 8o ,@3,@]* pid7o 9o*X Vo@,@a,@*m  TO uidTz wT s Uo pidWo* / kp,@|,@*g z,@,@+ {3+F S,@,@o"int_m{dvz ,@,@F+ S,@,@o"int_m7Z{dv !,@,@r+3 O ,@1@no"int_P5Lm7e{d,(e'e.Z%18id2# 38#pid4#55# 7#8z#E9z#:A#;v AV>  _ >d4K  3  ,@,@+v Yo-@-@+ 3 -@)-@+  d 30-@~-@",,c3N,`-@v-@cs>u{1 8-@.@,)8,pos3,c3-o`3.@^.@"-c3N- @.@V.@cs>u{3`.@.@- ne-strY- 3.@+/@4.7strY`. /0/@1@.~. 0. 1~~l2z.>V>V# )@ $@i%@|&@Y3  1@\B@o"int_P5Lm7e{dv,(e'e.Z%1?id2# 3?#pid4#55# 7#8#E9#:A#;<#H=E#! z AV>d4K3pid4Z#5Z#6#w7# h8a 7id8# 9# :# ;Z# K <?Iid@# A# B# CZ# wDI# AX l EOyidP# QcUidV# W Ki  z6 & zres {K# |#%V   V 2%l1 3E %1@1@/c81@1@K/ 31@1@w/ _31@1@/-^+31@2@/_ /O?_030l C _  ?out82@ K R32@ 3@0 QOM33@=3@0 LOL?lL G3@3@n3@%1 FOF? p3@k4@Q1src}1 1 1 1g2"2  524@=4@wS2  A  X 3p4@4@f27 2l2 34@Q5@2u 3 $ yp! 3`5@5@H3" t3#Z3Ahs5@z6@3 g3 npos64wV4 ~ N36@6@t4d M4 Ms4 M35$:7@#7@.5 307@8@Z5w5 5 5 6g`6 838@8@6:%str7 7_ %39@E9@6c$36 $&ch&zu{e 3P9@9@7c3B7 x7 E! 9@<@7 ")7" 8" V8" 8#8 8  \'x <9lO9()' *9l,9:@;@*i39+ E F3<@b<@9  E9,cGz,:0 ]?p<@5=@L:u )\?x:$\3: \:,i^3:,c^3 ;! K@=@v?@*; "-JV;"Jv;- L?up.msgR + SE*iW3;#~;# ;/+C _ z 0 ?@?@>< l3?@iA@j< Gk< k< Om _ nl o,srcq<,dstx=/$7= A 1! pA@\B@U=M " ="="e =#u =+ V-] -@-..Z@- /@2|82 Y3` `B@C@o"int_P5Lm{d,(Zv'T(#l)o# * ' e`B@B@> d3A> msggd (hzV i,A, 3sEB@B@`>YM3B@7C@>s`Lus ( 1@C@C@> 03>`C@zC@i43?`5u g(@Y3,V C@ID@F!0:vo"int_m{dO :O O :   # # arg#<OC@C@"?co;ap;%`=lNCOC@C@N?oBapD%yEOP},OC@0D@z?arg+A+?n+O?len-O%O0D@ID@@arg$c$:>@ PD@D@vo"int_P5Sm7l{d,(l'l.a%1?id2# 3?#pid4#55# 7#8#E9#:H#;<#H=E#! % HV>d4K 'PD@D@]@ %@ %@ n %:@ &: A  % |8 V8 D@E@xvo"int_P5Sm7l8~{d,(l'l0.a/H%1`id2# 3`#pid4#55# 7#8#E9#:H#;<#H=f#! % HV>d4l %&##'#l(s#)#Q*#$+# %  *-f$!!;#' l -%*:P )!D@D@*AnuCD@D@VA;B'A DAi w2D@D@ADDPD@ E@A?;O'BdirQ!8BD@ E@Q)e2E@E@S>: E@)E@VB =! = =:W00E@E@B /!B5B SE@E@o"int_m7Z{dv!E@E@C O ONE@K@o"int_P5Lm7e{d,(e'ev 3 pid4Z# 5Z# 6z# w7# h8 HJE KE# #L3#@ cMz#D NU#H U? Ad3E@F@.Cres3ZC?mC3F@:F@Cdevlz@F@F@CSwؒCsSDz#Dpos3NDq3F@G@aDwDD3uppos3Di G@G@Dw3 Esupret3s %RCG@G@EQB-lG@$J@IE;cmdkuE*k3EpidmE9pzuhq;rulzFz*FsJ =FYdirqF0zFEh J Y h w X0J@J@FW3YmsgZ1J@K@F02msg3 NK@K@GpidMK@6L@_o"int_P5Lm7e8w{d,(e'e.Z%1Cid2# 3C#pid4#55# 7#8#E9#:A#;<#H=P#! Iv AV> HidI# Jl# K3# +Ld Vi .K@6L@GG  -sG -lG -3 /diS@L@L@#o"int_m7Z{d%zvyO@L@SL@GlO idO"HBz`L@sL@5H idO =oaH UL@L@tH idO SL@L@o"int_m{dvtd3L@L@HnOsni SL@M@o"int_m7Z{OyZd$h%v&'#(z#)  ! l O 2 O ptr" L@M@H.  h1M@.M@Hl0O20O ptr2`2xp70M@KM@$Il6O 6O26O ptr8G3PM@lM@PI3FlFOHO|IiUpM@M@ITlTO"1SM@M@o"int_m{dvFM@M@I@ M@M@IJ"M@Q@o"int_P5Lm{d,(Zc)3'Zv $ S x ` ) #*# 9+z# len,o# /& num0o# 1&#5 4z ppb5z# S6o# 7o# 8o# QoldPxPo.PonewRA>b?5YM@N@JYppbz?JoJ oJlenoJ$oKi3Qi3 N@vN@2Kppbz^KoKi3R3K7N@N@K+ppbzKoLs+3 i3Qarg 33LEb3b`#`9alenao co od3newe!"""!#$3bshm3 lopi3 3 z dj3N@PQ@FL9s9rLbLshm3Lp9 M%&#%1"a"V"K"B&'l2M#w#()P@P@k"""&#)0"&H##'PM'pM'M'M#?mPQ@Q@M*Ţs9Mshm3Nretȇ-N+Y3v$Q@S@\4AAc3Aint9Adc8A AcA*Ac)AHAcGAMAcLAdQ@Q@@Nv%AQ@Q@lNc$AQ@Q@N; N/AQ@ R@Nec.A%R@$R@&O7H0R@OR@ROZ>APR@~R@~O c=AOCAR@R@O cBAOR@R@PR@R@@P3RAR@$S@lP cQAP R@S@Sv 1 HS@"S@S WA0S@GS@P cVAP\APS@eS@Q c[A.QaApS@S@MQ c`AyQ;M%S@S@7@@int}%S@V@o"int_m{d,(O'T(#l)d#(##9$o# *q NS@S@Q MQi  VdS@S@Q7 UR +S@YT@QR }R o3RRn3S <o`T@{T@/S [S o3{SݿSoT@"U@SHSo3T9 oFT&hf(oT po0U@U@T TP9oUBU@U@#U AOU  U@WV@zU' U o3U 9oV8V@WV@fVV yh`V@V@tVn gV 9goV m 6V@V@W7!+@[,3@-@&H%V@W@o"int_m{d,(O&z%dV@W@.Ws$ZWR$zWs1*W bit+o tbl,Lidx-3W  v o'Z%W@W@o"int_m{d,(Od%3W@W@Ws1#Ws2#-Xn$dcXv(l%W@AX@ o"int_m{d,(Ov*W@AX@Xdst)Xsrc)Xn)d(Yd,Qs-R v  (%PX@~X@d o"int_m{d~+PX@~X@iYp*Ych*3Yc,Qv )%X@X@ o"int_m{d*3X@X@Ys1)Zs2)BZvm)%X@X@ o"int_m{d#X@X@aZto"Z"Z$v )%X@:Y@ !o"int_m{d,(O&X@:Y@Zstr%[len'd.[(A[ v  x*%@Y@^Y@w!o"int_m{d,(O$d@Y@^Y@T[str#[s%R vM*%`Y@2Z@!o"int_m{d2`Y@ Z@[s1[17\ 1{\3\tok3\c43]sc43] @ v   `Z@2Z@+] s__ a@+%@Z@yZ@/"o"int_m{d,(O)@Z@yZ@W]s&]c'3]n(d]p+R    Ae,#%Z@\@"into"_m{d,(OAZ@\@^:H^,:h^$:d^dstB^srcC _tDd^_1}@[@   v   ,6% \@\@#o"int_m{d,(O?#AF%O< \@\@_:`c0:3\`$:d|` t=d` c?za dstA?a o5-\@qb@#o"int_m{d,(O#d\@)]@uas"ai"dalen$da  v d/0]@]@aCn.O)bs.CIby.Oub st0IKi1Oby;Ob t5O YY ]]@(^@bstr)cS3]kc$3c c0^@7^@cstr3@^@I^@c1s1s2P^@l_@ dɸ6dendld˽]̽_yͽ^neg3d\3dout^@  C p_@_@d end 0_@_@ eKendpEV_@b@6eDbeLDeyD3fFVVfnegG3goutR`@3 b@Cb@d4K  DIR&K &3b@b@g %g%3f)9hdir-Wh  V dY3G03b@)d@%o"int_P5Lm7e8w{d,(e'e0~.Z/A%1Yid2# 3Y#pid4#55# 7#8#E9#:A#;<#H=f#! _v AV> !"S#O## _  DIR&l%"&"##'#l(l#)#Q*#$+# _2 *-Gtb@c@uhsdirss s~ i c@Cc@hdirhs]~Pc@fc@hdir\sC'pc@c@h'dirBs%i D-Ei'JciP'i w 2V53d@d@i_dir4s?*s d@)d@i) _p10d@g@&o"int_P5Lm7e{d,(ev'e.Z%1?id2# 3?#pid4#55# 7#8z#E9z#:A#;d4K  Z[#\#^z#_#  a`dcd#fz#g#  ah 30d@e@ j9j3j6?ul(?jwd@njz#klz6kO   V  a  _33e@g@Jk1vk1kC2dl43l 5ln6&m(G?m6H?mw_f@=f@2f@ g@g@mzmlnzmOo ri  a Y3]2U g@h@M(!0:vo"int_P5hm7{d,('.v%1Tid2# 3T#pid4# 55# 7# 8# E9# :]# ;<# H=Z#! : ]V>d4`  O :  O  O  :   v# #arg#o##fp$## kL4Og@ h@'nfp3#o3ap3%w5 t_6hM<Oh@1h@Snfp;#o;ap=%y>OP|/O@h@h@n%arg.%nA.nn.Oo  (Oh@h@!oarg'%c':Mo 3c h@~@4)o"int_m{d!q{v3 d {3 d 3 {   # # argd#]W vV 0 3:OV&2-{  0 ##9 ]#F}'9|buf|`|OL2Vh@$i@loZ1Vo1Oo1o3Vrem4OOSL0i@i@!p.9KVMpbufK~pKOp#KOppMuXN.u`OVp?PO"qQOup 3i@j@5qmwmaqc{q3 j@j@qwmqA rn3-r i3zr3r j3j@k@r!mr"o3s#E-k@@o@s!o,?s$ap,ft%K.ud"/3Hu%o03ul"03su"03u"13v"23\v&i33v#3@o@~@v !wmv!o,w$apfx&ty"3{"2{T|" OU}"`!O}"$"O}"#O'$O"%3("K&d(?@o@)@&ret23)X &ret=3)p'"A ) &len3u&pad3")e&ret32*}@}@&ret3)&ret3*p@p@&ret3<*'}@)}@+ret3P)&ret3,X~@x~@&ret3Є,w@w@&ret30*,q@_q@E&retX3z) -bufl %9m])p&ret~3.}/01]) +buf "3)  &len3*B~@X~@+ret13P*"w@Pw@!&retH3T*z@z@?&ret 3})8 Y&ret#3*@{@e{@w&ret?3*x{@{@&retC3/*{@{@&retE3X)P &ret-3v)h &ret3ˉ,x~@~@&ret)3 *'u@Lu@ &ret^3j) : "9:) T "9V*(x@Dx@r &retS3( &retY3\) &c{ &ret3,v@v@+retc3P2{ 3 45{6 Bh6~~@@,o"int_m{d#]~@@str"/L"Ԍy"3y$]hu%3&ȍ'3 v Y36p@ǁ@_-intdvom"%,!_ {0(@  low`#`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0k6_@ǁ@n^Hd^h8 `A7-P LWbmx%g@^t`@@D@ǁ@Q8pȁ@'@-intdvom"%,!_ {0(@  low`#`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0kOSȁ@'@uR=vRwTh VA7- LWbtPmx]}ʒ,`s8@<@@'@ۓ% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' I@ 4: ; I? < % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includefilefrag.cstdint.hstddef.htypes.hio_struct.hstdio.ht@= Z_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ ../../../include/arch/i386../../../include../../includemessaging.cstdint.hstddef.htypes.hrpc.h @tB/@T@04.O.t>>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h @@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h0@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/ ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h @i+t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h,@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c,@=gP ../../../include/arch/i386add_intr_handler.cstdint.h,@ =u ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h,@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h`B@??>0Tfgh Zs<\*\/TZ,>d>-z=ewI ../../../includeprintf.cstdarg.hjprintf.hC@;i:LYfA`=jbtg ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hPD@&gI38 ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hD@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hE@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.hE@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h@L@?Dx ?Dx =3 puts.cL@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.hL@ ic?9 fi='=% wait_for_rpc.cM@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.hM@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.cQ@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cH ../../includelist.ccollections.hstddef.hS@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.hV@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.hW@$>9LV2z Z: ../../includestrncpy.cstddef.hW@)Xg[ye_; index.cPX@*\ strtok.c`Y@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@Z@(JgKwp@8 ../../includebcopy.cstddef.hZ@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h \@;fr<zT ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h0d@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ  ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.hg@3g==hwfA\jg;"xg;KJ ../../../includejprintf.cstdarg.hjprintf.hh@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io:sf"Ju[vI$Qj ȃ;/Xx#0]XDA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hȁ@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| (4t@1D  F AB AR.| t@AB t@AB FItp@AE Et@?AB FtP @VAB Ft @3AB D|  < @vAB FIF<p @AB  < @AB AFF<p @>AB |  @dAB F @oAB F@AB E| <@:AB D<@1AB <@1AB <P@0AB <@AB <@IAB F<@AB A<@AB ON<@YAB X<@YAB X <`@AB IFF| @ AB @AB | 0@&AB `@'AB @AB F@gAB AG@AB @AB MF0@_AB L@GAB FF@AB L@AB @AB F@AB F| D@IAB DD@IAB DD @IAB DDp@AB EDp@_AB DD@%AB D@%AB D0@aAB  D@AB MFFD@WAB DD@qAB DD`@AB D@"AB D@IAG |  @AB C!@#AB 0!@AB E!@AB F"@&AB | x"@AD x"@DAB E| @#@ AB | P#@7AB C%@AB F@&@AB F*@AB F| ,@ AB  ,@AB @,@!AB Dp,@ AB ,@ AB |  ,@AB | @ ,@AB | l ,@$AB l -@AB l -@ AB l 0-@NAB Dl -@AB BFl .@NAB Dl `.@\AB Dl .@kAB Dl 0/@jAB H| x 1@AD x 1@AB x 1@AB x 1@ AB x 1@AB Dx 2@+AB x 3@-AB x @3@.AB x p3@AB FKx p4@xAB Dx 4@aAB Dx `5@AB FFx 5@AB Dx 6@zAB Dx 7@#AB  x 07@fAB IFFx 8@RAB FFx 9@EAB Dx P9@UAB FFx 9@UAB Fx <@RAB Dx p<@AB IIx @=@6AB Cx ?@AB x ?@AB Ix pA@AB F| l `B@bAB El B@AB l B@GAB l @C@HAB B|  C@6AB  C@AB  C@@AB FF 0D@AB | lPD@?AB | D@AB D@0AB D@ AB D@0AB  E@ AB 0E@`AB FF| DE@AB | pE@QAB ApF@*AB p@F@mAB FpF@mAB BCp G@rAB FIpG@7AB DpG@DAB Fp0J@AB DpJ@AB PFpK@+AB | K@fAB D| @L@AB `L@AB L@AB | 4L@AB | `L@AAB LF`M@AB `0M@AB `PM@AB `pM@AB | M@ AB M@ AB | 8M@lAB C8 N@VAB C8N@jAB F8N@`AB F8PQ@HAB L| Q@AD Q@AD Q@/AB Q@AB R@AB 0R@AB PR@.AG R@/AB R@AB R@AB R@4AB 0S@AD PS@AB pS@AB | PS@AG PS@!AB PS@yAB HFP`T@AB  PT@AB FFFP0U@lAB FFPU@)AB DPU@AB MFP`V@OAB DPV@!AB | V@AD F| W@KAB DD| W@QAB B| PX@.AB | HX@>AB A| xX@-AB A| X@JAB FI| @Y@AD | `Y@AB BDZ@"AB | T@Z@9AB A| Z@AB F|  \@AB F| \@9AB 0]@AG F]@hAB B0^@AB @^@ AB P^@AB Fp_@ AB _@ AB _@oAB F b@#AB Pb@!AB | (b@ AB | Tb@]AB D| b@"AB  c@#AB Pc@AB pc@AB IHd@AB  d@ AB | 00d@dAB F0e@+AB JI| g@;AB h@!AB @h@JAB IFh@"AB |  h@dAB FLG0i@AB Fi@'AB  j@AB Fj@EAB Ak@0AB F@o@uAB C| ~@AB F|  @'AB E| Tȁ@_AB EresultGNU C 4.3.2__ctor_start__short intsize_tcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutGNU C 4.2.2stderr/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscmainfilefrag.c/home/tyndur/tyndur/src/lib/stdlibcusagediffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountnextmajSizefirstcaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexerrnoSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumrunningwaitoptionswait.cstatuswait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidsend_messagemetadatayieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipuid_tget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlerputchargetcharperrorstdio_init/home/tyndur/tyndur/src/modules/lib/stdlibcstdio.cstdinio_resstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadoriginshm_sizeio_eof_request_tfeoftmpfileold_bufferoffsetwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortretvalputsn_fctjprintf_args__builtin_va_listputc_fctpfn_putsnpfn_putcexpressionassert.c_assertassertiondirectory_closeio_direntry_type_tuint64_tctimetime_tatimeio_direntry_tdirectory.cis_directorymtimedirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigiterrno.clast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspn/home/tyndur/tyndur/src/lib/stringstrcspn.ccharsetstrncmp.cstrncmpstrncpy.cstrncpystrchrstrchr.cstrcmp.cstrcmpfromstrcpysavestrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrdst0memcpy.csrc0donememset.cu_charu_intendptrpositivedecimalitoamaxlenstrtoullbasestrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoiunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlinkvfprintffprintf.cfprintf_handlerfprintf_argsfprintf_putsnfprintf_putcptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexoverflowstrtol.cstrtol/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSu Q u u 1tttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0Pttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Stt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt?u9Q9?u9R9?u 1P1?u ?uttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcutt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nulultt;u@AtACtCaupqtqstsupupVu VputtuPttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P*3*@&(&(*@&(*@*A$p\\(:(:@O/25;$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJphj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)03X_r02 0DL]GIT8 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'P@P-X@X5H@H\?@F@M@R@ X @ $ ] fuO@9{z. 0Yt ~  @@P@X@H@@@@@ @     @@(H@;@H@^ @ m@ t@$@ @ @@@(@P@!@@ H@ X@ #d@ -P@ <`@ Fh@ Rp@d@ p|@ @ @ u@y@@I@ @ @g%.`@  6@ >`@G0@aT@ _@ krl@ |!@P#@7@ p3@@ @ @ (/@ ;DMY`gw~S@y@ @ @  $-6?@ HQZclu~j@Ek@00-@NX@-E@Q@P@0@#@ @' @/?@7N@`E`Y@"NS@!X@iC@p@ w@@@P9@U`V@O@%@Y*@`Y@]@h ,@K@f@0U@l @@ P^@Q@!2@+,-@1e@+@%@R N@V_ @dl@&@p<@ -@ M@ Z@PM@M@ 1@ @ob@",@$"@&.@k@: R@PS@ c@#'PQ@H24@a7@?>1@ ES@SPD@?["@_Pb@!g@ t0]@yR@4pc@@o@uQ@/p4@x`T@p @D@@ȁ@_@I@'3@- B@0D@R@/$p@_*@ :~@A\@9I@L@^?@e@y0/@j @3F@*_@ U@U@)0^@h@!@IJ@D@0,@ @ C@6" : @G@ `L@S @` 6@zf M@ls @Z@9z i@' @ !@# "@D @ @@  1@ @  @W @^@  R@ W@K 1@ W@Q b@  0@_ 0M@ `@'# `.@\) P @V1 ,@A @1Y `@s G@7 Z@" @% G@r 0R@ L@ @ 9@U X@J V@! D@0 _@o p @> @=@6 @ \@ t@1% 5@+ @: K@+P 1@Y `5@` 0@&u -@} d@  0S@ @ PR@. Q@ L@A .@N X@> 0i@ C@@ @,@! L@ @ F@m @  <@R @F@m2 p_@ 9 B@G@ V@H @YV @ ] @Ii D@ y @v 9@E h@d @ N@j 0!@ R@ 07@f b@] 0E@` @ p,@  D@ @ pM@' 7@#. pA@6 @1L @ a @C@Hf E@t @I~ @3@. M@ b@# Q@ @h@J h@" @ @ `B@b @ @ @Y@pS@G@DPX@.!0d@d08@R6 E@ Ed@N bT@n ,@ @"Pc@g@;,@ @q0J@@p@ j@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startfilefrag.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedwait.cwait_listrpc_child_exitrpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listprintf.cassert.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.cerrno.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrncpy.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cmemcpy.cmemset.cstring.cunlink.caccess.cposix_dir.clost_link.cfprintf.cjprintf.cread_indexstrtol.clibgcc2.cparse_pos_paramsputcharstrcpyinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileppb_from_argvstrtok_rlist_sizerpc_get_responseprintfstdoutlibrpc_rpc_handlerrpc_get_stringungetclist_pushsigemptysetrpc_get_intio_split_dirname__strtok_ratolget_parent_pidlio_seekgetenvlist_poperrnostrtoldisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorinit_waitpidputsrpc_send_string_responseislowertolowerrewinddirinit_execvfeofmallocremovelist_is_empty_assertrpcstrtoul__dso_handleitoaispunctreaddirjvprintfisspacefflushlist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3sigaddset__udivdi3setbufferabortprintf_putcisxdigitalarmmessage_handlerstrtolstrnlencreate_shared_memoryrenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroyatoffprintfkillinit_service_registerdirectory_createadd_intr_handlerinit_sync_messagesvprintf__deregister_frame_infochdiropen_shared_memory__dtor_end__fseekppb_is_validmemchrjprintf_putcstdinwaitsend_messageinit_envvars_startferrorsyscall_psignalstrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getstrtoksigfillsetinit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullinit_messagingfopen__bss_startmemsetmainftell__dtor_start__init_service_get_nameclearerrfclosegetenv_name_by_indexgetcharopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsncreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetccmdline_copy_argvstrtofatexitstrcspnrpc_get_dwordstderrsigismemberdirectory_closelibrpc_c_rpc_handlerfputcdivmod__ctor_start__ppb_copy_argvwait_child_addisdigitfwriteaccessdirectory_read_edatadestroy_process_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countsyscall_v_exitregister_message_handlertimer_registerstrlentoupper__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClasseslist_remove__register_frame_infoget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/e2fsck0000755000175200017520000507341711517101521016074 0ustar tyndurtyndurELF@@44 (@@TGTGTGTW@TW@x$6QtdSޜU={@t8vW@ҡW@ut hF@!{@ÐUth{@hF@dW@tt hdW@ЃÐQSP UWVS]  t&+vC3vSEE$D$1y$@?g")ċEt$|$ t$D$$PTW@=\W@s& \W@sBwҁ\W@rt$<$zá@$CX$ gCCÉ$)Ǎ")čt$|$t$$蔈oUWVSM}U t/u͉ȃ[^_Ê13 @BOtuv`EU։É3F3@3@3@Љ3 @Ku]EThf13 @BOuLU‹HBPBA9t HJÉJÍvU‹APBA9Pt QJÉHQJÐUWVS lj։9t Vىw,VW(e[^_ÐUWVSljӉ9t89t t [^_ÍvS[^_Ív1[^_ÐUME UtA$tQ(EA,f@A$u\@Q(EA,US]ًC[X[ÍvUEUP @$@@(\@@,@U P@@@ @0fUWVS }9u #t-[9tsu W }9u1ۉ؍e[^_ËW0t39u fv9tރvu W ufUWVS }u EF9uS9tӃsuW y9us؉F>~GF H u1X9t;J uY@ B C CދH tϋ@ e[^_fKy uI@ A C C90tH@ C 뭉؉0Z0Q9pt#B C |ԐUM9u 1҉f‹9u9tUM9u 1҉f‹B9u9tÍvUME P9uf‹9uËH9t;At f;HuA9u1ɉʉÉUME 9uv‹B9uËH9t;t f;uA9u1ɉʉÉUE@0ÐUE@ÐUE@ÐUUB;BUEM #vUEU P@@fUVSu v,V$Ãt&uP u SV@ e[^Ð1e[^ÍvUE@ÐUE@ÐUvUvUjtUP@@UEU ph@5@G5@hHjh@XT 5@h$jh@>T$B`fUu $uuh@5@Gj`vUS]C t0Ph|@Ph2@}X5@Qc߃]ÍvUWVS$hB@h:@YƃEPEPPPhD@VE tE V~Q1ۃ}ÃEPjjhu@h@m Eu1ۋ@u =|@t e[^_f5|@u싕Bp@;|~+@:BC@1f hP@+Ã8U S*ƒݱ@:BtBPhT@jPR)~XZhB@W6XƃtEPLPhf@VgDtE V"Pl@8^ S*v4@15@r SZYWSQ{5@jjh@}Q e[^_à S*1ۃ (t t@1됋OfA6f~y49rt9r;@aADt$|9u ܥ@10AP+A PR+QRw hX@|zHfA6 fA4)…qDtn|+A@9w[5@jjh@\P5@j R[%$&$-\tRh@y막);+q@E.t9 @5@jjhͯ@OL UWVS]C@E @@}fE fEm]mu9gjEPR#CeEƒ9u Zf @ K 1} ȃDN}EQ $@5@}fE fEm]mU܉)}@P|@)Pu Ph@5x 5@ @PP E$h@wMuS5@jjh*@N5@PkOtl 5@"K1e[^_Ðuh&@w믍vuv5@j|dOH SfUWVS ]E t4u4;W@~t@j$s S1e[^_Qs uuPh-@hVx1IQV1e[^_ÍvUtW@W@)E}P $$$c\fL$qUWVSQ1yEEP(Y5@蘎XZEPjَ9n EP."U`hjj5@Fhjj5@Fj3EƀEƀPjj=h |@ jj h|@$@轐$@豐Y[jE0PttEP E@<@DžpDžlfPhD@WVÃC7v EӍv$@ |@Pj5$@uN|@|@렋]Pj5$@S*냋EHtEHe|@@|@HV ]KK@@REPh@5$@P=HujEH]C th@u]K|@PEPh;@5$@<H5$@Sh`@5@=$U]Pj5$@SC wPEDžp] $@lLEH=E@\@RPh;@5$@D<HZ]  PRG P~] 5$@eC$UB B|@UBt$ BuUB]B\BQ|@F;{@tE]Ct |@j?5{@4Ct@C]5{@Pj4s0C]CXVjsSY Cl]EtRjlP- E8vDžxu@PjEP@$ƒE܀8u B 5@jjha@wGx||:Ӄj,SE܅#UB|j=S@t @@޿Z@,v@ L tH|` ux~ h@t$X@ h @jRXZEPh$X@Mfp |@=|@ h@ph 1hэA PAà @ߥfht&1fD :hS SNvjh+@Ã)y 5@] Ph@5@8 S `HXZjQ`@|@`,P`r`@,ty‹@, `A%H`ph@sn` h@<^_jhl@U`AD`BB DžP(D p@X`Xہ@,u@`Q A$Džd1fEt PVEPXd`r Srrƃ t ѥdGu`Y u AHԀLP`qh@Vq+ $+O   & PMQj`j`MI`@` |A`I\yLv.rh@h+rRhd@`$`A &OtDO:t&COCt) OP<t_COCu؃ `r^\A``@`A  `I `1芙`H@5@5@h5@5@4|@:] h+ SPhE@5@4j?Mv h@8`@P$R\B\EЉыR`UԋQd℉U؅u EԅhP`phD@5@I411 vF t/\tSW Ph@5@ 4F uGu5@j =7]WURXjjS`qq ƃ |h@QAe+t&<+tM uYE@ px @@QP`ph@MiX`ruRE t PJP P`B?@Pht@h(xDž|AHPDS`rE 1ۋE=P+p`H^M`r h@PrJ^_j`#tC\QMQXPRS`pp ƃ MI\Q\UЋA`%EԋAdE؅ Uԅ [v5@j+jh@=|@p j\EǀPSh@5@ 1x`qhܨ@PhT@`A\xxPj`qQ``B t @ 5@袂PEh@5@X0hئ@udXqhj@`f"RjxPQ`B D aE؅`B BMI1q`u ǂ q`A pEH ``@5`|@V5 |@P``BEHPHRP1\ `D X`F`y h`@2[`  uߒ`r h @Pr蜃XZj`uq h@jqsY[j`LWjjEpÃjjSDƒ S`@( hԩ@1 EPj`!PURj ``I^_jQ/ hL@l1BT u袑 DS`qEh@R0 h@0q߱@|@C hԪ@005@hjhl@95@jjh@8 5@j jh@8Y[5@j :$D{@4hC@jsv_XjuR]z h@0Ephհ@Rh@4XZju uA PEMh@uEph@5@h%@躀Y^jug|@/Q1=|@Pj` jRR jP?WjjjP|Qh@Ph<@*$jCQh!@P`q XZj`,PEPhQ"E@@1RPÃShج@`X5@4 jSutbWh@Ph@mr\L/Rhd@P`q<X`$@- h@-$@-`B uBPh9@_DžT  `% MaIAt9T`Auq h@g_`@,MAtT \B:t5`q h@_TƒT EPjjhu@h@`OT Et#E@t\B:Hu DžT\Adt`@ `i`@P$R`@ uo`X__` $@x$@xTeY[^_ɍaDžT*MR 0@FVh@P`r|Y[j`hO@`zp hW@v]TM` M`@8+pHM+H MX1Hgfff)á|@@1RV,$ @1RW,$$VQ\`X~\@gfff))RQVW\`TPLh@f\ H`htF h@+\1ۃ`hh@\C95@j/35@jDjh@2$>UB`\bPh@j`rzRpHj' h@<)$=5@j `3}ٲ@E1RP,$ @E1RP,$$uQ[`D@PRZ`\#@PRZ`$QG@PRZ`  j@PRwZ`,@PRPZ`(ɳ@PR)Z`<@M\ PRY`0)؃S@PRY`4"@PRY`8J@PRY`Hq@PR]Y$~@!'`@)؃@PR(Y`ArMAtI\@:uT\fB:\fB4`|\B@I \f`:ɺ@ze@;0@ @@@n@={@ [@4@@y@H@4@}@3uugfff<ؙ)<< )Rst P47Ct CE PECC t C E PػEC  S辻]ÐUWVS]3EFtwtsF@:ujCudCu^~vXG9~vJWV{tVEPFpvB BPjs tEf1e[^_Ë^EEHC\;A\t u͋S`⿋A`9uۋSd݋Ad9uˋC;AuË;ushyh묍vUWVSLljUEt>;M s9 ]SuEEE Sj W-Oe[^_fEt;uwe[^_ÐUWVS u}E EU UM YCCs({,Hw9UBM;Hs7PSj!uE @ ؍e[^_Ív1ۉ؍e[^_;HsăuUr0t[M A teU JZ9|9r1ډ1 tBM AE PjuuXRoPSj"uL1ҋM YtUBPqjuPRM A$QMA)ЋM QQPjRAUBPM qjuPRU B$ EUBPM qjuPRU B$MQE H~,1 @9uE HXHXUWVSEX{ KSLKXG)9~!י)vPh@BPu@M hɵ@BPQM h޵@BPQME$` jjj @E Kjjja@Eg Ksjj@EM Kjjj@E4 Ksjj@E K$Vs j-@E K Vjj=@E K(WjN@E KCPjj_@E BPjjn@ECLsXPqhj񺂶@EVF\MAt C9A({K;KUMKEuV}WjudEHe[^_fPrhj@EMAzi"G3fS$C 9tBEEUESURjuMIe[^_ÐSXv1{9}EEEQuVjuk}Ou}E@PEPj u;UJe[^_ÐEEq(uEW}WjQVEHHs(9t,EuRURj u{NsPBd@$N DžDžDž:FuMF9w9s'EEPEPjupFuUV9wBA(9s'UEPEPjuVuUFV;C wK(9w F9s vayDžuEVuf~t9PMQj6utfffFDž`VAH;tRfFf;F;C(v G0txǀO@:udxL ;0w0; @V0D Vj#uUAf`:IEPjjh%@h@E4 }ҁQЋMNY,}|9DA0}9 uXu:uXFKC\ A`4 @W Wj4Vs`HgC "SB\P1 v@FT(tW@Rj/u !ShjV臽h@Vju_ EEREPj2WQ|B0I]EQEPj1WdN|h S莞PuVj uHo S4GGLf9K3O{HD1u@ utDž P@Qj0uW}Gu Cf`:K  葪uF` h@Vu h@:t2W}Wj;utB`BBMAF? ff;z;zPh@CPu\ C WSmC CxffK1ы D9TDžPS&{vQDžWSht+C@ 9BG9{wCff;@K1ы @9,vBM|P,NtDžxWVj.uCfǀK@`(V}WjutB``BBMA%F 9iBBPhjV轸h@VjuuN yPTkVhŶ@ BPu$[u%@|Q@Rj uT(t3 FPL ;((;8M , @VpU}@@$Eĉ}EE@EfZE,r1D11҉¸WVSQ葟EԉU؋D,1qUEuVh5@$j0,N &Eh@@W0uE܃jfZDžTh@@V0u~(0(0hڶ@@Q0uc@4$0D@PfZ@PT@%=@Pj0 <M|T$EEEEs URj$P,| =Z+}t|DžRPW,A $k(DP@Rj$u $谣"EVj,<h0h8@Ph@AY0hh@Ph@&Y돐UU B u"0tL(u@uÍv1UMU A\+B\u Al+Blu+ÐUS]EE 9u'tA(D(Bu1[øA+[fUEE 9u"tRhPu91fA+ÐUEE 9t A+Ívt;EtQhuPA+UEE 9u!t%=@tJ+ÐA+1ÐUSEU u!C4C8C@CD]C4(M@C8N@C@tM@CDM@ǀPjhO@S2 jhN@SX9]USU ]E@xt"~U E[9U E[ov[ÐUWVS}] Pxt,EPRSWd4uUE@1e[^_ËO0tEPjʃ Wt׍vUWVS]u }EEEEG fGjV |GYXVsh话XZVs`褝Ctt VP萝Cdt VP|E CEE}u ]e[^_PUWVS lj֋ZCuCltPVh2Wu e[^_fCClh@vvWe[^_fUVSƉӋB@ 0u e[^ÍvPRh0VCtC` h@PsVe[^UWVSLÉ֋PdtVsd<e[^_Ð }W< CdPh@3BEtEEPWh$SK몍vUWVShEUϋEEPXutEPuqƃEEPWVuvEuoGEE]]É]EPEPh<ut_SWVubvEpQEPh=uVPEPh;ue[^_ÐUWVShE։ˋEUUMQ]EEEEEUBH9MAP H ڍDuUrxu PVu.E t1E EUQURhu Mae[^_Ív EpjEEUBBMU^ EEVMQRuEE] 11U BEEEUkvMQJujEPRQEڋMUEMAHujRPQEu\U1E1 tzuȉ}̉MPEpxMlPUrjuGyvPEPh#u덐REPh"u~D u蟛e[^_ËB@H !EF+WEPhu1Ub#fUVS]uEPjjh@h@!EPjjh@h@[#EPjjhI@h@["EP3btEEt@Et9jPu'Et;EsVu u3葧te[^ÐUVSP]CluBSt;C u3u8Ksh1)tuuF9s 9v1ۉ؍e[^ÐE;PwPEPu u蘋uՃEPu^su }1ۃ u萊륃;wjt!A9tMAЃU B‹M y%Ep1tM A@;A du}| gF;~r ;~Lu NANFu ȉ֙MyAEUA(Q,VQSu'u 1u FEuW6EpL;]UzBEUMA4Q8PQh+uuN؍e[^_fMq+N9]|9Ef1| 9JfEUM AQ1*fEfE 8 ]S`XZWEpx~Ur|Wuv|U BEr|PuhuE HDUҋE u ]SXZWUrxݍMA| WUr|qM A1ۃ}uuWPuvhp@' E PWEpxQЃ|Phѷ@2>4EEEPSh%uMIPuh-usU JPjjjWuvx~gVȃ|Phѷ@13EEEQSh%uuNE @1ۃUWVS<׉8EU 04EPuPite[^_QURju(k<|fUBE~E쉅@G%D]؋u܋<HAw9A1҉HL9UM94w 90^_wW O$UW4G8RWP<uJPURju;j$=|+e[^_ÍvXUM닍vjunHPEPjui=+뤐@E艅 (Dž,(,,9Lw(9Hw8@t'@$1 t<@f8H PTDžX)U8sjE(D Pj j( 8G,<9[B 2vKS<8;x t#PBPQ(K* KPS*\NjC 9t0B4B8PRhT{ <<9, <| +PPW(; " : SPhBU (L0Chh@S4葵aQhI ` t8Et2 C!u&C1vvQEu)Et#Whlw@@dA EEE SNGHm %=CMċ]ȃF4V8~0QVh aF4 G%=@tF8GlB4B8 U ;QuC@dteA"t_fyttXV4F8WVh tE GfGt@4@8vu e[^_fh;@ e[^_Ð4cf Al1҉¸I Ήuċ}ȅB1҉扅ډ9_G $RPWVy ʋ$ 11  B"X@vVh1m b DžfXEZ h;@j  e[^_WSh)Q $كۉ!ȉ!ڋʋ9w 9t B"[C;4D}@ B"mH*11 9w 9x2XPEPSVotPQhVEPuSWu!E~ EhQMujjEtVE;B s X u4n]쐃SpLZFHE싕97p,H! qLWFXZSvLFu E싽;8tEUy@EęUi щEċUȃ9)ډӋ19.`9X f  Pl\SE@P艻9w9~  iw;<@}@R9@:fPjVzt,\WjVB_EwA h&@jWS h;@j Q  PjG4G8PWh8SuK];t {QhA8Wj(t"Sh@ (BH DSXZVwx3vG|Vp|vVv,  9 {f Ph@vQRh9ؽ[8Rh:蟽[YRPh@8B4B8PRh%GI:mPh@.PjC4C8PSh8貼NPh?PhB>RhIjtlSh@+ +VrxStQPV PRhJݻ;PhK趻P|Phѷ@7DDžxDž|PSh%WaO<)щ+UWVSÉT5$}@ue[^_à j`X\hM@h5$}@5 }@ EP $}@~t11GƄ9=$}@~_ }@Eġ }@0ERPh@dPU d$STUkCtX\$}@ ` e[^_ÍvUSEPES\t pE@PjS҃t Q+]1]ÐUWVSdEPpMQ蜢D$νuF&B@\ t MA w扝 t1ۉ  t1|@|@Gas\C`VE`PhH@JDt;DžxDž|SDRh$u<MIe[^_QEhPhY@Dt;DžxDž|RDSh$uܷuNe[^_PEtPhm@DPExPh@ DDžxDž|PDQh%uO]KWShV3j2P]ǃDžxDž|PDPh$uӶUJe[^_Ë]ÈPSjuu"DAXLDžDžQh@u* h@]PS }@$}@XZj=D"E@u!BtǀJM9 S_DžDž4QEpxVWG$XW(1JDž PPh u)tUF9w(~/CSMqxyluSMqxmF9w(ыG$X@9GQh@B@Pu]XZju$Ը@cà EPMޑD$8DPDSh(uuNX3o_'oVDPh&PuvxNkG$TDž SQhV菳R]sxjt[G$4Dž VPhS&tUG$7G$4]sx kG$ G$tuvxj@X5VjjuBEEM EPhz@u]S\tpjjS҃F9P0 Dž@Up h@uVuPDS蹮E@wD=B+T4U/HTEfFfPF"\Ff~UC /O CHL  9vQЅtu ]@9wnЋfzf:PDQhu{]|Vh@VuS˝XPDVh6u2BfPDVhZu]UtfzuUtt %=t=@uj<(PCuPDSh\uxtN h@Vuu˜U.UZl uEplegXZuUr`UgWPRUxDFxDž|SDQh*kfuMq`fKQH11ۋ~pyq%=@SuAdufzt A! t0 ]CpuUrpCfuxTOLGXf=Hf'҃~9RDPhOu蠭 fdžGLGX h@PTHu8T %=@==V(11ۃ~GM@;P;PRqxwd{D(C Pt%= =` h,@觩 v(]36$胩 PfMx{{.;H MHA9ЋPfxunfx..uf ~au\QDShUu贫t@%@fU@PL hD@PVHuH x%=@=T= =`=| =C =UEF"FXt ELz\t MPs`t uT@"AXXuH\uP`u @h!$}@ }@E T WhRAuC$}@UB;$}@5EMAFlUEHQH@T%=@VDVhu觩 h@juu }jEp`amDEpj<(P= RDPh[uJ`@IC"DžUPЅfySDShu蕨Fh@VuuRuv``Exf;t PDVhu DE% Ft^u\C"=%y]EPEpxDf EEEEEeuDEUUShxW@juZ DumD E@t WDVhu  uUr`-_D $7PDVh'SĦK_azjEp`^BZfxuPu x(VDRh4uOj1tftSjuMo$@uuē PDPhuϥ Bh@Ruu"1ҍ82Xx)уPƒ9vn)9rhCCPS-8S t9 SËl)֍Nƒ9SuxDž|SVDVPuƤ_L#%=0 V%;P,3#ZY-DE跿DEA]HSDQh/uc h@SuuEuuvh[ juV薙 %=@jE Sjjj9jD Q蜧 ElPh@]3Dž8Dž<QVh$SKuEpt[U$f%=sT=kZY%A=[^%DžB%=QDSh5ufh@VuuP裹[^%u@%LUE?E uu~]t+ j{^ǃut+ jCYdžE-CCP DžDžFMUuq 9sCP xUtPC$Pjh@EWkVC$Ps(h@E)MIZPC$Pjh@EEǀUt PMǁ]C]K|t;Ct! DV舣 VhS!u 5 }@0Z }@XZjuBXZ_ZUB  Rr Mp]Shg@Ԏbfy1Fh@VuuFPDQh(fh@Puu誋f~gZ VW h@3Dž8Dž<WVh$S踝KDE2DE輸E(DEM4S{hV19TE8D[?fDE貸DE<], DE舸DEM<]|IsxDž|RMAWDPh]u脜%‰xDž|Pr^0UBxF0 DQ耠4$dDt#SDShNF hX@jusU|AhX@QjR7^0UBB GPDQh)5xDž|Ta h@QuuЈ%DžxDž|PDRh%EH@X{UE+E ÐUVSu] ;Cw";Cr} ~P5~@DRu 1e[^Ã6h}@jt@uU ;ɍvUWVS u ] Bv 1e[^_Ð;Rw|Qt{tCP@QPhW!Cs5~@JRC E6usXZuh}@iXPh@jW證0SPC[XVh}@it5XQhD@jW{UPC1e[^_Qh-@hWFÃtvCǃCRhuP+d SVh}@(lsPh@jW@ Puh}@k }@UWVS ֋CxCtoE9ptSC@ EU9SvOǃuSxt 9r C 9v EC$Pt 9rS(9r90ue[^_1e[^_ÐUVSƉӋH~Hte[^ÉIuSv|Pe[^ÍvUWVS]u} G EM Bv 1e[^_ÐREp|MOt߃U 2h}@gt0@E܍EPMqxju7t/e[^_ËU 2hĺ@jhR@k1xGtxSuPEpLuUBPwjM 1PRuUBPwjuPRqM܋E EEU PMqxOXZuEp0OUVSu E Bv 1e[^ÃRs| Nt-6h}@nft?H1e[^f6sxN j6ux1e[^6hĺ@jhc@!tUWVS8E|VK h~@hu@S|t!WVhuĕUJe[^_Sh@jh}@Te h@jh}@@ejh(@jh}@d jh@jh}@dM<$訙UB PEPESr<r |EEx[XWh}@Z@XuJTP9zpu2ApBph@BP3uwE[9tPh}@4Zu3hH@jh@&Wh@jh@ UVSuF@tfX PE؃uue[^DUVSuFtvX PD؃uue[^DUWVS]u {t7NtSF9t)‰[^_Ív[^_f9u)ދNtɸUM E9At1fAU ÐUWVSuh@PuV~wU$3EEE EUXt C@\Dž`1%=@ta== =`=m==fRURPV8G`jSBHuBdudffXt:S;Br;Br-SURh2V͇DžX`f\u2`u`FdtYuP@1e[^_%=@uREPhVQDž\`1e[^_fdeSBH%=%=uRuS臧1rfPURh V褆Dž``fh@RuVsvEEPURhVGu`GEE QEPhVZDž`]G\GtGfƅe`뒃RS詝;%=`u*vPSx%=zRSFR%EEPEPhDV,-fDžd`EEPEPhVHƅd`EEPS蜜&[vh@pWuVs$@jWuVpP軈Ut4$sp%=@PjuS t C@\ W,t=p%=Vhl@jjuSp u`v1Fe[^_DžXDž`1G%7-GPpPh#VXN뇋utI\> EPjjRSp =Z+tOpuEtQDžEEPpRh;VǂNDžpE랃vx; jS눐US] Bw4MA;Pr);Ps$RE px: j3u~v1]ÐUWVSÉh@tVRPpeh@VWSuo t WPe[^_ÍvUS]M CQ9t)Ћ]RPAPCPG]ÐUWVSE P(pMQj84$躅E@]ÄPSjuUDž8Ph@ BPup$ jju$u$4EEDžxX rL|MQ\t PjjQ҃ B@\ @W4PhH@ qL]8UBnEMQuz,E@Q,Jtƃ MQf,EzGtG,Q~W 1C ,9Y~BzuJ tr,ptBFtċBFC ,9YA(_ Dž011$F ,9Bzu}CECu C;C%{tUt C;CCuPMQh4u~0SVhR~MIe[^_f,JC8> f}t@ B8uꋍ,A 9_EUPMQh@ug~08PEPh5uG~0EECEEPURh7u~0EECEEPURh6u}00iSMQh8u}L,E`,B*GRVhP\}hd@rL $b8Y pL?,UBdt PMMAdUBtt P-MAt ]S(E\t!(Bd(qLUB  RP qEPhĻ@le[^_à SMjj C8 PVhu(|EHCQSh3u |` H@WSh3P{(Id BBfUWVSE @XU \M `][LdCދ[\t!}OHWDBGDQRjVӃ~\dp`2\UJXZB u FB,z0B BB8B<^'] {փPd\PDžl h,@gw `XuUB$>wMA=#+j \ds<@M ;A u v<@XFFF`Bf ] S`@N `u {v{v#VEPh<dBy#SqLi[F8DžhPH8BRg8;Džh00PuuSUB_u-$EMqA@@EPjM 1S[uFh0@dU 8fB \8fAA.A \DžxDžt* 8x.x с\dj2P臼dvhB@P81d]Q$fGǃ8uFUUWVS}7Fu+؍e[^_f WQZYu Vd>Ãu׋EE܋EEEEE}EPh<@jju V*] uP\Pu V=ÃrE@F`ERP\PV hQ@\Pu W4O 4UWVS]u} GEGt9~$|~U_ U tT~@1e[^_f|(9v$ԍEPEpx5T~@utGe[^_Ðv뤃~~EPjju6TuQuuuu uEEU [^PEpx juuG?@1vy Ur uGF+ERUrjP,UBPujuPR OfUWVS}u pu1ۉ؍e[^_fPtPVp;Ãu׃}t)}tTStPVp8Ã؍e[^_PjV+f}tPjV*fEPjV ,f}ZPjV+fMtvUWVSu>t ؍e[^_Ív EPcYXEPjj hԼ@jWiE tzU t=L+tEPEPh V^PjhV^t VNEPvxjWa EWEPh V^Rvuvht],E !EEPEPhVL^ juhԼ@jW E  Eb@REPhV^uvx1 juW#E$v`hAjWe u\uv`XZuvhjjuW EPjuWPt6EPEPh Vr])EQEPh VW]PuuW XugE tC EWEPh V]PjuV&Q juVQhj(P\)fDž(AG,|840fDžBjj(PWE쉅P(PuW3Et Ep@; juhԼ@jW-@E t E䃼@PjuVR jjV ju% ju%]vUWVS(]} 3EP`}PWh@dPv PWV]7Dž WdPV/? =&+tmEPEPhS[e[^_fjSuMfREPhSZe[^_PjWSv1e[^_Ð PH?.PEPhSzZujjSt EPEPhSEZp WdPV > vUWVShÉ׉M0uME]UR=^}XZEPh@jjWV uIMtbfPuWSM WSMtPEPhSYe[^_ÍvERURPShYf룍vEfUWVSdEsURGBE$|]UBVhX~@h@S۷EBUB E0 @W,]XZjUr`IjEph.UB uQ\~@t P趷\~@X~@t P藷X~@UB t% R|, UpEPhͼ@SHe[^_PWhuX u;GEPUrxjV聦@ Dž|˻@QWhuWEHUBj5X~@ZusIUB\tjjRЃ uLDžfuKÃE@w‹@\t"jRЃR3EphRtUDž1BW~)\~@& P豴DžދV5X~@{PEPVuI]rS5\~@ ]S5\~@*r R* jEPh@EEEQURhuUEHWEPhRtUXSWhPh\~@h@"EEEPEPhuUUJ{uPEPhuTt#uubEWURPuGu[VEPuGuAE;EUQURhuwT8MEK"fSEPhuBTPURhu(TPWhuTUJcuUrx1 XZuv0$ N"EPjjVF@ tDž|ܻ@SWhPuuVR@tlDž|@VWhfuHE@ uwEU*UE\ uRE hjSfDžAFU|fDžjjSVE쉅SjV)@t"Dž|p@jP(QjjucH jjU& jjEXZjUr`v _XjEphg Y[jv,[ NpvUWVSL]{t 1e[^_Ísܱ@u uV*V j3Ep uiPjEpp hu7UBB @@`ufcE@e[^_fCEPVhUr UQ믉EPVhUr ;QzUWVSu>wEP+:U$`UFsG,F\t,jjVЃGHLRh@PV@0OLFTDž8Dž4f1q(u)8F\t,8jVЃGvOAL 9Sv`FptSPwFltSP[PURSk MQSXf}44SjVq~<@HLt@X==h@0SV=Dž@ DP{SH0Te[^_@X5SVt <`PMQSy EPSfSvh+tf}vfEEf;Eh@0SV <]0UfEf9Bt EEPMQhV=MU‰EE0%=@PEPhVMfOC9| Bdž[,džYvlFlZvpFp8fQTeSMQhVxLu@XlU0fQh@QSV9Of$A!f}Ft h@P0SV6:0@ 1PDQhVK h@j0SV/fV:0%=@PjS<֞ Ph߼@wV;;4Dž4ZUVSƉˁt~%te uA;A ftlPSRVJC C$CCCCe[^ÍvA;At@뱐AQI$13C t`뗍vAQI$13C t,xAgA VC C$>C C$&fUWVSdUpMQ3|$QNuFEP\t@PjjQ҃ u9]4$M h@CPud9CX_Epx\9Dž0Dž4CpDž@HDž Epx^Urx QhuH]K ]Ce[^_ËBXK Mqx9)FX v0c9%FXK v0R9QZdDžDžDž DžDžtF$@Z;Z DžDžDžDžDžDžvjURMQEPB @`4;]Ett9w9vfEt9B$9t9Xt@9w B(9v9f t5;u C1 kEF1҉ MI@u t t V9B kJA9]C9SEpxuƃJSq0Pǃf3 EH2Dž0Dž4PShu=uNgfDžE`Y11P$fD NC9ZB$D 9t҉,Dž QQhu$=k`뀋F v,9pVBdDžN,DžDDž@tF$@DžDžDžDžDžDžDž@t+;uG;DF@C(s,C<@C0\ V\Džh)+Dž`vj,ETt TM`t `2 S&he[^_Ð,Q,PjRp@PhDž`NfDžhF+he[^_DžhF+Phܽ@h,2`,\`FXWV2hDžlDžhX+`fz"tB%= \sleQhjX*`0 󥋕\L`A fA"fAXZj,C`F,XDžl#,H֋rPQxRpudEQWEPjj'E싸 huDxQhRPuZu fSu PxPj,H)DžhW+Dž`DžlS}WV Wh`@,r0, \n,ƒVxPjW(DžhW+Dž`E PDž`)DžhF+Ei,@u|C8EDž`Ps0udEtCC Pj,-ADžhDžhU+B 1s0=EEEPh4@jj`q,6肋>0G1҉@DEU@@`w 18< J9@lt ,@tW`F 1s0C8s<0G,WEPjS.t\hhPxPjJPX\07h*, 0g,H,rPQ'fUWVSd]BxRUs h@ xCt s h@wM+e[^_Ë@un EP$*?Uuƃtx 3֥YXSWus jsf  u3|P`H낃 Pqs h@PsSXZjS1뭋Et0ƃ u@>U$LhuL=ƃu u,:uMA\t$EPEPj:S$BfH:JMA E@ fBfH:JE@ qhX@fUjtUÐUWVSlUXC`C\utZ uV~(EEUEƒtvHԀvSU+tKX+tCӉ؍e[^_Ívuu Px1fEÉ؍e[^_fELtP=<+>=C+=D+=V+ià Uj1ɋE؍e[^_ÍvC\uq{`Ea@PVju#?YPVju"tǃǃ1EC\taC`u[UB HtQPVju" Ex ,VPu"7UJK`H1ɋUvU1Ƀ jE1ۃ؍e[^_ËUUU@P`U@\PVju " Ep  h9;q9 h9;Y$KFUX ~ 1҉tftЪ Up F XEp8F$FE$\E3E3E3E$FUr.EPjjE@D eUE:1E<+PVj'u V+xUBK\`H{LuV 91RVj&uz 8C+PVj%uY D+STPVju3 fc:UHU^ j9/UWVSEXUR%$uFuUtKC\tER,WPu*t fFt e[^_ÃEPuv*uEuٺ@Dž @f}Wj1IQRje u;E  usT <։APEPj-u' Tlj󥋅0LƃBB  7* EW}Wj(u" ju6j uV,Pjt,EW}Wj)uBf`:JEǃBBfDžFu|@Q,WuR$uMYp1v(ÃQv,NF$f@XZSV^F@US] t4MQ;Bs;Bs$Ph@n]Ív1]ÐUE8@nUWVS(} E0EP Y[jh@jjjV EthB@WJÃh$@EPSV\lj$BEp h@nY[uV1wRh@Ph]@fEHe[^_ÐEPVUWh@Ph@軌fRh`@Ph@裌fVh@WhI@苌뒃 ucWh@5@h4@`dUE%=t<=@t;= t:=`t9=t8=t=ufff1fffffU1ÐUWVSdhB@ht@IEf u@PujPEPH] WuFt SFufj Vtj Vtj VtVu. uK@e[^_ÍvFt؃ Sumtu u@1e[^_ÍuBfUWVS } Ets`~@]1 9u~F])~UBP5`~@SWPRtʋMtMUtU:e[^_á`~@t P`~@1e[^_1˃ UBP7£`~@tMAVPjR&2Wh@jh@耉$LUWVSuU Et&BtX Xt ^ BF$؍e[^_ft2F$t=t{^ ؍e[^_fF  F$EtEtPEPjuURt< 1Ut BRP v W؍e[^_C낃 h ǃtbEXZjW돍vUWVS} WƃtSWjVe[^_fQuhR@SbXZSuōvUWVS4]ujEP tShe@aU BPhj@a ME +EU +B1RP,$50@Q$$h|@LaVB(EtShe@aVEPVR(Epx M +qy HXE +H$X(ȉRP,$x~]E؁ʉUЉMԉWEM +U+Q1QR,$50@P$$uuVSh@A` e[^_f4@wEE11딐UEtUWVSU싰VtWMESQRP,GM Ed~@h~@Al~@ Qd~@؍e[^_Ë^ t;Et^}9;t܍HI;8uÉ؍e[^_Ð1ۉ؍e[^_Å~t9t1f9}ڍ19t9tōR;8trى׃ v>t v7ZYPhO@^1ۃBUU Et@U1ÍvUU Et@U1ÍvUWVSExt6BEBEMjSQWREpQ @t e[^_Ð Epj[^Ph8@ ^e[^_fUU EtUP‹E[1ÍvUU EtUP‹E+1ÍvUWVSEu 1e[^_Ëu tCU RUt׋M yWRPEPDUMU؉M܋U؃ t~M Ap~@t~@Bx~@WVsEPZEUM AQu&Xup~@e[^_ËE ;FRCC BM 1 sZYPhJ@\1vUS] Ct P]]vUVSEha@j P"StERP?LEUFV e[^ÍvUWVSluXC9} }ԋEE܉E؋{tUԉKe[^_Ív3SUvU} M;| FEEMI E };D9w"zUvB܍ 9E wMu1ɋUʋM 9 toF;u~eCfNuM<wu M;u=v C@SUPREt*Cf1SF} :EBBe[^_Ëh e[^_Qhs@jVhE@@XZEP6肋tE]EEPjjh@h@,JEPjjh@h@KEPjjh@h@J }EjPEt9 }1у?QEtcUB]S@hP޶Suh@MqJZ}w $jTjjw4GSEHt E UBRh@@PVMA@ vUS]tnPt R`"Pt! ROXp@E PEǃ]ÐUWVSEtE 9tJU 9u Ɖ[^_Å~@t:9t619}+99t9t;E t9E rӉ1[^_ÉfUEfUVS]u ;} B[^1ɉ[^UWVS,EtM9 UUԍU} M9|FE؉ÅRM؍ E }9DrzUBč9E wKu1MԉM܋U 9tMFM9|;Nu؋}}wu؃m9|f1ҋ}U܍FU E܉MH@Ph@Qu}܉Ge[^_Ð UPREt}E e[^_ǀǀdRh@hPUV UWVS}td~41fCt CE P蒾ECF9ЋE PfELJLJLJe[^_ÐU|~@U|~@ÐUE@2@@2@fUWVS } UB\C}~:]1FUB ;utGUBSjWRPE tًE e[^_Ë5|~@tM u apVPWh@TT S jh\@S(tE E e[^_à u p PWh@TUWVS } UB\C}~<]1FUB ;utE UBSju RPǃt։e[^_Ë5|~@tx WoVPu h@zS S& jh\@SNtPjhi@S9u 1e[^_ËUBuju RP1t Wo Pu h<@S널USË`o@x9t*11 f9t@po@y1[`o@[ø`o@vUVSu ]Et p !X 1[^Ð[^ÍvUEyt @ U 1ÐÐUWVS$׋u#Z ]URSu Qhw@B Et w e[^_!w e[^_ÍvUWVS,}] Eԡ`X@t!9119t(AtX@uSh@Q1ۃ؍e[^_Í4`X@tՋV 91ۉ%PEE@t G]t G]Eu?FEGt$uG HPhe@ QU܀:V u~t WV FtSG@uV uUԃb1ۅF< u!tjWpV  fyV RuvWUÃ؍e[^_YGӃ%'E؋P@ V EjWV  PSh@]SPYXEPjh@Shw@?E tFh@jى9XZh@jى%YXh@jىXZh@jىYXh@h@ىXZh@hىYXh@hىXZh@hىV V YGW@Ph@NFtM؋I M<@QSPWj1 jjuuWOV WV EM؋A %PuRW$tkuU؃J M؋A A 1FF @%1}+/G`X@$B@2E؃H UWU1B(B,B0X_ÐUVS@E tƋ@uf e[^F t]SSvu4ՐUWVS Åxytmߍ4%fvGtB5@P%9tAGv5@jjh@#Àwf5@j^$@릍e[^_1эQqfUSÅu vREPQRSzu#E. u胵]Ív5@jjh@t"]Ã5@4@#]ÍvUWVS8] }EEu1tqދUBUԍv<@ti<%F<@><%61 f<@t<%t Bӊ2uPVRh @Ktu܃uFU܊B1ue[^_ÍFE܊Fp@t:th1B:t_p@uPh@/K맍FE܊VIt\D}tBHREp8p4h@"HjjujY[Ph@GtUJR EV^UB6EPE3;VUr8r4h@GSEp,p(h@Gqhh@oGAzQ Ph;@LGAPh;@2GPh@G%=@VAl1҉¸I RPh@FU%==@= =`n=N==#Rh @sFPh@VF%=@1Ph@+Fqph@FAxQAE UR@$AZYPh@EFA"t-SAt1҉¸I1:@a1qh@Eqh@nEAl% h@QE h@^u.] sHMQ9Ef{ MUJEx~UB X( jEMA\ u诸dvRWPh@>]} u~$ h9;YU h@hh@h@h@=j5t@+Ef{ EP\ u u h@ Xu·Xu蹷UWS ]U1׫1ɉDžuE@ECDCe[_ÍvPhH@<CDCe[_UWVS,]u1C Hu! pF@CD1e[^_Ív1ɉDžt+E@ECD SPZs,e[^_fDžu믐UWVS }] ;s e[^_ËE؉E;GwMtXwE9^t|9rDFut8Ƌ9r;^r$9EvU;Vv9wU;Vs 9Eu‰1댸1 j iUPpUt*UB1OVt E;wt UV12G1(E뜋BFBF R.1UWVS uFtX P؃u1ue[^_UWj &t1׫EE BЋ}Ív1҉Ћ}ÐUWVS֋XXS J1J1ЋJ!ЍS9u9t 9p u[^_1[^_ÐUS]U Et +X1[ÐUWVS ExX~41_ 9tAB Q 9uF97΍e[^_ÍvUWVS }u OXt4 h@hh@h@h@q9j5t@M ~@0ϥGXFue_X31ҐBuS P营C_XStx~1fSC@A9u1e[^_à h@hh@h@h@8j5t@be[^_1e S诡GXfU5~@苡~@X5~@u~@fUj觤t+~@ j苤t ~@1~@~@ 5~@~@UWVS ]U E-…t+B~fZ1e[^_à ~@0ƃtKXE F }_XS J} 1Je 3E J!CrF0f1e[^_ø뎍vUWVS }wXtv~S1vC9~GF;t h@hh@h@h@6j5t@C9 vџ4$ɟGXe[^_ÐUWVSEp 8t>1Ef\t;MtU֋ΉXEA9u݋EU[^_EEU[^_fUEt@ÐUE@ÐUVS]C;s(s Lu%@ Lu@C9w1҉[^ËE tE C@C[^ÐUWVSÉU΋S9s')|Tu^C @Ue[^_ÍzdS UPRtEC {)}1e[^_fS QP2PDPfUWVSƉUMu1҉Ѓ[^_Ív@ tE܉OeE܅V U؋M9 F;EM؍]9AEfx9}9}EU؋ ‹9Msr+EP $}fE fEm]mEE]؋ ;M9Mr@E뒍v]9^vU[^_IZ9]v 뇍v먋E)1RP,$)1RS,$^F1E]E;FrEU;Vs4}O@FV wE܅jF E@FXM?US]1ɅU Et X1Z[Ív%F+Z[US]1ɋU EtPtJPt1Y[fG+Y[ÍvUS]U EtPBPt1[[ÍvF+[[ÍvUS]1ɋU Eet @1Z[f1Z[US]t3K t C E PPEC  S6]fUWVS(jlÃtW1߫ut;E4C V=Eu7 SfF+e[^_ffĐF+e[^_ÍvC 1CE 1e[^_ÐUE@U +BÍvUWVSljUffE%fEEK~34E0 w E  A0I w>Ju<~t?K~}fMD8~D80fef MEf[^_9tǀ<~u}9uGETJ}9u70Ktω֊E0 vރtt*1D;~fM넊E@뙊rE$ Sd$alDžhu]EPu'YE9t׉EuS`Eu~C\t t)1tdSHEfhuۅh @ۅlٝpمp$h;@SJ18hS EPhSlZPEPhST,hSXZdSt PǃC t" SF pEPhP@ e[^_ÃhSWYuj&딅t؃jSVpE$EPa&tEPEPhSs뉃 %lDždUWVS ]uE 8U U9~=PMAMAPWuXU Btce[^_f}^ M q E XZSU Bpx> jSu"M E @ e[^_Ð1e[^_f9[fUWVS ]uEx8] C;PvC#+e[^_Ëu ME BSuRu}Wu FEPMA]`t]E9} ]]CfvE9}sB9tM I uU B9BU BM Q@AZ A u FBv BPRUBPQCPubWM A u]{9}f1e[^_fȉ @PrJu FFs:u F#+{. ~f{..] C$u~WBEx?VWjQ荘MQ]fSM AU塈~@U~@ÐUt<#t <;ÍvÐUStF"tAHfQCt,I"t$\uCnt#ttbuACu[A A fUVS]u `ʪe[^Á;`ʪt `ʪe[^ËU tPEtX1 j(wƒt< `ʪXE B EBCBrB B$E1뎸`ʪ뇸뀋E t뚍vUS]tt8 `ʪt]Ív P蛅]ÐUVSƁ8`ʪte[^Ë@t PfFt PSFtX؅u V+e[^ÐUSË@tCt P S]ÍvUVSut>`ʪt[^ËFtX؅uu[^饄UVSƅt+t P臄Cu Vqe[^ÍvUE E EE+vUWVSƉUMj$耇Ãt& 1 VbCuue[^_ËMt u2Ct`ʪE1e[^_ÍvUWVSÉ׉΁8`ʪt`ʪȍe[^_Ë@t`ʪCEEUBU܅tzEWUr6~ڍMuES BP `EXU܉P UPtB u܅t*EU܉B]WEUJE떋ECEUVSv S߀uFte[^USÊu vCt P虀u؋]ÍvUWVSÉBPu ;[u f;u 1҉Ѝe[^_1эD 9sP t uH9rXNJu[t}tj=WÅu:`ʪ늋Ft*tF@FN1j`ʪ`FH9t?"LG}܉CNJ"dtmj*uÅt FVR1ɋU]ƒtFHFV8{`ʪ{,j*uZ FURًUEH1҃BX봋V~x `ʪ%1GMjU8t@{8L} FURًU61҃GDE؃j]P膎DžE؀8"O P}t;}wE؀8F E8`ʪt `ʪHEXt*E؅tus>uCth[uփ FP1ɋU؋EuƒG*u FHGp`ʪ@ESCu^[tE؅tus裍uCt[uUWVS,Ë@ u{t1e[^_ÍvU׫M1ҸX@Džu@hB@s`tyC uxVhPStYUƅt~@t QuVsЃ -=@fEC vUWVSEUM8u `ʪ؍e[^_Á? `ʪuGE܅W ӅM܅M܋A;GgG$EG 1ۅtvwSt%[t>tVs‹uGuԨtCtЋEM[uG$M܋AE܉GG _ EuE܅pG fEÅt WJM܉O믁:`ʪt`ʪvC5G$SW EtUEtCME'CU1GE܉‹@GRG EOM؋t^Zt&E0Vs茊uCt[uߋU܋RU܉WCtOEڋM؋E utˋMGRӉW ?E-8`ʪ`ʪE܋@G uBEt UEt MEtE1i1b uOfUWVS(u MEP1ҋEÃt:U 1Q}tguPo}tFUtZ 1Qw}UuJt# 6 z؍e[^_Ð؍e[^_ÐE؍e[^_ÃuPiUVS UMUUEuVjURPÃt ؍e[^Ív EP11҉Ãu EtU  V|؍e[^û`ʪUW}tnEPuMU W5Uv[u9}tX 1Q+|Ut#uP1҃Ћ}ÍvUU뵺Ћ}ËEE롋E1͍vUWVS]txEPuMU Ǎ5UvQuAuEA@1f@Ct<VPnuEfe[^_fUE1e[^_øt+EPuMU Í5Uvt؍e[^_Ív>1ۉ؍e[^_ËU:u`ʪ@Pj EPR贎ƒu @uϋEE1}ыE܍|;}uUWVS]}u>t+EPuMU Í5Uvt؍e[^_Ív>1ۉ؍e[^_ËU:u`ʪ@Pj EPR~v @uɋEE1}ыE܍|;}ufUWVSuEEh+u;u| VUЃRu{EQVuuE0UEuoE̅tLE@EċÙzt<j u蔃E̅u1}эqp1EEUB utá~@tRuSUrЃ ustUBOE뺐UWVSEUjwÃ1߫`ʪ}֋E8~tqE VEwǃMuPXZE@PW4{5@W菂uLM1e[^_Ívx/u h_@ѕEu1эt^ƅt(fe[^_ÐPVuW`5@nvUWVSx]jIvEE@`ʪU:E]E uEEEE upXt)f Ppu -t_u_Guۃ 1ً}҉ىэ P\uÃVuhd@P XZEPS贱xE%p= t SqAU9U~EU@E'E MPux5Eċ}t"hk@juup{ME uuUUutsM]}UƃtEUECuыMYƃttEMEEEt E8UZ Re[^_Ë5@6 taUZ5@S8u%}\ unE뿋E u5e[^_ËEX}e[^_EEUTًBI9M|zG _,EӐUvUWVS(ƉUMjfÃ1߫+t{sECt*1w SbF+e[^_Ív PeEtʉC u܅t9KNjuE1e[^_f |vF+e[^_ËK{ 1UVS]u K SCVuCBȍe[^ÐUvUE 11UE 11US] UxCEP3qt&CPjuuuEU ]ð]ÐK;K}KCUACREp0v]uӋUBPsjuPRtC렍EPjju]uUWVS} utKUB;Hre[^_Ð;Hrx-SjQue[^_Ð1e[^_Ë] C 9C}U BӋR @C벃 C SUPRfEuE h @F+eC먍vUWVS];+s0EEEE j(cqE܋M1 sbEQsjPpEXZuVh@@jjjSCǃ }E tQVu 0ǃVh@jjjSǃu}PTVjSǃugC`d\`uC``EؙRPVSkcECX VjS|ǃvF+ uh^E^uX^e[^_ÍvF+e[^_ÿ+ݿ(+փ jJ jYUuuu h+uVfUuuu h +u`VfUuuu h+uUfUuuu h +uUfUu uh9+h +y[ÍvUu uh8+h+Y[ÍvUuu uh+OVÐUuu uh +3VÐUUvUUvUuu h3+h+uSUuu h4+h +uSUS];+t +]C<|:@SJuju CB DPBHPQSh+V ]fUM9+t+A<|:@Quju AB(P2jQh +gV fUSvUWvUYvU{YUSU] CEU [vUWVS,E܉U؉Mԋ]pCtp1CttCk+e[^_U܋usS e[^_Ðu Q;Bs;Bs4C5+e[^_ÐQs(uujjuPSǃ sRsPQmCt됋CEC_EEECS ;uQs(EPU2s sEP3S E tÃCUtt3Ck+}tRsE03 mCtCCCU됅EEEfECS ;utăEEtQs(uU2s sP3S E  EdPs(uujju3S ǃ DE1UWVSE viIẺEUEu9}u,PujjjjEPuU { E*DRujjjjDPQU EEk+fV Pu uMpDžR+ x}W 1 EԋU؉É֋}܅})fE+9EEEQujjVSWuU Et tjE1RPVSu<E tvUU |}W 1) XEtfu^MQ;Bs ;BE7+aEk+ uAN uQFÙEUzPujjjjEPRUƋE UUEPMQju`+E[bWuPQqcEtMĉUDž Dž};t2 UW t ƋU Ek+ ÉDž 1DžEUG9ttك UMQ KDž 1?tPuuuaEtEtE uWujjjjEPuU ƃ vU EEEEEPh<@uEPu uÐUWVSu} EEuU(BE$t M$EYEXUB"E,` PdQIEw vrE(1҃9UzX}'EPtbDž _+1Dž$_v&UL(U( B 1҉UM( Au EDž 1Dž$PEPu u> 0jM(q1WVu7 Dž$ v1ۋEt Pz= u=$ut/$RPuu?P uu ui  e[^_fDž$눋M(UMT(Dž Dž$T  L>)ɉȃw9F)ËEx`}40MY01ƋE814Dž$UBPujWPR 4M<Uup8tg4tMTUEPEMAPRQ{ uTE苕<MAPujWPR u)$}j5Dž _+1vDž F+ e[^_ËEx\}wދUZ1(U,Dž$UBPujWPR u(M@Uux,to(tMTUEPEMAPRQK  E苕@MAPujWPR $}UBPujWPR 1qM MEztULMEPEUBPQR{ PEMAPujWDžPPSu ui a]{PWVu+_=+ Dž$Dž$MAPujWPR tU4UuiEtctMTUEPEMAPRQd 9EUBPujWPR $E1ҋM(QDž 1FMT(PEMQ\UEPuRu EUB`0NjMY01ƋU814Dž$EjMQXUEPuRuM TEUB\މNjMYE,;1(Dž$=EPuRu EMD(UE(@1Dž$4MQTUEPuRu EUBXDžDž _+Dž$1M(Q E~EPuuu [jE1RPWVu0 4Puu u9f UE(@Dž$fSEPju E؋U9w09();M1EUԋM(QM$EM$ EUMAPujWPR 111Dž$Dž$UBPujWPR 1M4Mul8tctULMEPEUBPQR\ 1EMAPujWPR $uUBPujVPR 01M MEtULMEPEUBPQR cEMAPujV%Dž$112ME UBPujWME UBPujVvUS EPjE1RPuuuu u0u UMv K]Ív] ]ÐUWVS,}GPU؋p?+tE+Eԍe[^_QEPh@WrEԃuۋW51ۍvPuSW C9_wGNuEWBau&J ]ى]؋Z]H9E E؍LM܋uG$09]9]Su=Su~>G$\09]9]Su=Su?>G$T09UwAO(D 9Er5~Q1fSu >F9w(~4CSu:=tE+ uEԍe[^_EG;EfRJUE+E+붐UVSӅt&ușƉtt1Z[^øZ[^UE@@du fE uE uպE yÍvUWVSEPJZ E ȉEB`uuFH;E u u^EZYEURU܋zr` EeEљEE 1uǃtM;EE1ɋuV(EtuE0EtuE0utEMtM9)ӍCe[^_fE]KEE2uv EuFH;E B)1fuFu+]1Lvv EH9/1}U KEvUE@PLu@L@T f@XfUWVS<}?+t+؍e[^_ËOfA:fEƋQ`UȋG`M؉C0]fCZG$Efc:S`ЃC`O MЋw1 vF9w]SEPURMQVWwGut MuMt$tuGPuuQPRÃu-]tGHUWURjSPQÃhGfUfP:؍e[^_ËG +u@N t/F1 vB 9t9u9xuUPF1[^_øN+[^_ø +fUSM] QC9t)‰[Ð9uA+CUE@ ÐUUM : +u&B ttR @1fj+ø +fUU: +uB t HB 1Ívj+ø +fUS]E tPj s sy@C]f@ڐUWVS u> +t +e[^_ËNt:V t)11 vG 9~ vPuFPvU t1e[^_ÃjV[fUS]; +t +]ËC9C rD=wmdCSU@PR <EukdF+]ÉCC @S@C EBE EBC1]ÐfUWVSE։M܁8+t+e[^_ËM  jO8Ã1߫ +ECsU܉S t1 vN I4V7Et1C}tpNjuu tkU 1e[^_fF+ SZ4e[^_ÐCPu,XZuՋKL K[F+E뎋EXL1뒋UBL8 +1qUVSuN VF]SvuUFBE ȍe[^US] EPj11ҋELuUBt]ËMQL]ÐUS$]; +t +؋]fEE EEu^ Cpn6tBEEEEEEREPh@SXu2u]؋]ûF+녋EEEEEEEQEPh@SUÃfUSM ]CSjjARPQuy t1{]1]ÐUWVS }uGPVju PRÃu2t>9s%vfAQfu,vА9wމ؍e[^_û#+҃vu9sʉл#+Ujuu uZUEPJEEEUIfUjuu uUWVSEˉ Љ ƋEE9~UM1%v}9ʁx0t8A;MtBuU uЋ}9ʁyJBuˍvMA;MuUJxHx 3Hu[^_ÉِUWVS`UuE#EgE艫EܺEvT2tL @uvEY+e[^_$@EMM MujMċUEEEUUMĉMEȉEỦU}Ћ]M1XZfGaE1‰E1щU111ӁwuUEM Emu8EWEu -7+FRЍ1ىM}EuGEEE EujMċUEUUMMUUE1#E3Euu3E!1]ˋE1!3EMM1!1 Uԉ1!1u؉1!1]܉1!1M1!1 EȍyZ!‰1!EЍyZ!Ɖ1!E؍yZ!É1!EyZ!1!EčyZ!‰1!E̍yZ!Ɖ1!EԍyZ!É1!1E܍yZ!!EЍn1En11E̍n11E܍n11Eȍn11E؍n11Ečn11Eԍn11UUMUU]MMuum E ^_]EUM]tU1e[^_E@EEF-1뭋UE륍}EEUU널UVSu]MU BEEEM] u [^vUWVSEU| ЃERU rM 1uu FEEEE@E܋M9MvU Ju1Cf}E49uC9uE @Eبu V Fu9unPQuuSVE 0҃ }Et$SfKMy;E3u vu؋E4MIM܋E9EEt[C 9tM}9sBU RUff9~$ECfujUzv^99t9rɉuM9M1ۋUtPu vE 0ugFut|e[^_Ѓ~uC9fE49u\U B#+e[^_Ëu‰U[1념UVS u>+t+؍e[^Ívu VJÃuߋE EEEMuk vU,tOEEEEEEEPh,@jju VÃu(s]kF+aEEEEEEEEPh,@jju VSà U EEEEEPh@uuu uÐUVSu؄t@11ҍvD21B9uFuFttU 3 Hu[^1ҍvUE@Puju PRÍvUS]CPuju PRuK]UWVS } ]UB9x;xr} Ep*tpEPSWudƃu%ECCutUQSWu[ƃUt u'e[^_ÍvZ+e[^_ÐF+e[^_EzUEf8 u Hf9HwU 9}w+ÍB9|1ÐUWVS];+t+[^_Ív 1} sCEt7H ts+M EPM Q@A )Ѝ@AE pCU BBBB B$B(B,1[^_Ë} 땐UVSPu4HQZLuRp pQ=e[^ÍvRXfHt @@X4jvPSe[^UVSu]>+F@Nt}VҋL to;Vt*SA1fACfA 41[^fCSA1fACtC=w)-fAC=wfA뱸+본+문+른+UWVS,E8+UJJE EREE؃Efҍ<} t0}t*} tP}tJ}P} v^+e[^_ÐE9PlGaGE } uEP;P]GRE 듐E$@UBϋGG G W G 6p BG w GPMAUB;BF1҉¸N1ڋMQEH@ G GF )ȋUBGtMI}}MQ;QEHUB;B|+EB@G G G*G uE G E܅UB;B_$G$u Bp%EG$E܋HUB@ P;Vpj33MA3ApV=ZYNKK FCG E܋@ CC} I4s C UB;B}C$G eE ?GH9G E )vF1҉¸N1ڋMQAA FAA=-AAw 1fEP;PGUBHMA$w } t }-G!G W B;Wpw W MA;AGw 7 PB3jQRPE+e[^_à s CHC CGWCS+|+E+}+~+F+vUVS u>+F@VFS C uVBC CHCt-‹fPKu VtOvaÉ؍e[^fC Ft&E tH1Q@PB PR+K f1Ff@륻+맻+렻+PEPj VÃuu VV NA )BAXLu,Pv vQ6à juvf/@XUWVS0ẺUȋu} EPjuEЃ7ŰB;EU+B;Eu5M]9PEPjuPEЄ+fEЍe[^_ÐPEPju)=|+t;M]11 t!9w3r9w-PURjuuuSEPj uu^ŰBKvr9WE19aw9WPURju=|+uEЄ+EЍe[^_ÉEЋEЍe[^_EЁ+EЍe[^_=|+vUEU MUM 1nfUWVS,Eȁ8+'UȋB@MȋQAC PEPjQu}UȋBCH9C tyM]11 Eȋ@EЋUȋRŰE)Eu}RMQjuuBEEȋ@~8M̍ɋMЋDH;D u$QMQj urfe[^_PWVue[^_ø+e[^_ø+θ+ǍvUWVSÁ8+%@@"sQEPjSƃt e[^_fEPS~XZuUM)ʉUE܋UptsJSDžxDž|1щMA t}UUfBfEEE}+EEt uaE3 uHe[^_Ív+e[^_þ++fz CHPKL}EK ɍ HljE: CpE| xu=CpCH1v(NJtt !~ ~xDž|EPuxs蘭ƃ}uEufFCP fV uvuF+E@D VRPQ(E@ dC@PujuPRƃ GCEU)B)B MAufFƅdhDžlEPURjSƃhlE܉UUUEC@+E܉EWMQjSƃtpUƃlS KA BAPLPs sQ/ƃ3fF+zS D;D}DžxDž|PURj Sƃ&EԋU؉x|ƅtpUƃSs 'KA }uUSBBHB C@CMfAuuUVuVj Sd+})} VjS%ƃhlU܉MMME}QuVjSƃ*@XifUVSu>+F@VFC;C|KE t+؍e[^ÍvaÅtjV؍e[^ËF^ C E t K S C xQD@PRB P4" C C@CfAPujVÃumÅdF+<+2Q 눻+#vUWVSE UX\]uPTu>+aUB@e]SMuNECx|T PuDuFuɋDoSE؉+t e[^fN9tt BRP Nt AQP F t F E P EF Ft FE P EFFTt FTE P EFTF$t F$E P[ EF$F0t P>F,t P7FHt PFHFLt PtiCHCu^tE P EKt CE P ECC S  Vu e[^ÐUu +f-+w1UE@ÐUE@ ÐUUE 9tÐE9BrEtB MEB 1ÍvEÍvUWVSMy _AQU9w(9s$)ƋI9sCF;]vZ[^_ÍvUWVSu} EE9~w>D;F w5E~%1ۉ+NىV C;]uY[^_ÍvFE} E.+[[^_fUWVSu} EE9~w:D;F w1E~#1ۉ+NىVC;]uX[^_ÐFE} E-+X[^_鎷fUSME Ut9u9Qw ]D;Av G+]ÐQ؃QPuR31]ÐUSME Ut9u9Qw ]D;Av G+]Ð؃QSPRu1]ÐUS]uC+C@RPjsE]ÐUWVSE]tU9t e[^_fz ;} rxBEU9UUB)EmuFU)‰X9t+UBESP EUB9r}U EP UP1e[^_ËURUu 9wI9vEH+X؃ NK9rU9UTU EP 1e[^_É9r*)QSjV&mF+UWS}j<Ã8E CECEC EC+ +tOC=+}tQ 1}QE S*F+e[_ÍvC0+}ufCC+Cx W<EueCE PEC$F+e[_fC-+@F+e[_ÉCuP|CM tRWu P(E$17PWjsUEu pppp pp0oÐUujuuu ujh +IÍvUMU At Puh4@QRj袹 Ðuh@@QRj艹UME Q9w;A vRPjQ1Ív)ЋI ÍvUWVS u} 9~w8UD;Fw,~D1C;]t:;PVt1e[^_QvWh/+ݲ1e[^_øe[^_ÍvUME Q9w;A vRPjQ1҃Ð)ЉA҉fUME Q9w;A vRPjQ1҃Ð)ЉA҉fUS]u`Ct CE P;ECKt CE PEC S]fUWVS]Mt U;Et Ee[^_Åt;uB;Ct E e[^_ÉыR ;S u)lj}qC9ɉuЃe+u9r,vVuEXZVS9EuFE9p s1xUWVS,Ɖ׉9u] j{t0EUt7ݱ@MffEEЍe[^_ÐEF+EЍe[^_fj;@ǐu1 jtωEU...EEЍe[^_ËUxȉMEEEEPh|@u jWVEЃ u MMЅtEM PD+uT v]ÃtPE9E t,QuSj MU Ɖ$e[^fEˍv+e[^fF+e[^fUWVS]CE<tqM;t 1e[^_f E@P‰Et1}GVCPCPR SGe[^_ËE@ F+뚍sܱ@׉uUBhUSjQRP(xPjEPS]5]Ð1]ÐUWVSdju5ǃ#EPW=uE%p= EEEEvEUEUEUUM9uݐEU9U|[~Q11ɉEUE RPuu M1f W3/؃e[^_f9EsvEUEUӉ1ډt ]uVf]uI@e[^_û끋Eؙ} U1nUWVSU] u}B@dtC"uB C1[^_ÍvCtEEEU¸EUC1EUu}USEU1fCt1[^_UWVSU] u}B@dtC"uB )C1[^_ÍvCtEEEU¸EUC1EU)u}USEU1fCt1[^_UWVSU} ]uB@dtG"uB G1[^_Ð_1f_t1[^_ÐUEt8 +t1f@ÍvUWVS,ÉỦϋ@ t9tzK s9rC1Nd9s΋SUPRECsK )u)4C C@ỦC e[^_ÍvC4QR0RD0Pf1RQ,$C1RP,$CD1RP,$}fE޴ fEm}mދE!f1e[^_fUWVSE։Mu1҉Ѓ[^_Ív@E܅txUJ 9tUB9r B1M܍923Ex OxyE vz;}|l9}U]܋ Ӌ9sw+EP $}fE fEm]mEM ]܋99rBUE]MfE[^_v9v 냋U멍v)1RP,$)1RS,$@Eu@;@E(@BUBʋ]Su@]Ci]K TvUWVSEEljUM@(u*U…EB1e[^_Ð]t5UUEjuuVSP誁 u1e[^_ÐRVSP|t w(MH`+e[^_øF+fUWVSljUM܋P(t@]EVSRP)uU tC]܉ R1e[^_fU1u:Ee[^_ËE w(G`+e[^_Ë@U܉1UWVS ]; +t +e[^_ÐC ;Cv%WhE@hP@u VG+e[^_ÃvI1G9{ vSL9rVPWQGPhE@hx@u VG+ 1sfUS]Ct CE PECCt P荙Ct PzC(t PUC$t P!Xs$; S/]ÍvUWVS(ÉUMj,VE 1}PEPjSƃuNEu,E@U +CB}e[^_fPEPjS4tljƍv ue[^_þF+e[^_ÐUWVS]t'; +tE +Ee[^_fC9EsEMU EEuӋEuEFNt11w#F+ u }Ee[^_f MQEtĉFExM1uF Ft K t[~1ҍvӉB9uN E0Ee[^_ÃEPu,ǃQuEPQ"VUujuu uÐUWVSLMUEƅt e[^_Ð 1} у?Q ǃEHYhAi Aj Ak É]QlAm fEQnAo fEApQq fUArEfAvfE EPEPEPEPEPEPPREPEPSh@]S@Su hb@W诉<$g9E]{$$jTjjWdC( E@(t= u$EUe[^_þF+ ue[^_Ë5@ u#UVS]u Etr;swm; +t +e[^ÐftYfȉ9t F+e[^ÐVsTCtGVP1e[^øG+뙃VsCtVP 1o1hVsCu1ɉ1@UVSu] > +t;^v G+e[^ÐSvtEf1e[^ËFtSPou UffMډE=vUf1e[^ø +|UVS]u ; +t;sv G+e[^ÐVstztF+e[^ÍvEVsCt VPYUtTE=vUf1e[^ø +kCu,MMAMtl18VP.uÃVsMtҋEf1fUVS]u ;s; +t +e[^ÐVsCtVPMEHM;}EuCt VPI]tpE=wUUf1TVsCtJVPEt/Ef1vG+e[^ø뤸F+11ɉ붃VskFUE@ t1Ð@Puju PRÐUE@ t!P;tRpju`1ÐPBuju RPÐUSEt(A ~11ҋAC„9Y A1[fUEt8+tËU P8UP+t+ [^_Ð~}G,u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS uM ]EEUU>+t+ [^_Ð~}G0u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS E8+t+e[^_ÐM UBP$ 1} QEu uTM9tx] tM?tFj&SDžtGj=S…tBPMARSQP$ƃt ue[^_þF+"1ھG+1 UWVSTEPuTu Ep 1hB@h@|KƃRPhSJPVhSsJj Stj StuSt&tEPSuEpu9}u VBE uh@u1e[^_à VBE 1e[^_Ë}Ujju uÐUWS]U;+CtqU܅tf1эAEEEEEECECEEPh@jju Sb u Mu&+e[_1맸+e[_R\Wu SKuы|tƀ|PWu S뭸+릐UWVS E }_ MQfu uMM E9}EE8f1ɋEtA@P 9|#MfQEf@)fpȍe[^_Ív9|GUGfBSP7ЃPG@`tG Mf AGȍe[^_Ë@fE9ENfEЋUfB6EUE U|#~@Ív=wRuPu ÐUU:+t+ËEEEEEEEEPh@uju R% uċUuL+UVSu]F9Ct 1e[^ÍvQPFP3?uSC e[^ÐUEU v Ív=v9w=v5w=v1w=v,w=w@fÐÐø fUWVS u E~@u: UBP£~@MAWPjR]1+ v=ÃRvjP4FfCE uE1e[^ÐF@`u?U fCC.V fC C fPUS fH@.@ .몐뿸+e[^øF+e[^UUM B tt B9t1ø\+Ð1fUUE B t tB1f\+ÐUUE B tBB5߉B1ø\+ÐUWVS uVJ`t E9vU MD e[^_ËzxQ ؉љ]SVNQq ;U t0;Qs뫍vUWVSLu>+D hKÃRPhjS@+ECC\1}щ $EC uPY_j?s :U EEE@tPCPRs Vǃup} tu sǃuRCX\ hhEt*CE ut~MVG+F+Et"U e[^_Ív+e[^_Ð Sse[^_fF+e[^_Å @E CPhPR$EiCTEECPshQPRǃ8CTtRhsPC@P+ hL-ECXCPQhjPRǃCX8+t1+CPuPRUUCTу8EEcsf~8St +f~Lv +VEuNV`MЩFdt}tt D+fEuu}NA whCFLt FX~LNSN(M̋FLtUVXNU̍D C(Et7E9Ct/"+<+C+xЃ5먋CPsPRsF`tCU HN MtC(EЋVU܋FL,Mљ)9UaF+F1CVU~` HEEMeEE1AK st19| Q‰E`C$E؅u C@E؋s tvEQuuS\SJVjPRQ uDCEԋM9K v=C s1|*H1u@VXSdCP}~*Bdt$C$St1f`f@B 9SwKcE fU uuuuu ju%ÐUVS];+t+e[^fU t3EEEPh0@jjjSh uŋEe[^PpPjSuMC@du>S ȉ1A1w.2Pu ]dU lEu=PvиɐUUxU MQ;Br;Br1fPE 0B\U Bt߸ÐUSEt[v[ÐUWVS}tE8+t +e[^_ËU2tf u )utSu hW0t^Qj jWÃUtUJ;Ar";AsPE0w[tzvEtuWSuUz1e[^_Ãj Ri\R8U$EEh1@EPuu uÐUWVSE8+tDž4+4e[^_ÐUR8MA=v+Dž4F+ <菽4e[^_f P,tCPujQPR#+멍vKA+A1q хXC9JƉȃ:A9w.+e[^_ËU̅u1EЅu1B+8c uӵ1c߃ W輵E1UEP,t;P҃H0t"H уutf111UE1UE1ɺUWVSlÉUM@P UP(UsPUā;+C<|:@@dEӃ { 1уOQẼ uẺEEC0t PX @}fs u C0PuSWǃhEEC0E P;EC0Eut u ]t uMt ue[^_fEEEC,t PW@}̥fs u C,PuSWǃuE P袶uE u6C CEEEEEUډUvRuhu?uuus0UǃzEEċEtZEC$p}t @4PuhuuuVus,TǃuEE U9SMtEC$0}t @-CPuuVPR%+EZvuEG P$AuEEEEdF+EEDEdC,E PtEC,?fSJuEPVRQ+E떍vuSx%uSxi\+e[^_ÿF+e[^_ËSXK(y sE;1uEvCu9vRus0Rǃu>C)E}E)ƋM܋QU܋PujQPRǃtESX$CEK1EI1uEHvCu9vRus,CRǃuCE)EUE)ƋM؋QU؋PujQPRǃtTCC-F+&Et ulEt uW1m1ffUEP,t H0t11Ƀx0UE1UE1ɺUE@,ÐUEP,1;/@t @ u1@Ë/@ÐUS]u }t @t'1]ÐKuStC, ]ËEu-}t'C,uuuu sh4@jS C,뙍vUSËuCt 1]Ív jjjRjSP @tǃ1]Ph|@jSC,뫍vUSËu 1]f jjjjjSP uǃ]ÍvUu1à jjjjRQP ÐUSÅt t1t 9PuAuIt1]à jjjjRSP ]fUWVSƉt31ۍv%   щ C9u҉[^_ÍvUu@1ÐUu@ÍvUVS SjQRPe[^fUWVSuE Ft0NT9sC9t1DtE [^_EVT9s}EuCVT9vЉ؉1Ut벍vUWVSÉ׋E puEjPWS֍e[^_fEjPWS֍e[^_UWVSÉ׉΋ RjQWS t'F=&t=uR jPSR e[^_C, WPh@jSC, UWVS,ÉUЉ΍E܉E󥋃 pu}jWuS֍e[^_fE܍vUVSEu XT9s'LuB fAuB9u[^ÍvUUE 9B r1B,U1ÐU1ÐUSPt#Hv9JsB Ëu[û[fUWVSÉ׉΋ RjQWS @t4F=&td=fu0W jRSP u e[^_Ðe[^_C, Wvh @jSC, 뽃 Wh&h@jSFfك jVWSP@tF_UWVSƉ׉M໨ӍMډb@tUt9uMډe[^_WhP@jVF,e[^_fUSӋQUMT[UVSuy)E]ٺ0Eٺ0k[^USÀx]Ðjjjjj0PA u SXZjjjjj0S ]ÍvUEfUE@ÐUEfUEM0EEfUE@TÐUE@ ÐUEfUEfUWVS]CEUB) )щ )ȋUB<Mt/]11ۋEE1e}F;uuڍ W)ЍǍǍG90[^_ÍvUÍvUU EÍvUME @UEfUVSƋ@u.^u'%9F uFtv"HF1e[^fF,e[^Åx& VTRjjjhVP uFF 1뽋 5@PhD@jVӸ UE1>fUE+vUEvUWVS Ɖϋ@u,Fu%ӁFt*9^ u@F1e[^_ÍvF,e[^_Ëux$ VTRjQShVP uF^ 1e[^_Ãt릋 5@Ph_@jVӸ zfUE1UE1UEfUEfUEfUVS@]u 9s sBuBEPse;uw<-tyEC 31e[^ËEt;C,e[^ËEuC, uVh@jS C, s Vh@jS C,fUWVS }mrtBJ1e[^_ËBG Zt*fB s$Zu؋_taW$~/11ۃjjjjG(PWF 9w$LJG$G(t PlG(@ jjjjhW {t R PLJ1e[^_ÃGTPjjjhWG Ph@jWUWVSÉUMpt(%;C tEEe[^_fu}|VE;CT}NC$~#{(U9tiw 1 v M9tUB9uQhx@jSEEe[^_à sTuh@jSE Ee[^_ÅtWtv%BGE@C,E-U jjjjMPSRE C$~4@s( }襋C$HC$uC(t P-C(EPh @jSEUS]E P1sT1ɉ6]ÐUS]E P1sT ]fUS]E P1sT]fUVS]t SCt  P=Ct P$Ctv PjƃC(t PC(~@t9uC9tDuPh jS$貞e[^Éj1딺~@fUVS@uuduFt+ShL@jV Ve[^Ðt'Rh|@jVɉv1e[^É` vMPjP6F@t! jjjjjVP @EPvuoE;uE;MPhP@jV 5@,Ph@jVӃ Ph@jV0 5@Ph0@jVӃ 5@Ph@jVӃ sPh@jV\UVSu~@u 1t't St۸e[^1e[^fUWVS } ]EPu@tE@, e[^_PhjBPnu h)tcށvWVPEp;9tЋE 5@$Vh|@juӸ e[^_1e[^_ÍvUWVSEEu UUMMEE܋U苊Y t}vC9s S 9r0[uAU܉UMMUUu MMe[^_9MM9vB)UM)щM)sPuVu蟪]܅Mu1e[^_ËUUE uuEEPWu tlj uVh@juEUB,@ e[^_É) uWuVu uE)E}<CS UE2vUWVS u}t%FuFt!F, e[^_Ív1e[^_P jM RVP uFtE SWuPN1봸u Wuv9tF, 5@?ZYPWu h@jVF, WfUWVS}u ] j3RWP u7Gt@RSPu諨Eu 1e[^_ÍvڋEe[^_ÍvVSuwE9tG,EG E 5@muPuSVh@jWUG,0vUWVSE֍EjP$Ã@ m&p$Eu}VjjUr@tIEE0QhSP蘧@ߥf uSUr;Etv S褗e[^_ÍvUP X0WhSP;Eu 1e[^_úh1溨XTv1닋UB,농vUWVS]tf} f]tXډ@t]؁}uߋUg@uлN؃,[^_û؃,[^_1ҐUWVSLÉUME1sT@ME1sT @U1} UUt$@}ЭuFUUu;fuVuUME‰ƅuJAPuVjuUMue[^_ɉ ƅtfE1sTtPh'@jSe[^_1;:U+E1sTtUS]E P$U M@]ÍvUWVSƉӉϋRKM;HT1ECECEu'K U4@SC1vTM@t]EvS@t8S9CFuŋNutCK Sye[^_ÉűErSz@tCS^K S"ECEMAMK9NTv]S uVPCE;FTPh(@jV6'Ce[^_F,1/Ph$(@jVvUWVS,u] tx@|@Ve[^_ǃǃǃM܍~}䋓EЋuEЉ~e[^_PhL(@jS؍vUWVSLEEEEljUMUEfMMEP^ƅ]UŰEH P/Eȉu]č]ỦUEt!uuuuuWU  VwM؋UiÅ_UxMEȍe[^_ËUJ Ru#EPtRh(@jWUEEȍe[^_à VvUՋEPu]ȃ VvTPh(@jWfUWVS]u11҉Ste[^_C VMU Ke[^_ÍvUWVS].@ߥExuptQuu udƃe[^_úEtރ SMU EwƋE UWVS|]}uCuCtC, e[^_à E PE1sT@C}U MMEPuEtUD29E>C,{,u }wC, uU M EP+xEIQuu u~.ExE1sTM@UEԉEfUԉUM@}u;}wӋUUEE܉uEEE&M-@ uVuURSP@tc1Et usE1sT! uU MC,EE@tދtU@}@>PUEUE|M캨@UqE1EEEԉE3Ut9v=UU;ENjEEUUԉUMԉ@t:E9EvUP us SPEUUE}ԋE1sT@oEE܉uEEE&U@F uVuURSP@$ME1sT@C,@P jC @PSR K TU!)ʉUEȉC %PswC1|EES +UM@fUUE(MU@UUЋM MЋE E̋u `} 1wT*ŰEMЉHEe[^_u 5@Ph(@jVӡx@|@}W } M܉}@tMME :Åt5EM9ɉމu$ SiU 1ۋE Et+ Spiu tVt SAix@|@}WSh )@jWWh )@jVE ǀ,QfUWVS,u;Åt ؍e[^_ÍvM-@uh@VM1ۍ}9E=fE܋M RPPQhX)@]܋M؉M t] RjWQV @ug؍e[^_ùG؍e[^_1PSSh)@Ã؍e[^_ÃPh8)@p؍e[^_ÐUWVS,Ɖ׋XTte[^_ÐM1ɺ@t ]uv~e[^_ÃWh@]tf RjURSV @tm uuuuuuSWh)@E؃0Mډ0@tNE؃U9tQPRhl*@S]ԉ]vASh)@.E#ShH*@]ԃ뼐UVSuFTt1ۍvډC9^Tw h@e[^wvUWVS\]EwzBuMrOruSttB;G}܉Auڐ]u1҉Ѓ[^_ÉU뻋Mt!UEދMA @A BЃ[^_É}ڍvUWVSE׋EU EU}E]UZ ]J EșMȋ]eÉ_wjVSw11 t_@t*1ɋ]StVPQuuuuS҃ e[^_ÐE+ϐUR Uk]ۉ]EH XPuuw9Et %+1UWVS EUωӃE1 vFt>C ttc C t3jC1RPUEtEFuÐEe[^_Àc 뫍vUE8+uPX:+t+1\+ÐUWVS lj։ˋEU EUA <t'C C USF @F Ce[^_Ív1jA1RPvUWVS,u }E8+PXU؁:+tE+E܍e[^_f}EXEE~̋UUE7vPUr u3jC E׈C UB MtEEPEXu]WVًU؋E뛹U؋EE܅;uuWVU؋EE܃E+uuWVU؋EE܃ UuuE 1RPuÍvUWVSE׋EU EUEUEP UEUB Mȋ]eÉ_wjVSw艄11 th@uKE+11ҋE)UWPjRjUBtQSVuuuuRЉÃ ؍e[^_f붋UډUMvPuuw蹐9Etx Ɖ»$+넻$+v1UWVS,E UEȉŰU:+MIXMЁ9+t +e[^_Ã}huSEE4QMq 0uShMEUE@ EԃEURUȋM̋E[u}>]ȋũEvE؃M9MtU؍DPډEZtuuuuȋUЋE"E؅eEȋUEfM܋\Ɖ׃RPًUЋE Ep u3VgUR UE܃M9MuEUEH1EŰE)EE1e[^_1ɋUЋEquuuuȋUЋER+HEfUuuE 1RPuÍvUWVSE8+umXX;+uUP/@u u/Et(WjEPukщƒE8u SKy G+e[^_1v+e[^_ø+UVSE8+ugXX;+t+e[^ÍvƅuPjCE u sʌx%Puus49Et%+멾+뢋5@fUVS@ X1fCCc tE PUEFue[^UWVSB Z1vCCc w XtEFu1e[^_øF+e[^_ÍvUWVS ]} ;+uSsX>+t+ [^_Ð9{ t+1ɉ4u{ ؃ [^_:f1 [^_ø+붍vUWVSu>+u3^X;+t+e[^_fFHF~1e[^_ÿ+1ɉډǃ s莆x_LFXE PTEFXFt FE PSEF VSX=@UWVSUc j`VÃ5Pj`jSd+$Vƃp@C 1}QVECuPNbsXC CCC hjV_d+džvǃubE E t PsFx\Ee[^_fF+ SRe[^_ÐF+t VgRfF+e[^_Ë=@ο:+뷐UW$U}:+t +}ÐtvBtf}t[1эAEEEEEEEPh@jju R]) uUu&+1밸+}ËMuG+oUWVS u]{st(F;Ct 1e[^_fQPFPRH\uCu&tԋE tFfGCe[^_f;uUU%=@t3=t,=t1ÐBht!B;wv1z,ÐÐ1zÐUVSUt>11fЍBЃ w#\BЊAAt<.uu fAAu[^1UEU t h/@tl/@Mv h/@UEt Pu h4@uj u h@@ujÐUVSUu ]t1Ɋ11/@1A9u[^U1ÐU1ÐUSf=~@y]f h1@qƒt:QjEPRg~@E8t~@]f@uf~@̀~@=t9t1~@xhB@h1@%~@Vΐא9u h1@&qthB@P~@듍vUVSut e[^Ë~@t NC9HuB9Ht=Ӌu~@t vVPh1@5~@ e[^Ë R&N~@u 1e[^à vVPh1@5~@蔮1 e[^Ë~@뮐USjQÃtIu(EC~@~@~@u+1]à SM@]f]f EpuPh1@5~@1 ]UE@EVfUWVS EЉU)ЉEu~@t6J]A%9u2JA%9u~@t(J]A%9E;A~@1@ߥf u$^_PSZ1fǁ~@ =~@~@vA9u}cQmE)ӍS0A)EgfffEE)B0A)UE0A~@e[^_ÍvJA%9uE;AUe[^_à R腐u~@1@f} {S~@USU~@?t 2@Cu~@[ÐU q@UUq@t q@Ðq@@@Uq@q@@@UWVS Eu }UUt&5@P55@jjhg@豷 uBtPuW5@5@jjh`2@@Ee[^_騴@ V^ZSPZY5@j U q@tEEPuu ufq@@@UWVSL}tD39u:f9t0ƃEPs菉y S+O9uЍe[^_UVS] j jtQƃtWF@FF t;u(9t1US]jKƒtL(XBBB Ћ]ÍvUWVS Eue[^_ÍvE8L(uE tދEt׃ ً} 1QJً}1щ $kJÃtptVu V"VY_uSVUBt PF}G t PFEpX 1I VF3& PFUVS]tHCBsC9t PC9uCt PAF]e[^0Fe[^ÐUj4j Nt‰B@BB f1҉ÐUWVS Nj0t!v^ 6E4$Eރue[^_UWVS u} tIt1 GPHÃtPWVSP;؍e[^_f1эy뼐1ۉ؍e[^_UjufUWVSƉjtHÃt VtCe[^_à SDUWVSXu(ƃ 1}I VKƒZ1򮋅)=ẁz.uBt<.vSuhd@PY[URPxE%puU 9UtZUi=@^EPR菄@E%p=@-U PsU Vމe[^_Àz,UWVSEEEq@t1ۍvU(q@Cu}uf]tGCEVWu3GX3+C$#CEuEuƋEEE]uEEe[^_UVSƊtv\uF>tFue[^Ð P@utFUSÊu vCt P@u؋]ÍvUWS1эA;t$< GO;t GPA@u؍e[_ÐUWVSlEtJjEpzƃx1EPVWxEU;BtBt Vte[^_ÃhB@VyÃtՍPShPų0t*vw>PS)PP茳t1эQ\tNJq<#i2@Rj>PvOƅ1@x>]j<Lt52@ ut G +PZƃyPjVuy  V?j=xNƅMF8"8t @2@u?Wjj;TA b SqUbEBi2@ucVjj'GG@j"PMOW0 W+v@u!QjjoSA$1IQ `j V>UWVS}u ]}EEtaPSVutK Pr$jÃEt P=Et P=tK؍e[^_Ð1ǃj=VLtjREPEPVSEtdUtdƉd uA؍e[^_ÃjEP~.v1ۉ؍e[^_à VÃ81D11vUVSu]t~utbQjSu7 t@u Pt- pBÃu u؍e[^f1ۅt؍e[^ÃjEPy1ۉ؍e[^ÐUWVS\ME9@PU\EPu{ƃWyEh@uE EEE9u }19]ttKtC8/us$s h2@u!C{s9twwh2@u?9uPsh2@uۛ19]ux Ub uTE9EtYo 1}уQ6>Ãt-Wuh2@P$VgZYSuw$:Et' u:e[^_Ã=@1e[^_þe[^_ÃjultxӋE%p= ` 1}уQw=E>Ruh2@PXu聁Ãxyh@P rE_XhS*x]UU RPh2@uQ6En2@5@ ufhPwUVSUM ]u [^Ð:L(urB9tFFB1UWVS ׅu 1e[^_ÍvtXp9u9t݃WsGu؍e[^_ÐUWVS U} u 1ۉ؍e[^_ÐtBr9tfÃWpjGtЋ9uƍvUEuËM tu PUtt݃upGÅfUWVS EuEEe[^_ËE t}t uEvU EXx9EE v9tIsuviFuFU9P~׃jpzquËvuFE9uutDUB(8RuEO@(U EE]t&E@ PE uEvUEt8L(t6US]tJCBSC BCt Pa6Ct PN6]]?6v]ÍvUS]j s9ƒtL(XCBЋ]UWVS ]u e[^_Ãj=SDƅt߃ S~ǃt)ލ0XP"t#'t STt*U :U1뜍XPSAtƃ Wf5jUjj9=t‰B@BB f1҉fUWVS ]ue[^_ÍvM tuu;E~'3@u CEu SƃE~uWrCt3 W4EFsEtMU tN1I uM4143@u S,U] V}sDž u GUW_S { CW:sMʉEtesEH WP GO `@u tEsK0MUw?EtO u MAtMsV N FQ bEt u3 WV W@Xu7U1ÐUEfUS]jCK1҉]fUWVS }u u 1ۉ؍e[^_Ðt9u$9VsAuEtƒSWÃt@(t7E9tF(SFPR@S,UtF,tPR@umC0EtF0tPup@uIEF,t7MV0t%VWt@(u PfU9E%Eu1EÅ@$ VC{G_;COF,uQF0uWUDH tu9s19w)@ÍvU1ÐUWVSׅ~GtAq 1 v t.ue[^1e[^UWVS1ȉƒ35@ƒ3 5@Fu;KuC E̍S!MͿfBF!tA@DDt-ABF!uj&EPh`@Ep1e[^_ËEEƉ]EfUjE(Ph3@Ep]1ÐUS]( PSh3@Ep-1]fUS]jjh`@s jjh3@s1]ÐUEP0x0tjRh3@Ep1Ív1UEPxtjRh3@Ep1Ív1US8j(EP]S8j(Sh`@Epb1]ÍvUWVSHE։R^ t e[^_Ív}WV!tj%WSue[^_û`@fUVS]uj@Ph3@sPC1s1e[^fUVS]sЉ9Ct e[^C9Su)C9uݍt-jPh3@Ep_MA111ϐUVSuEx$t+X$PF1jSh3@v1e[^f1USMA, u ]Ë] C1;A w,U B@2<v#1jSh3@]s1뾸뷀ydu1ۍQTMA1-ōYdfUVSu]{lt+Clj Ph3@vXS F11e[^f1UWVS E׉ˀyxuJ1jPh3@uSh1ɋEC\uJ73@t C`te[^_ÍAx볍vjh3@h#3@ue[^_Ð Vu3@E7돐UMA`u fUBU *1fUMA\tAduA`uUBU 1fUM`tA\tAduA`uUBU 1ÐUVSu]jh SP9t hSP9opnqwaEUPEPh3@vFsrPPh93@v UF11e[^Ðjh23@h#3@v농vjh,3@h#3@vgUWVS ljUM]1΃~EE;GvPwM/tGEGjuu7zy=1e[^_Ð|wG tT;D3 wMA= 9}jWh3@Ep1ow0q Ѓ?Ȁ)Pq ?Ȁ)Ѓ?Ȁ)OUSjQRP!xPjEPSJ]Ð1]ÐUWVSd}EPWRuE%p= EEEEfEUEUEUUMQuݐEU9U|~EUe[^_Ð9EsvEUEUӉ1ډt ]u땐]u댋Eؙe[^_UE U|#~@)Ív=wRuPuHÐUVSjuVRN}SU3U11ډ$(XZjVRE3EÃt fwKue[^UWVS EUEuxZE~K]1 )1~PSVuHG1E 1ËEF9ue[^_ËMvUWVS,]E t EЃugE1}ԍvECWEPE%? fEfE%@fEXZSWF;u|e[^_e[^_fU EEPuWfUWVS, ~@=y@~@u ~@uvjV)Q];~@FM; ~@4o~@ @~@=~@GEEÉց@]űE teU ~[Lgfff)‰=~@)щ ~@C~@)׉=~@y@~W 5~@{_X5~@5~@5~@~@Ph$6@5~@xo5~@yY5~@{؉1҉]f~@fUfE%fEލUء~@Ef~@fEuRe[^_ËM~@EU~@~@~@ ~@~@=y@ jLà hjh6@ Fy@$cLXZh6@5y@E~@ 5y@@y@Mf~@@%?f~@*~@f%~@?jh~@N ~@uKvUjuÍvUS]Ix ]X[f][[UU1ɊBu Au1UMU BBBABBABBAB BA B fAfBÐUSM] A Q Q ЉQA fCQA fCQA fCA C fAfC[ÐUVS։ˍURPzUE$EPEPEPEPEPPREPEPuSV苣@e[^ÐUEU |6@fUEU 6@wvUEU |6@_UVSuy@t;y@ Ct)PVuU CM1e[^Rjh6@Vu FCt u1 [^_]Ít&$u$h)ƉfUWVS u} &}$7ÍGE$$9u>uӃ 1[^_]Ð$$ )É[^_]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$tt$|$$5؋u]}]ÐU1M9t :u)]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]W&UWVS ]} &$ju+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%89@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$u<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$HAEEs{xC{$EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& `@t;=d@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]t&]Eu}]t&FED$$W1 f?[D$E@D$U$ uɍFD$ ED$E<$D$U@FD$ ED$E<$D$`@v'UUE `@U]6<UW V@S1ۃED$D$$D$ED$E$t&߃ t;>t[@D$ED$$ u˃1[^_]Í& tED$@D$$ E @[^_]Ív'U:$0 @d@;@&@ = @uÐUWVS }1=vl@t$$Tt&9{ul@t$$X$0ƍ [^_]UWVS }1 v9{t+l@t$$ߍu [^_]t&l@t$$׍$ [^_]UVSl@$ƋEh@Fh@11&@;Fwl@\$$<ul@\$t$$蓎E D$F$A~^[^]Kl@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$.\$D$D$ E D$E$+[]ÍUED$E D$ D$D$E$a+ UED$E D$ D$D$E$!+ UED$D$ED$ E D$E$*U`@P@p@Ít&UWVS,EUMI=t@Gt@p@ Eu&)ċE\$#D$D$$oED$ED$C$E\$t$ |$D$$"*t&1 &p@\$$ĊtF;~up@\$$ȊE;u|;~t)&軅V떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$&\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$K$C]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEzp@t`$É0E{C<$|$ƋE4$D$*s \$p@$V]u}]%t&뙐U 0]Ít&U j0]ÐUED$x@$1tÍv'UED$x@$趇1tBÉ'UWVS }1]v<$D$Zt&x@t$$buԃ [^_]0$FC$;$3x@t$$BUWVS 1t&<$D$t.x@t$$u [^_]Ðt& [^_]É'UE1҅tPÐt&U$<9@]]uu1ۉ؋u]]Ðt44$9E r݉4$t$$D$&$4$E $W맍vUE]utoU1u ]u]ÍvE $e$ ƋE $M4$D$E D$WE tC$1s롸$tE$$E $$҉CthtdE$D$ED$$E $D$E D$C$x@\$$҆x@1$C$$U]]u$*\$D$$<9@o4$e؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&@eUx@$Ít&'UWVS,EEE EFEEE}&$EF$]]x;D$E$EED$D$EE$|$FD$]$EEEED$x@$΂lED$ ED$E܉D$E$EE,[^_]'UWVS„D$@$@9@x@$M.u [^_]ÐD$ D$D$@9@$EtЉ‹@ tljB9s&<$<$D$tt$<$x4$nUDNjB B9r[^_]ÐUU]Љ%   Ív'UE]fÍvUU]Љ%   Ív'UE]fÍvU1Uw9@]Ív'UWVS @{@}t;L{@1f t$D$<$uv @{@[^_]f 1[^_]ÍUWVS `{@} tAp{@1t&D$E$aut)C<$D$Juuʃ 1[^_] `{@[^_] UEuE $wUÐ@Í&UE$wU Ð&UWVS,|@t)t# t$|@uE$jw@ty$D$á|@$@|@@E@@@@@|@@@e[^_]ÍvUEeD$I9@$T$k8D$B@E$HNjE$<$D$D$ B<$sA<$yBC)čt$|$ 4$\$D$E<$@4$D$@A1Et_f$4$ v|$|@$U|@UD$@$߁uU|@e1&UUuu}}]uLU $wÉ$-9r>t$\$<$$n]u}]Í&@1f$@1@'fUSE$vD$$@ÉD$D$@[]ÐUEt;8t6 @1҃w9@T$ D$D$W9@@$M4Ív @1҃w9@T$D$P@@$4ÐU]';UU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@B@Bt\1ۅt.@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@]uu%@1[]Í&$ti@B$!@D$~@1[]ÐUED$ D$$O1Ít&'UED$ D$$1Ít&'UD$D$$@D$ D$$@@t&!@=@uă@ U=ă@]]uu}} G~&@&]u}]Ív tՅt4@@C@C@C @C1t@G@G@G @G@1rfKUS]=ă@t=G( t#M @ @[]Í&[]Ív[뼉'US]=ă@t=GH\$$@u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE]Ft&]Í&'UU ~ÍD$D$ D$D$E$1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3@\$$wvu@ [^_]f@\$$gv$}8uȉ4$1 1[^_]Í&UWVS1ۃ}9~t3@\$$uu@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$@\$ D$H:@$-^ 1[^_]Ít&]F9tD$@\$ D$ :@$,^1[^_]ËE cF[^_]ÍUWVS }@1 f9>tl@\$$tu$Ƹt>@t$$v@>@F@FF t&F [^_]u@fU @tÍv@@$@$@$Ðt&UVS@t519pt#@\$$su[^]Ít&[^]bf&'U(Eu]}t;$K6D$4$NjED$6t.]Ћu}]f@ލ&Et$ D$D$E $"7D$|$4$\6څt떍t&U(Eu]}t;$5D$4$NjED$6t.]Ћu}]f@ލ&Et$ D$D$E $8D$|$4$5څt떍t&UE]uu}} #tEt$|$$m5t]u}]Í&]u]}]4t&@ÍUEt&D$ ED$D$E $5Í@Í&UE]u\tVD$ ED$D$E $7t]u]Í$2u@Ӎv@ UE]t&UVS u ]00 D$B@$:0$2ft^ErtDaDED$$q:t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$B@$9@@됍&15D$B@$9uLvEwfvEwE+D$@$p9v${1@UE D$RD$E$0ÐUS]D$B@$8t$ 11[]f$ t$ 1[]@ːUS (@u{@tr,@B{@,@:#{@8{@U::,@D$:@D$@$%?[]Ð{@E (@;] {@}A{@-t{@B@[]QA{@-,@ta7D$-U{@B@$,t,@-1&?[]Ív{@t&y,@D$E$x:t,{@$@8u{@,@[]Ív{@8uh{@9E{@PE:{@B@8:{@D,@D$:@D$@$&$?U $@{@B@bC{@U$>ÍU]U@]ÍUE]uD$:@$6t;D$ ED$D$E $M2$-]u]Í&@ UE D$D$E$P ÐU]ÍU1]É'U@]ÍU@]ÍUE D$:@D$E$1ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$Z<É'U}׉$]ÉuD$4D$G!$,D$D$$\-$,D$t$$G=-G1G,w, O0tAG0G]G@u@G}1] US] D$B@E$t[]v@[]Ít&'Uuu]}} D$B@4$+3t%$4+]u}]Ðt&4$YtI$1JYD$4D$<$GAGG@@G@농v'U(]]}} u$|$t]u}]Í&$D$:@@2tԋG G\$ D$D$${.G0G$*두UE@1]ÐU1]É'U1]É'UE]@tV@\$$du1D$ D$D$:@$:@rSUFF[^_]Jf뿐UfD$3@$:@@ÐU@]ÐUED$:@D$@$@D$ S@UE D$D$E$TÍ&'UED$D$$OTÍ'U$ ;@>Q1Ív'UEu1}]$TtL$$xfw7D$F|$$Ɔ<$]u}]Ív‰'UE$?SɃÍU]RUWVS }<$,4s/|X4t&B)E4$0 v@UWVSRX1ɉ‰EE#E$VËE$+UStdfuC.C E\$$W11vD$xE$UtXC$%ƋCt+rǍ&CC뗐t&$i;@Ɖ떍F$}EE$oTuE#&tcu :F/<$mED$E$Tt8_4$\$$aƋGu/볍&|E$UE[^_]Í&$xE$SD$E$[T8$薮@@E$xS\$D$E$UaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐUMSYt ЍCA[]É'UE]@Ðt&UE]@Ðt&USM] Q~BA8\t[]"[]Ðt&UWVS|U‰EЉMEuR <U$&UH]9uSUCu< ~<%uBEEz*'E1$藧]B<E[t@ct;n]$fU$utÉD$E$U]%t&D$U$;E5Mt UȈUEttE$UuUą}Et ]EEEЋe]-EE]EEv$=@191E9kvэۍẼ9ff]̀|0X9$fۍt^1[vX]̀|09\A&ivÈ|0 9t&ED$ D$EЉ$V&BEEvqEuE-}]Tt&]u]LEuEu=}u]Ѝvv]} t/}tU}tk}t&uYQuE]ЃCEЉECEЉE f뽃}]Ѓ]릉t&랍CECEKAÉD$E$Uv]EED$E؉$\$膶]&+]vvf]Аt&]Ѝt evet&'UPP@(EUED$F@EED$E $0P@Ðt&UE D$ED$@$Í'UE D$E$ÍUED$E D$E$Q UE@(EUED$F@EED$E $ F@WÐt&UED$E D$E$ UEU hUM ]t&US]$tC[]ÐU(EE@Q@EEEEED$E D$E$WÐt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$舮ҍUUE $T$ ÐU]]uu KSA9t BC]Ћu]Í CD$$t΋S뷍&U8uu]}u؋u]}]Í}}EEpQ@$@@t‰EEE@ED$E D$E܉$D$<$tE;Er EtD$E$E␍t&UED$E D$E$!ÐU@$@>@D$ED$3ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$?؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$>؃$[]fUS@]U u$T$>؃[]Í\$D$ D$$ []Ít&US]$\$$t@t$ 2[]Ðt&D$@$>ؐt&UVSD$B@$N>@ wD$ D$D$4$5 Ƅw@D$D$Y@4$$@D$ D$D$$D$B@$]>@[ )wD$ D$D$4$ Ƅw@ZD$D$B@4$6$@D$ D$D$ @$D$B@$m>@ wD$ D$D$4$ Ƅw@D$D$B@4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$B@4$ @vD$Y@4$ @*D$B@4$ @U1]É'U]Ít&'UE@1] U]&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$}>@F$Ɖ]u}]Íu \$KS<$8C $8U|$T$$裥\$ D$D$}>@F$蔵ƋC $8뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$>@C$衴 Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$>@F$4$@딍US$]u$[]Í&Ct$ELED$ D$D$>@C$蚲D$Ë@ D$E$~C $賓$諓E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$31҄u뱍vC!C$.뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$W?$wt&tyvC!C$:vK9Crt$ED$ $菡sY&{Cft$ED$CC$Rsv'U]]u$ U $D$T$ D$^$]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$#tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;(@v/$@Eܣ(@$2$@$2 @$@EED$ D$D$>@G$rË@ <9}sE<D$ @D$E$AC $v$n,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$胕_utRu4ttG!9u܍f]v֍ovɍt͉$v蓎G!9uIvvE<$ED$ D$D$>@G$Ë@<9}sE<D$C $ 1t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$O )čt$<$59s@a<w%$>@vЃ|+uf<$9rE1ۉ$UT$D$F$E$t$ D$>@$D$U$w t Nun1ۉ<$܋e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$$蒎FU$T$P$&tËFCFCF C FCFCFCFCF C F$C%C$$'D$ D$$D$C%4$诊v'UD$>@$>@Ít&UWVS] D$B@E$~C$# D$@$N84$t$ D$D$<$uN@D$D$?@$q4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$׵1[^_]á@D$P?@$@e@D$ ?@$@<@D$t?@$s4$ @ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$:@4$–]$t$D$ D$D$$$7&f&'U$~ÍU,@tED$,@$ 21ÐS2,@u@É'UVS1ۃ,@uu!&Ѓ,@\$$/uu[^]U(}}EU u1]]EUt\$t$ $T$蕂EU\$t$ $T$Q]u}]ÍUWVS,E ]E?@E܋EuE?@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$行~8$t 1҃[]f[]Ít&'UWVS${1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|4@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UE]0@ÍvUE]0@ÍvU]u50@D$5qD$ Ӊ $\$rl]u 0@]Í&'U]UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; E@|}z;; E@|fE xQM 6AA +E@ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@@$Ðt&UED$@@$Ðt&UxE@]ÍUtE@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$]D$$FFF D$D$$wkta$iEԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$bEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$jj\$UT$M܉ $h\$E$FU F$E] UMV~HU1fC D$CD$EE$1hMC K9}MƋVT$D$U$hF D$$ 4$%XUE ]u$tD$E$n$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtxd@t9t)ȉ vt̅ud@h@l@뵋5h@9|͡l@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$Vk9d@u,h@9|Qu!d@vWu1]u}]Í&tq $KV뛐h@ȍ&'U]]u1t#1tr$Vk9d@t]u]Ít&h@th@ݐt&d@̍t&US]$xu][]U&U$]]uXۉƋEFtM u:3C9d@t؋u]]Ít&h@9E h@܍t&U ؃t21빉'US]t$$6XU PC9d@t؃[]Í؃h@[]ÐU$W@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$p@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐUSTW@t1ېЋPW@uX[bUngueltiger PPB!  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@Usage: %s [-panyrcdfvtDFV] [-b superblock] [-B blocksize] [-I inode_buffer_blocks] [-P process_inode_size] [-l|-L bad_blocks_file] [-C fd] [-j external_journal] [-E extended-options] device Emergency help: -p Automatic repair (no questions) -n Make no changes to the filesystem -y Assume "yes" to all questions -c Check for bad blocks and add them to the badblock list -f Force checking even if filesystem is marked clean -v Be verbose -b superblock Use alternative superblock -B blocksize Force blocksize when looking for superblock -j external_journal Set location of the external journal -l bad_blocks_file Add to badblocks list -L bad_blocks_file Set badblocks list Syntax error in e2fsck config file (%s, line #%d) %s /proc/acpi/ac_adapter/%s/state primary superblock features different from backup has been mounted %u times without being checked has filesystem last checked time in the future has gone %u days without being checked contains a file system with errors%s: clean, %u/%u files, %u/%u blocksError: ext2fs library version out of date! Error validating file descriptor %d: %s Invalid completion information file descriptorOnly one of the options -p/-a, -n or -y may be specified.panyrcC:B:dE:fvtFVM:b:I:j:P:l:L:N:SsDk Extended options are separated by commas, and may take an argument which is set off by an equals ('=') sign. Valid extended options are: ea_ver= The -c and the -l/-L options may not be both used at the same time. Invalid non-numeric argument to -%c ("%s") while trying to initialize programERROR: Couldn't open /dev/null (%s) while determining whether %s is mounted. WARNING!!! Running e2fsck on a mounted filesystem may cause SEVERE filesystem damage. Do you really want to continueneed terminal for interactive repairs%s: %s trying backup blocks... The filesystem revision is apparently too high for this version of e2fsck. (Or the filesystem superblock is corrupt) Could this be a zero-length partition?You must have %s access to the filesystem or be root Possibly non-existent or swap device?Filesystem mounted or opened exclusively by another program?Disk write-protected; use the -n option to do a read-only check of the device.Get a newer version of e2fsck!while checking ext3 journal for %sWarning: skipping journal recovery because doing a read-only filesystem check.unable to set superblock flags on %s while recovering ext3 journal of %s%s has unsupported feature(s):while reading bad blocks inodeThis doesn't bode well, but we'll try to go on...Couldn't determine journal sizeCreating journal (%d blocks): while trying to create journal *** journal has been re-created - filesystem is now ext3 again ***Restarting e2fsck from the beginning... %s: ***** FILE SYSTEM WAS MODIFIED ***** %s: ********** WARNING: Filesystem still has errors ********** %s: %u/%u files (%0d.%d%% non-contiguous), %u/%u blocks %8u non-contiguous inode (%0d.%d%%) %8u non-contiguous inodes (%0d.%d%%) # of inodes with ind/dind/tind blocks: %u/%u/%u Extent depth histogram: while setting block group checksum info/packages/e2fsprogs///etc/e2fsck.conf%s%s %s/proc/apm%s %s %s %x/proc/acpi/ac_adapter%s %soff-linedefer_check_on_batteryoptions was not cleanly unmounted (check deferred; on battery) (check after next mount) (check in %ld mounts), check forced. %s%s: |%s%s %4.1f%% %u %d %lu %lu %s e2fsckUnable to resolve '%s'ea_verInvalid EA version. fragcheckUnknown extended option: %s fragcheck E2FSCK_CONFIGwhile opening %s for flushingwhile trying to flush %sext2fs_sync_devicePATHCouldn't malloc() newpathPATH=/sbin/dev/nulle2fsck %s (%s) Using %s, %s ext2fs_check_if_mountWarning! %s is mounted. %s is mounted. Cannot continue, aborting. check aborted.Group descriptors look bad...Superblock invalid,while trying to open %sr/or/wError Done.while resetting context%s: e2fsck canceled. aborted%s: ***** REBOOT LINUX ***** allow_cancellation %8u inode used (%2.2f%%) %8u inodes used (%2.2f%%) %8u block used (%2.2f%%) %8u blocks used (%2.2f%%) %8u bad block %8u bad blocks %8u large file %8u large files %8u regular file %8u regular files %8u directory %8u directories %8u character device file %8u character device files %8u block device file %8u block device files %8u fifo %8u fifos %8u link %8u links %8u symbolic link%8u symbolic links (%u fast symbolic link) (%u fast symbolic links) %8u socket %8u sockets --------%8u file %8u files 12-Oct-2008 @@@{@l@@@a@@@@@D@@@@@@@@@@@@@@@@@@@@@s@d@@U@@@@8@0@@@c@@@@@@N@@?@@@&@@@\|/- A?HBBE2FSCK_TIMEinvalid_inode_bitmapinvalid_block_bitmapinvalid_inode_tableinodes_countfirst_data_blocklog_block_sizelog_frag_sizefrags_per_groupblocks_per_groupinodes_per_groupr_blocks_countreserved_gdt_blocksinode_sizeclear_test_fs_flagext4clear_resizeresize dind bufferblock iterate bufferrelease_orphan_inodesTruncatingClearingrelease_inode_blocksdelete_filebuggy_init_scriptswhile calling ext2fs_block_iterate for inode %dwhile calling ext2fs_adjust_ea_refcount for inode %dpass1bad inode mapscratch_filesnumdirs_thresholdmultiply claimed block mapError1: %s on inode %u ext attr block mapcheck_ext_attrcheck_blocks_extentscheck_blocksin-use inode mapdirectory inode mapregular file inode mapin-use block mapscratch inodearray of inodes to processblock interate bufferopening inode scangetting next inode from scaninode in bad block mapimagic inode mapreading directory blockcheck_is_really_dirrecreate inodePass 1%6lu: expecting %6lu got phys %6lu (blkcnt %lld) %6lu: expecting %6lu actual extent phys %6lu log %lu len %lu reading indirect blocks of inode %uduplicate block headerinode elementduplicate inode headerblock elementclone_file_blockdelete_file_blockmultiply claimed inode mappass1bShared inode listclone_fileclone file EAinternal error: can't find dup_blk for %u returned from clone_file_blockinternal error: couldn't lookup EA block record for %uinternal error: couldn't lookup EA inode record for %uprocess_bad_inodedeallocate_inodeclear_htreedirectory scan bufferPass 2ext2fs_new_blockext2fs_new_dir_blockext2fs_write_dir_blockallocate_dir_blockext2fs_block_iterateCan not continue.check_filetypeexpand_directoryext2fs_unlinkext2fs_write_inodeext2fs_link#%uinode done bitmapPeak memoryinode loop detection bitmapPass 3lost+foundbad_inode bufferpass4: disconnect_inodepass4Pass 4free block count arrayfree inode count arraydirectory count arrayPass 5UUIDwhile reading block %lu while writing block %lu block bufferreading journal superblock %s: journal too short kdevjournal inode%s: recovering journal while trying to re-open %s.journal.dat*** ext3 journal has been deleted - filesystem is now ext2 only *** %s: no valid journal superblock found %s: won't do journal recovery while read-only L@l@l@@c@l@@@@@Warning: illegal block %u found in bad block inode. Cleared. Bad block %u out of range; ignored. while sanity checking the bad blocks inodewhile reading the bad blocks inodewhile reading in list of bad blocks from file%s: Updating bad block inode. while updating bad block inodeext2fs_read_bb_inoderead_bad_blocks_fileext2fs_read_bb_FILEext2fs_update_bb_inode/proc/filesystemsmalloc (y/n)%s%s? cancelled! yYnNyes no %s? no %s? yes noyes%s? %s e2fsck: %s while writing inode %ld in %swhile reading inode %ld in %sext2fs_read_inode_fullext2fs_read_inodeCan't allocate %s %s: Memory used: %d, elapsed time: %6.3f while allocating zeroizing buffer %s: UNEXPECTED INCONSISTENCY; RUN fsck MANUALLY. (i.e., without -a or -p options) e2fsck: io manager magic bad! writing block and inode bitmapswhile rewriting block and inode bitmaps for %se2fsck_read_bitmaps: illegal bitmap block(s) for %sreading inode and block bitmapswhile retrying to read bitmaps for %sI/O read: %lluMB, write: %lluMB, rate: %.2fMB/s $tI_store failed: %s iter fetch failed: %s dir_info iteratordirectory map dbdirinfo%s/%s-dirinfo-XXXXXXdirectory mapdx_block info arrayError writing block %lu (%s) while %s. Error writing block %lu (%s). Error reading block %lu (%s) while %s. Error reading block %lu (%s). Ignore errorForce rewriteproblemsUnhandled error code (0x%x)! 0x%06xdescriptionpreen_okno_okno_defaultprint_message_onlypreen_nomessageno_collateno_nomsgpreen_noheaderIGNORED%s. (no prompt)FixClearRelocateAllocateExpandConnect to /lost+foundCreateSalvageTruncateClear inodeAbortSplitContinueClone multiply-claimed blocksDelete fileSuppress messagesUnlinkClear HTree indexRecreate(NONE)FIXEDRELOCATEDALLOCATEDEXPANDEDRECONNECTEDCREATEDSALVAGEDTRUNCATEDINODE CLEAREDABORTEDSPLITCONTINUINGFILE DELETEDSUPPRESSEDUNLINKEDHTREE INDEX CLEAREDWILL RECREATE@i count in @S is %i, @s %j. Can't find external @j External @j has bad @S Ext3 @j @S is corrupt. Clear @jRun @j anyway@I @o @i %i in @S. @I @i %i in @o @i list. Error moving @j: %m Resize @i not valid. Adding dirhash hint to @f. @r is not a @d. @D @i %i has zero dtime. @i %i is a @z @d. @g %g's @b @B at %b @C. @g %g's @i @B at %b @C. @g %g's @i table at %b @C. @g %g's @b @B (%b) is bad. @g %g's @i @B (%b) is bad. @i %i, i_@bs is %Ib, @s %N. @I @b #%B (%b) in @i %i. @i %i has illegal @b(s). Duplicate or bad @b in use! @A @i @B (%N): %m @A @b @B (%N): %m @A @d @b array: %m Error reading @i %i: %m @i %i has imagic flag set. @j is not regular file. @i %i has a bad @a @b %b. @a @b %b has h_@bs > 1. @A @a @b %b. @i %i is too big. @h %i has an @n root node. @m @b(s) in @i %i: %b@A @i @B (@i_dup_map): %m Pass 1D: Reconciling @m @bs %Q (@i #%i, mod time %IM) <@f metadata> Couldn't clone file: %m @E has @n @i #: %Di. @E has @D/unused @i %Di. @E @L to '.' @E @L to @d %P (%Di). @E @L to the @r. Missing '.' in @d @i %i. Missing '..' in @d @i %i. i_faddr @F %IF, @s zero. i_file_acl @F %If, @s zero. i_dir_acl @F %Id, @s zero. i_frag @F %N, @s zero. i_fsize @F %N, @s zero. @i %i (%Q) is an @I @b @v. @E is duplicate '.' @e. @E is duplicate '..' @e. @A icount structure: %m Error deallocating @i %i: %m @i %i (%Q) is an @I FIFO. @i %i (%Q) is an @I socket. @E has filetype set. @E has a @z name. Symlink %Q (@i #%i) is @n. @a @b @F @n (%If). @n @h %d (%q). @p @h %d: root node is @n Duplicate @E found. i_blocks_hi @F %N, @s zero. Unexpected @b in @h %d (%q). @r not allocated. No room in @l @d. Unconnected @d @i %i (%p) /@l not found. Could not expand /@l: %m Could not reconnect %i: %m @r is not a @d; aborting. Cannot proceed without a @r. /@l is not a @d (ino=%i) Optimizing directories: @u @z @i %i. @u @i %i @b @B differences: -%b +%b@i @B differences: -%i +%i -(%b--%c) +(%b--%c) -(%i--%j) +(%i--%j)@*@.@4@=@F@M@d@k@s@|@@@@@@@@@@B@@@R@@@@%@1@9@B@L@Z@b@h@t@s@@@@@B@MULTIPLY-CLAIMED BLOCKS CLONED@b @B for @g %g is not in @g. (@b %b) @i @B for @g %g is not in @g. (@b %b) @i table for @g %g is not in @g. (@b %b) WARNING: SEVERE DATA LOSS POSSIBLE. The @S could not be read or does not describe a correct ext2 @f. If the @v is valid and it really contains an ext2 @f (and not swap or ufs or something else), then the @S is corrupt, and you might try running e2fsck with an alternate @S: e2fsck -b %S <@v> The @f size (according to the @S) is %b @bs The physical size of the @v is %c @bs Either the @S or the partition table is likely to be corrupt! @S @b_size = %b, fragsize = %c. This version of e2fsck does not support fragment sizes different from the @b size. @S @bs_per_group = %b, should have been %c @S first_data_@b = %b, should have been %c @f did not have a UUID; generating one. Note: if several inode or block bitmap blocks or part of the inode table require relocation, you may wish to try running e2fsck with the '-b %S' option first. The problem may lie only with the primary block group descriptors, and the backup block group descriptors may be OK. Corruption found in @S. (%s = %N). Error determining size of the physical @v: %m The Hurd does not support the filetype feature. @S has an @n ext3 @j (@i %i). External @j has multiple @f users (unsupported). External @j does not support this @f Ext3 @j @S is unknown type %N (unsupported). It is likely that your copy of e2fsck is old and/or doesn't support this @j format. It is also possible the @j @S is corrupt. @S doesn't have has_@j flag, but has ext3 @j %s. @S has ext3 needs_recovery flag set, but no @j. ext3 recovery flag is clear, but @j has data. Recovery flag not set in backup @S, so running @j anyway. %s @o @i %i (uid=%Iu, gid=%Ig, mode=%Im, size=%Is) @I @b #%B (%b) found in @o @i %i. Already cleared @b #%B (%b) found in @o @i %i. @f has feature flag(s) set, but is a revision 0 @f. Ext3 @j @S has an unknown read-only feature flag set. Ext3 @j @S has an unknown incompatible feature flag set. @j version not supported by this e2fsck. Moving @j from /%s to hidden @i. Found @n V2 @j @S fields (from V1 @j). Clearing fields beyond the V1 @j @S... Backing up @j @i @b information. @f does not have resize_@i enabled, but s_reserved_gdt_@bs is %N; @s zero. Resize_@i not enabled, but the resize @i is non-zero. @S last mount time is in the future. @S last write time is in the future. @S hint for external superblock @s %X. @g descriptor %g checksum is invalid. @g descriptor %g marked uninitialized without feature set. @g %g @b @B uninitialized but @i @B in use. @g descriptor %g has invalid unused inodes count %b. Last @g @b @B uninitialized. Journal transaction %i was corrupt, replay was aborted. The test_fs flag is set (and ext4 is available). Pass 1: Checking @is, @bs, and sizes @r has dtime set (probably due to old mke2fs). Reserved @i %i (%Q) has @n mode. @i %i is in use, but has dtime set. @i %i, i_size is %Is, @s %N. @b #%B (%b) overlaps @f metadata in @i %i. Too many illegal @bs in @i %i. @I @b #%B (%b) in bad @b @i. Bad @b @i has illegal @b(s). Bad @b %b used as bad @b @i indirect @b. The bad @b @i has probably been corrupted. You probably should stop now and run e2fsck -c to scan for bad blocks in the @f. If the @b is really bad, the @f can not be fixed. You can remove this @b from the bad @b list and hope that the @b is really OK. But there are no guarantees. The primary @S (%b) is on the bad @b list. Block %b in the primary @g descriptors is on the bad @b list Warning: Group %g's @S (%b) is bad. Warning: Group %g's copy of the @g descriptors has a bad @b (%b). Programming error? @b #%b claimed for no reason in process_bad_@b. @A %N contiguous @b(s) in @b @g %g for %s: %m @A @b buffer for relocating %s Relocating @g %g's %s from %b to %c... Relocating @g %g's %s to %c... Warning: could not read @b %b of %s: %m Warning: could not write @b %b for %s: %m @A icount link information: %m Error while scanning @is (%i): %m Error while iterating over @bs in @i %i: %m Error storing @i count information (@i=%i, count=%N): %m Error storing @d @b information (@i=%i, @b=%b, num=%N): %m Special (@v/socket/fifo/symlink) file (@i %i) has immutable or append-only flag set. @i %i has @cion flag set on @f without @cion support. Special (@v/socket/fifo) @i %i has non-zero size. @j @i is not in use, but contains data. @i %i was part of the @o @i list. @is that were part of a corrupted orphan linked list found. @A refcount structure (%N): %m Error reading @a @b %b for @i %i. Error reading @a @b %b (%m). @a @b %b has reference count %B, @s %N. Error writing @a @b %b (%m). @a @b %b is corrupt (allocation collision). @a @b %b is corrupt (@n name). @a @b %b is corrupt (@n value). @b #%B (%b) causes @d to be too big. @b #%B (%b) causes file to be too big. @b #%B (%b) causes symlink to be too big. @i %i has INDEX_FL flag set on @f without htree support. @i %i has INDEX_FL flag set but is not a @d. @h %i has an unsupported hash version (%N) @h %i uses an incompatible htree root node flag. @h %i has a tree depth (%N) which is too big Bad @b @i has an indirect @b (%b) that conflicts with @f metadata. Resize @i (re)creation failed: %m.@i %i has a extra size (%IS) which is @n @a in @i %i has a namelen (%N) which is @n @a in @i %i has a value size (%N) which is @n @a in @i %i has a value offset (%N) which is @n @a in @i %i has a value @b (%N) which is @n (must be 0) @a in @i %i has a hash (%N) which is @n @i %i is a %It but it looks like it is really a directory. Error while reading over @x tree in @i %i: %m Error while deleting extent: %m @i %i has an @n extent (logical @b %c, @n physical @b %b, len %N) @i %i has an @n extent (logical @b %c, physical @b %b, @n len %N) @i %i has EXTENTS_FL flag set on @f without extents support. @i %i is in extent format, but @S is missing EXTENTS feature @i %i missing EXTENT_FL, but is in extents format Fast symlink %i has EXTENT_FL set. @i %i has out of order extents (@n logical @b %c, physical @b %b, len %N) Running additional passes to resolve @bs claimed by more than one @i... Pass 1B: Rescanning for @m @bs Error while scanning inodes (%i): %m Error while iterating over @bs in @i %i (%s): %m Error adjusting refcount for @a @b %b (@i %i): %m Pass 1C: Scanning directories for @is with @m @bs File %Q (@i #%i, mod time %IM) has %B @m @b(s), shared with %N file(s): (There are %N @is containing @m @bs.) @m @bs already reassigned or cloned. Pass 2: Checking @d structure @n @i number for '.' in @d @i %i. @E points to @i (%Di) located in a bad @b. @E has illegal characters in its name. First @e '%Dn' (@i=%Di) in @d @i %i (%p) @s '.' Second @e '%Dn' (@i=%Di) in @d @i %i @s '..' @i %i (%Q) has @n mode (%Im). @d @i %i, @b %B, offset %N: @d corrupted @d @i %i, @b %B, offset %N: filename too long @d @i %i has an unallocated @b #%B. '.' @d @e in @d @i %i is not NULL terminated '..' @d @e in @d @i %i is not NULL terminated @i %i (%Q) is an @I character @v. Internal error: couldn't find dir_info for %i. @E has rec_len of %Dr, @s %N. Error iterating over @d @bs: %m Error reading @d @b %b (@i %i): %m Error writing @d @b %b (@i %i): %m @A new @d @b for @i %i (%s): %m @d @e for '.' in %p (%i) is big. Setting filetype for @E to %N. @E has an incorrect filetype (was %Dt, @s %N). @f contains large files, but lacks LARGE_FILE flag in @S. @p @h %d: node (%B) not referenced @p @h %d: node (%B) referenced twice @p @h %d: node (%B) has bad min hash @p @h %d: node (%B) has bad max hash @p @h %d (%q): bad @b number %b. @p @h %d: node (%B) has @n limit (%N) @p @h %d: node (%B) has @n count (%N) @p @h %d: node (%B) has an unordered hash table @p @h %d: node (%B) has @n depth (%N) @E has a non-unique filename. Rename to %sDuplicate @e '%Dn' found. Marking %p (%i) to be rebuilt. @E references @i %Di in @g %g where _INODE_UNINIT is set. @E references @i %Di found in @g %g's unused inodes area. Pass 3: Checking @d connectivity '..' in %Q (%i) is %P (%j), @s %q (%d). Bad or non-existent /@l. Cannot reconnect. Error while trying to find /@l: %m ext2fs_new_@b: %m while trying to create /@l @d ext2fs_new_@i: %m while trying to create /@l @d ext2fs_new_dir_@b: %m while creating new @d @b ext2fs_write_dir_@b: %m while writing the @d @b for /@l Error while adjusting @i count on @i %i Couldn't fix parent of @i %i: %m Couldn't fix parent of @i %i: Couldn't find parent @d @e Error creating root @d (%s): %m Error creating /@l @d (%s): %m Pass 3A: Optimizing directories Failed to create dirs_to_hash iterator: %mFailed to optimize directory %q (%d): %mPass 4: Checking reference counts @i %i ref count is %Il, @s %N. WARNING: PROGRAMMING BUG IN E2FSCK! OR SOME BONEHEAD (YOU) IS CHECKING A MOUNTED (LIVE) FILESYSTEM. @i_link_info[%i] is %N, @i.i_links_count is %Il. They @s the same! Pass 5: Checking @g summary information Padding at end of @i @B is not set. Padding at end of @b @B is not set. Free @is count wrong for @g #%g (%i, counted=%j). Directories count wrong for @g #%g (%i, counted=%j). Free @is count wrong (%i, counted=%j). Free @bs count wrong for @g #%g (%b, counted=%c). Free @bs count wrong (%b, counted=%c). PROGRAMMING ERROR: @f (#%N) @B endpoints (%b, %c) don't match calculated @B endpoints (%i, %j) Internal error: fudging end of bitmap (%N) Error copying in replacement @i @B: %m Error copying in replacement @b @B: %m Recreate journal to make the filesystem ext3 again? @g %g @b(s) in use but @g is marked BLOCK_UNINIT @g %g @i(s) in use but @g is marked INODE_UNINIT M-???@%c%llu0%o%.24sregular filecharacter deviceblock devicenamed pipesocket%%I%c%%D%c%lld0x%llx%%%c%.*saextended attributeAerror allocatingbblockBbitmapccompressiinodeIillegaljjournalDdeletedddirectoryeentryE@e '%Dn' in %p (%i)ffilesystemFfor @i %i (%Q) isggrouphHTREE @d @illost+foundLis a linkmmultiply-claimedninvalidoorphanedpproblem inrroot @isshould beSsuper@buunattachedvdevicexextentzzero-length@@unknown file type with mode 0%oCconflicts with some other fs @b=@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@;@N?@;@;@;@;@;@;@;@;@;@;@;@2?@;@?@>@;@>@;@;@;@;@>@;@;@;@;@;@;@;@;@;@>@>@g>@;@;@L>@;@1>@>@;@;@=@;@;@=@=@;@=@@@Q<@Q<@Q<@Q<@Q<@Q<@@@Q<@Q<@Q<@Q<@Q<@@@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@Q<@'A@Q<@@@Q<@q?@?@Q<@Q<@Q<@Q<@?@?@Q<@Q<@Q<@Q<@Q<@?@@@@@w=@<@<@]=@<@@=@<@<@<@&=@<@ =@[@l@j;@@@@d@@@@ @JBD: corrupted journal superblockJBD: Failed to read block at offset %u JBD: IO error %d recovering block %lu in log JBD: IO error %d recovering block %ld in log Assertion failure in %s() at %s line %d: "%s" JBD: Out of memory during recovery.JBD: recovery pass %d ended at transaction %u, expected %u JBD: error %d scanning journal JBD: bad block at offset %u obh != NULLrecovery.cdo_one_passjournal->j_revoke == NULLrevoke.clist_empty(hash_list)(hash_size & (hash_size-1)) == 0journal_destroy_revokejournal_init_revokerehash_dirRebuilding directoryPass 3A(root)HOME%s/%struefalseniloffA@@j@@l@@ size %s/%s-icount-XXXXXX%s: list[%d].ino=%u, list[%d].ino=%u %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x??fff?=/proc/swaps/.journalblock bitmap for inode bitmap for Invalid error codetdb_unlockall failed (%s) tdb_lockall failed (%s) tdb_unlock: count is 0 tdb_reopen: open failed (%s) TDB file lock failed in tdb_expand flvalfreelist top=[0x%08x] hash=%d freelist:Lock exists on other keyswrite not permittedtdb_brlock failed (fd=%d) at offset %d rw_type=%d lck_type=%d len=%d tdb_transaction_lock: failed to get transaction lock tdb_rec_read bad magic 0x%x at offset=%d tdb_rec_free_read non-free magic 0x%x at offset=%d - fixing tdb_rec_free_read bad magic 0x%x at offset=%d remove_from_freelist: not on list at off=%d tdb_oob len %d beyond internal malloc size %d tdb_oob len %d beyond eof at %d tdb_transaction_cancel: no transaction tdb_unlock: list %d invalid (%d) tdb_unlock: An error occurred unlocking! tdb_reopen: reopen not allowed with locks held tdb_reopen: reopen not allowed inside a transaction tdb_reopen: munmap failed (%s) tdb_reopen: WARNING closing tdb->fd failed! tdb_reopen: failed to obtain active lock tdb_reopen: fstat failed (%s) tdb_reopen: file dev/inode has changed! expand_file write of %d failed (%s) transaction_read: failed at off=%d len=%d tdb_write failed at %d len=%d (%s) tdb_read failed at %d len=%d ret=%d (%s) map_size=%d tdb_transaction_recover: failed to read recovery head tdb_transaction_recover: failed to read recovery record tdb_transaction_recover: attempt to recover read only database tdb_transaction_recover: failed to allocate recovery data tdb_transaction_recover: failed to read recovery data tdb_transaction_recover: failed to recover %d bytes at offset %d tdb_transaction_recover: failed to sync recovery tdb_transaction_recover: failed to remove recovery head tdb_transaction_recover: failed to remove recovery magic tdb_transaction_recover: failed to sync2 recovery tdb_transaction_recover: recovered %d byte database tdb_open_ex: can't open tdb %s write-only tdb_open_ex: tdb_new_database failed!tdb_open_ex: could not open file %s: %s tdb_open_ex: failed to get global lock on %s: %s tdb_open_ex: spinlocks no longer supported tdb_open_ex: %s (%d,%d) is already open in this process tdb_open_ex: failed to take ACTIVE_LOCK on %s: %s tdb_open_ex: failed to close tdb->fd on error! tdb_alloc_read malloc failed len=%d (%s) transaction_write: failed at off=%d len=%d tdb_transaction_start: cannot start a transaction on a read-only or internal db tdb_transaction_start: nesting %d tdb_transaction_start: cannot start a transaction with locks held tdb_transaction_start: cannot start a transaction within a traverse tdb_transaction_start: failed to get hash locks tdb_transaction_start: failed to read hash heads tdb_transaction_start: failed to prime hash table tdb_lock: invalid list %d for ltype=%d tdb_lock: lck->count == 0 for list %dtdb_lock failed on list %d ltype=%d (%s) tdb_free: update_tailer failed! tdb_free: right read failed at %u tdb_free: right free failed at %u tdb_free: left offset read failed at %u tdb_free: left read failed at %u (%u) tdb_free: left free failed at %u tdb_free: update_tailer failed at %u tdb_free record write failed at offset=%d tdb_delete: WARNING tdb_unlock failed! tdb_next_lock: loop detected. tdb_next_lock: On error unlock failed! tdb_firstkey: error occurred while tdb_unlocking! tdb_traverse: key.dptr == NULL and unlock_record failed! tdb_traverse: unlock_record failed! tdb_nextkey: lock_record failed (%s)! tdb_nextkey: WARNING tdb_unlock failed! bad magic 0x%08x in free list entry offset=[0x%08x], rec.rec_len = [0x%08x (%d)] (end = 0x%08x) total rec_len = [0x%08x (%d)] ERROR: failed to read record at %u rec: hash=%d offset=0x%08x next=0x%08x rec_len=%d key_len=%d data_len=%d full_hash=0x%x magic=0x%x ERROR: failed to read tailer at %u ERROR: tailer does not match record! tailer=%u totalsize=%u tdb_transaction_commit: no transaction tdb_transaction_commit: transaction error pending tdb_transaction_commit: locks pending on commit tdb_brlock_upgrade failed at offset %d tdb_transaction_start: failed to upgrade hash locks tdb_transaction_commit: failed to get global lock tdb_recovery_allocate: failed to read recovery head tdb_recovery_allocate: failed to read recovery record tdb_recovery_allocate: failed to free previous recovery area tdb_recovery_allocate: failed to create recovery area tdb_recovery_allocate: failed to write recovery head tdb_transaction_setup_recovery: transaction data over new region boundary tdb_transaction_setup_recovery: failed to write recovery data tdb_transaction_setup_recovery: failed to write recovery magic tdb_transaction_commit: failed to setup recovery data tdb_transaction_commit: expansion failed tdb_transaction_commit: write failed during commit tdb_transaction_commit: write failed tdb_transaction_commit: failed to remove recovery magic V@ V@C@L@S@lA@T@d@E@E@j@F@. @; @Q @_ @r @ @@ @ @ @offsetUnix I/O Manager@@@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@COMERR_DEBUGCOMERR_DEBUG_FILE/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ BLKID_FILE/etc/blkid.tab/devices/devfs/devDEVNOPRI%s-XXXXXX PRI="%d" %s="%s">%s %s.old %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c lrtyndurwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert 1qay2wsx3edc4rfv5tgb6zhn7ujm8ik9ol0prdIO_ULINKlwIO_LINK :/H@G@pH@G@XH@G@G@G@G@G@G@G@G@G@G@G@G@G@G@F@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@oG@QJ@oG@oG@]J@oG@oG@oG@oG@oG@oG@oG@I@EI@oG@oG@oG@oG@K@oG@oG@oG@oG@G@K@K@oG@oG@H@oG@EI@oG@oG@QJ@K@I@K@I@I@K@pL@pL@pL@pL@pL@pL@pL@PL@PL@I@I@I@I@I@I@I@K@K@K@K@K@K@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@K@K@K@K@K@K@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@I@L@%s: errno=%d console:/stdinconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/created@c@c@d@c@c@c@c@c@c@c@xd@c@c@c@c@c@c@c@c@c@c@Pd@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZn@m@m@m@m@m@m@m@m@m@m@m@m@m@n@n@m@m@m@m@m@m@m@n@n@m@m@m@m@n@m@m@n@v@r@r@r@r@r@r@r@r@r@r@1v@u@r@s@s@r@u@r@r@r@r@r@v@v@r@r@p@r@v@r@r@v@|@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@|@w@w@w@w@w@w@w@w@w@w@{@w@{@w@w@|@_PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 @Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@@Յ@Ղ@@Ղ@Ղ@Ղ@@@Ղ@Ղ@Ղ@t@Ղ@Ղ@Ղ@Ղ@@^@J@"@Ղ@ׄ@Ղ@@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@Ղ@@@Ղ@@x@Ղ@Ղ@@Ղ@^@Ղ@Ղ@.@$@Ղ@@Ղ@΃@Ղ@ă@Ղ@Ղ@@Ղ@T@:B@>B@BB@GB@KB@OB@SB@WB@[B@_B@cB@gB@kB@rB@zB@B@KB@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@C@B@A@ C@F@A@!C@3C@3C@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d wdDEV_LISTDEV_REG SERV_GET;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK REGDRV tcpip%02x:%02x:%02x:%02x:%02x:%02x%d.%d.%d.%dzR| AB E< 'AB E\(_AB E`W@FZ\_d @<{@P@@@@@P@P@P4@<@ @D@ p@  @ @ @  @ @8@l@@@@@@  @@@@@@+%@,,@ h@!@"@#3@$G@@%(@ &`@ '@ (@)`@*@-<@.`@/@0v@1@2@38@4@5d@6@7@8@90@:P@;@@@@@@@@@@@ @ 9@ V@ h@ s@@@@@ @ @@@ D@ @@ @@h@ @ @@@@@@@@ @!@" @#L@$@%@&x@' @(@)@*@+(@,@-B@/7@0d@1@2@3@4(@5T@6T@p7x@8@9@:n@;@ <@=H@ >@?@ @h@A@B@C@ D@E@F4@G`@H@I@J@K@L,@M\@ N@ O@P@S @QP@R@T@U@V(@ WX@ X|@Y@Z@[D@\@]@^@,@@@`@@@@@ (@0@0\@02@0N@0@0@0B@0B@0^@@@w@@@<@@@h@ @ @ @ @ @/@L@h@@@@@@ p@@@@@@@@L@@l@ @ !@ "@#@$@ %@&:@' @(@@)W@0m@1@2@3p@4@5@6@7 @8@:H@;@<@=l@>@?@@@A@B@CD@D@E@F@G@@-@A@U@p@@H@@@ x@ @ @ @ 4@p@@@@@ @@@@@@@@d@@ @;@@@#@2@@@@@@<@@P@A@U@A@@@Z@@n@1@ s@1@ @@ ,@@ `@@ @@@@@@@|@@@x@A@@A@@1@@1@@0@d@ 0 @P `p7C@#@5@<@D@@@N@U@^@g@p@{@@@@@@@@@@@@@@&@/@;@C@K@X@p@+W/@`@@@@@@ę@<@@@@@@}2@2@2@3@ 3@@3@3@@3@83@p@3@83@h@@83@@3@83@@3@83@@3@43@@3@@4 3@@3@@4 3@@3@@43@@3@3@@3@@3@@4@@ 4@@4@@ 4@X@4@R4@@4@R4@@4@6(4@@4@6.4@@4@674@@4@@4@8@4@B4@8@4@D4@8@G4@M4@G4@P4@G4@S4@G4@V4@Y4@^4@Z4@c4@@h4@n4@<@w4@{4@4@4@ @4@4@4@ 4@4@4@ 4@4@4@ 4@4@4@ 4@4@4@ 4@4@4@ 4@4@4@ 4@4@4@ 4@@4@ 4@@4@ 4@<@4@5@@4@5@@4@5@@4@5@@4@3@X@4@O3@X@4@R3@X@]5@3@@4@\5@4@4@4@4@5@ 5@@5@ D3@H@5@ 5@H@5@ %5@H@5@ 5@@5@ D3@H@5@ 5@H@5@ %5@H@5@? 5@@5@? D3@H@5@? 5@H@5@? %5@H@5@ 5@@5@ D3@H@5@ 5@H@5@ %5@H@5@ 5@@5@ D3@H@5@ 5@H@5@ %5@H@43@ /5@@95@?5@@95@?5@@95@?5@@95@?5@@F5@Q5@l@X5@a5@X5@f5@k5@r5@H@k5@r5@H@k5@r5@H@k5@r5@H@4@4@4@4@4@4@4@6@6@6@6@6@6@@ 7@7@@!7@)7@67@A7@K7@U7@ c7@@m7@y7@H@7@7@@ @@G @7@7@7@_9@{@c9@{@P_9@h9@{@_9@m9@{@ _9@_9@c9@h9@m9@B@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2@@1jt@<L@\ @z&Z3$/@FLl4@goL@M@oNd@&T@es'@D@i@,۔@w@B &@N.@>=1@ 3@<9@eR[(B@Z}J@|L@lP@3U@yi@D]`@y܀@yX@),@t @%@'@:@N<@F e@2 H|@@x@" @@н@@G@ @oST@;@< @3P@ k@S),@I@^e8@ @sݿ@@,@@W&@w@GMD@-@# P'(@7(@M/@" ^1@)o02@]7@k ę4A@nP@: @*  @[,h@k@?8,@4J`@`@9@0,@9ԧ@VC ,@<@@ @"@x+d@d/d@be@4uh@GSiD@o@ op8@Vq@ns@Su@y@(}8@'%`@_, @u@3?P@V0@u@K>`@Q+@)@[@m@</@.@>@@-dp@J7@@@ P@D@  @ @g3@!̫ @MLp@6:@ @y@"@0*@]*@;1,@)-@M-@`.@eP1@Pp1@a>1@7$ 2@4@5@0@5@976@08@d8@@<@ rP<@E@|JE@E@E@ P@,pQ@QR@W@"`h@( i@@3! @'@)p@,@?-P@U0P@4P@4p@9@f;@=@S?@@?`@ j@p@B@@pC`@IP@AL@M`@NO@@9jcrc32_be^<} @dict_set_allocatordict_free_nodesdict_init*dict_lookupdict_insertHdict_firstdict_lastdict_nextedict_prevdict_allow_dupesdict_count(dict_isemptyVdict_isfulldict_containsdnode_initdict_alloc_insert[dnode_getdnode_getkeydnode_destroy dnode_createp %e2fsck_clear_progbarle2fsck_simple_progressmain{%e2fsck_global_ctx%e2fsck_tbl|Z30e2fsck_rune2fsck_reset_contexte2fsck_allocate_contextje2fsck_free_contexte2fsck_passesAL"check_backup_super_blockZcheck_super_blockoA?l e2fsck_pass1_check_device_inode"e2fsck_use_inode_shortcuts$e2fsck_clear_inode/(e2fsck_setup_tdb_icount(e2fsck_pass1_check_symlink8e2fsck_pass1)) %e2fsck_pass1_dupblocks<N+e2fsck_process_bad_inodee2fsck_pass2#e2fsck_expand_directorye2fsck_adjust_inode_count e2fsck_get_lost_and_founde2fsck_reconnect_filee2fsck_pass3s'.7e2fsck_pass4D1%Ve2fsck_pass5di +Osync_blockdevmark_buffer_dirtybuffer_uptodatemark_buffer_uptodatee2fsck_fix_ext3_journal_hintdo_cache_destroyll_rw_block wait_on_bufferF brelse getblkZ"journal_tag_bytesc#journal_bmap%e2fsck_run_ext3_journal&do_cache_create'e2fsck_check_ext3_journal)e2fsck_move_ext3_journal'۔read_bad_blocks_filew!)ext2_file_typeXcheck_for_modulesfs_proc_checke2fsck_zero_blocks)get_backup_sb?init_resource_trackpreenhalt)ask_ynask(string_copyfatal_errore2fsck_write_inode e2fsck_write_inode_fulle2fsck_read_inode_fulle2fsck_read_inodeue2fsck_write_bitmapse2fsck_read_bitmaps e2fsck_allocate_memory print_resource_track+R2e2fsck_get_num_dirinfo$e2fsck_dir_info_get_dotdote2fsck_dir_info_get_parentYe2fsck_dir_info_set_dotdote2fsck_dir_info_set_parente2fsck_dir_info_itere2fsck_dir_info_iter_end#e2fsck_dir_info_iter_beginte2fsck_add_dir_infoe2fsck_free_dir_infoNqe2fsck_get_dx_dir_infoe2fsck_get_num_dx_dirinfoe2fsck_dx_dir_info_itere2fsck_add_dx_dir_e2fsck_free_dx_dir_info7=Sqehandler_operationehandler_initvvset_latch_flagsget_latch_flagsfix_problemMclear_problem_contextwend_problem_latch'<Lyprint_e2fsck_message<R["4!journal_skip_recovery!journal_recoverDZ},region_allocateregion_freeregion_createc!vjournal_test_revoke journal_clear_revokejournal_init_revokeIjournal_destroy_revoke_cachesjournal_init_revoke_cachesjournal_set_revoke journal_destroy_revokeext2fs_get_refcount_sizeea_refcount_intr_beginDea_refcount_intr_nextea_refcount_storeLea_refcount_decrementea_refcount_incrementea_refcount_fetch\ea_refcount_free ea_refcount_createB%e2fsck_rehash_dir#e2fsck_rehash_directoriesprofile_set_syntax_err_cb5profile_iterator_createprofile_iterator_freefprofile_release profile_iterator profile_get_stringprofile_get_booleanprofile_get_uintVprofile_get_integerprofile_set_default$profile_inith]initialize_prof_error_table_rBinitialize_prof_error_tableet_prof_error_tablehinitialize_ext2_error_table_rBinitialize_ext2_error_tableet_ext2_error_tablejext2fs_set_alloc_block_callbackVext2fs_get_free_blocksext2fs_new_blockext2fs_alloc_blockAext2fs_new_inode/)KWext2fs_reserve_super_and_bgdt ext2fs_set_block_alloc_stats_callback/ext2fs_inode_alloc_stats2ext2fs_inode_alloc_statsext2fs_block_alloc_statsR%Iext2fs_u32_list_findext2fs_u32_list_testext2fs_badblocks_list_test#ext2fs_u32_list_delzext2fs_badblocks_list_delext2fs_u32_list_iterateext2fs_badblocks_list_iterate9ext2fs_u32_list_countfext2fs_u32_list_equalext2fs_badblocks_equalext2fs_u32_list_iterate_end2ext2fs_badblocks_list_iterate_end\ext2fs_u32_list_iterate_beginext2fs_badblocks_list_iterate_beginext2fs_u32_list_addext2fs_badblocks_list_addext2fs_u32_copyBext2fs_badblocks_copyext2fs_badblocks_list_createext2fs_u32_list_create)'eext2fs_update_bb_inodeE: 6ext2fs_get_block_bitmap_rangeext2fs_get_inode_bitmap_rangeext2fs_set_block_bitmap_range7ext2fs_set_inode_bitmap_rangeext2fs_compare_inode_bitmapext2fs_compare_block_bitmapext2fs_resize_block_bitmapHext2fs_resize_inode_bitmapext2fs_clear_block_bitmapext2fs_clear_inode_bitmapext2fs_fudge_block_bitmap_end(ext2fs_fudge_inode_bitmap_endvext2fs_allocate_block_bitmapext2fs_allocate_inode_bitmapXext2fs_set_bitmap_paddingext2fs_copy_bitmapext2fs_free_block_bitmapext2fs_free_inode_bitmapANext2fs_block_iterate2Qext2fs_block_iterate/eext2fs_bmap2 ext2fs_bmap$H|eext2fs_check_descext2fs_bg_has_super<ext2fs_super_and_bgd_locQext2fs_update_dynamic_rev<ext2fs_flushext2fs_closegext2fs_group_desc_csum_setdext2fs_set_gdt_csum]ext2fs_group_desc_csum_verify"Aext2fs_get_num_dirsext2fs_set_dir_blocknext2fs_dblist_countext2fs_dblist_get_lastext2fs_dblist_drop_lastext2fs_dblist_sortcext2fs_dblist_iterate*ext2fs_add_dir_block ext2fs_copy_dblistdext2fs_init_dblist,-ext2fs_dblist_dir_iteratezext2fs_read_dir_block2.ext2fs_read_dir_blockuext2fs_write_dir_block2ext2fs_write_dir_block!ext2fs_dirhashZAext2fs_process_dir_blockext2fs_dir_iterate2ext2fs_dir_iterate~ $ext2fs_ext_attr_hash_entryext2fs_read_ext_attrext2fs_write_ext_attrext2fs_adjust_ea_refcount S|Xext2fs_extent_header_verifyext2fs_extent_get_infoaext2fs_extent_replaceext2fs_extent_getext2fs_extent_delete ext2fs_extent_gotoext2fs_extent_insert7ext2fs_extent_set_bmap~ext2fs_extent_freeYext2fs_extent_open%;ext2fs_sync_devicem<ext2fs_free_dblistLext2fs_u32_list_freeext2fs_badblocks_list_free&ext2fs_free3Pext2fs_get_generic_bitmap_startext2fs_get_generic_bitmap_endext2fs_fudge_generic_bitmap_endext2fs_set_generic_bitmap_paddingGext2fs_unmark_block_bitmap_rangeext2fs_mark_block_bitmap_rangeext2fs_set_generic_bitmap_rangeext2fs_get_generic_bitmap_range_ext2fs_clear_generic_bitmapext2fs_resize_generic_bitmapext2fs_make_generic_bitmapext2fs_copy_generic_bitmapext2fs_allocate_generic_bitmap:ext2fs_warn_bitmap2ext2fs_test_generic_bitmapext2fs_test_block_bitmap_rangeext2fs_mark_generic_bitmapext2fs_unmark_generic_bitmapkext2fs_free_generic_bitmapext2fs_compare_generic_bitmap&kEext2fs_get_pathname)) *ext2fs_get_device_sizeXI+ext2fs_iblk_add_blocksext2fs_iblk_sub_blocksext2fs_iblk_seteext2fs_get_icount_size$ext2fs_icount_validateext2fs_free_icountext2fs_create_icount2ext2fs_create_icount]ext2fs_create_icount_tdbext2fs_icount_storeext2fs_icount_fetchext2fs_icount_incrementext2fs_icount_decrementC+ext2fs_write_ind_blocksext2fs_read_ind_blockݿO!ext2fs_flush_icacheext2fs_set_inode_callback1ext2fs_inode_scan_flagsext2fs_inode_scan_goto_blockgroupzext2fs_get_next_inode_fullbext2fs_get_next_inodeext2fs_write_inode_fullext2fs_write_new_inodeext2fs_write_inodeext2fs_read_inode_fullext2fs_read_inodeFext2fs_check_directoryext2fs_get_blocks ext2fs_close_inode_scanext2fs_open_inode_scanx,Iio_channel_write_byteio_channel_read_blk64io_channel_write_blk64Wio_channel_set_optionsG#ext2fs_check_mount_pointext2fs_check_if_mounted&Qext2fs_link wext2fs_llseek Mext2fs_lookup-#ext2fs_default_journal_sizeext2fs_zero_blockscext2fs_create_journal_superblockAext2fs_add_journal_inodedext2fs_add_journal_device'P'ext2fs_new_dir_block7Oext2fs_get_data_ioext2fs_set_data_ioext2fs_rewrite_to_io ext2fs_descriptor_block_locext2fs_open2`ext2fs_open'Mijext2fs_read_bb_inode? ^ext2fs_read_bb_FILE2iext2fs_read_bb_FILE-o1ext2fs_create_resize_inode]gEext2fs_write_bitmapsext2fs_write_block_bitmapext2fs_write_inode_bitmapext2fs_read_bitmapsext2fs_read_block_bitmap=ext2fs_read_inode_bitmapę6a ext2fs_tdb_error ext2fs_tdb_errorstrext2fs_tdb_increment_seqnum_nonblockext2fs_tdb_name<ext2fs_tdb_fdjext2fs_tdb_log_fnext2fs_tdb_get_seqnumext2fs_tdb_hash_sizeext2fs_tdb_map_size1ext2fs_tdb_get_flags_ext2fs_tdb_enable_seqnumext2fs_tdb_set_max_deadVext2fs_tdb_set_logging_functionext2fs_tdb_get_logging_privateext2fs_tdb_unlockall_readDext2fs_tdb_unlockallrext2fs_tdb_lockall_unmarkext2fs_tdb_lockall_read_nonblock'ext2fs_tdb_lockall_readUext2fs_tdb_lockall_nonblockext2fs_tdb_lockall_markext2fs_tdb_lockall<ext2fs_tdb_transaction_cancel$ext2fs_tdb_chainunlock_readaext2fs_tdb_chainunlockext2fs_tdb_chainlock_unmarkext2fs_tdb_close.ext2fs_tdb_reopenxext2fs_tdb_reopen_allAext2fs_tdb_transaction_recover>ext2fs_tdb_open_exext2fs_tdb_openi ext2fs_tdb_transaction_startr!ext2fs_tdb_lock_nonblock!ext2fs_tdb_chainlock_nonblock4#ext2fs_tdb_exists#ext2fs_tdb_parse_record$ext2fs_tdb_fetch(ext2fs_tdb_delete(ext2fs_tdb_firstkey)ext2fs_tdb_traverse_readQ*ext2fs_tdb_traverse,ext2fs_tdb_store.ext2fs_tdb_append/ext2fs_tdb_validate_freelistq0ext2fs_tdb_chainlock_read0ext2fs_tdb_chainlock_mark0ext2fs_tdb_chainlocku1ext2fs_tdb_nextkey1ext2fs_tdb_printfreelistU3ext2fs_tdb_dump_all4ext2fs_tdb_transaction_commit6tdb_null"ubunix_io_manager ext2fs_unlink0 !ext2fs_inode_has_valid_blocksM,?ext2fs_parse_version_stringext2fs_get_library_version%kext2fs_warn_bitmap8ext2fs_crc16Jhet_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#Perror_table_namef_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hook^6fblkid_gc_cacheblkid_get_cachepblkid_put_cache#blkid_debug_mask9 blkid_dev_devnameblkid_dev_iterate_end1blkid_dev_next~blkid_dev_iterate_beginblkid_dev_set_searchNblkid_free_devblkid_new_dev`C `Iblkid_strndupblkid_strdupblkid__scan_dirblkid_devno_to_devname#"blkid_read_cache<oKblkid_get_devnameblkid_get_tag_value$ blkid_flush_cache"blkid_tag_nextblkid_find_tag_dev1blkid_dev_has_tagblkid_find_dev_with_tagJblkid_tag_iterate_endublkid_free_tagblkid_tag_iterate_beginKblkid_parse_tag_string2blkid_set_tagLx+Ublkid_probe_all_newblkid_probe_allblkid_get_dev6d/o6Ublkid_known_fstypeS/blkid_verify%eblkid_get_dev_sizeuhblkid_llseekSi_ uuid__generate_randomuuid_generate_randomuuid__generate_timeuuid_generate_timeuuid_generateonuuid_is_nullopWuuid_packqYuuid_unpackMs4huuid_unparseuuid_unparse_upperuuid_unparse_lowerSue2p_jrnl_string2featureLe2p_string2featuree2p_edit_feature2e2p_edit_feature]e2p_jrnl_feature2stringe2p_feature2stringy=__divdi3(}__udivdi3%__umoddi3, isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper6?%errnoQuinit_memory_managerfreeZmallocrealloccalloc?dstrtolVoqsortuostrncmp>ostrncpy+dstrrchr-^strncasecmp strcasecmp[omemmovemdstrcat/dstrchrdstrcmpdstrcpydostrdup7ostrlenomemcpymemset 9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoulDlibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerE timer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*3nsyscall_psyscall_v̫agetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsLhtonlhtons$ntohlQntohs~hstrerrorgetprotobynamegetservbyname3inet_ptoninet_atongethostbynameinet_ntop]inet_ntoaherrorh_errno:runlink7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatoaccessRPlgetoptoptargoptindoptopt+opterr=optreset%1getppidgetpid0iolinkreadlink!symlinkKMfgetpagesizeisattyforkpipegethostnameichmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstategettimeofdayFPtcsetattrHtcflushcfgetospeedtcgetattr<>getuidgeteuidgetgidgetegidG$vwaitpid,waitXwait_child_addqinit_waitpidutimexstrerrorY=seekdiryrewinddirtelldirreaddir3closedir_opendir%7_vmktempmkstemp'Zrpcsend_message4 io_remove_linkio_create_linknyieldRr,io_split_filenameio_get_absolute_pathZio_split_dirnamedget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"Jnset_rpc_handler#yadd_intr_handlerQD vfscanf vscanfIscanffscanfvsscanf@ sscanfJa)vfprintffprintffprintf_putsn+fprintf_putc;,g]asprintf_putcvasprintfasprintf}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr# Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6"_exit2abortGatexit{exiti  'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf87srandsrandomrand random{3! gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF'0vprintfcprintfprintf_putsnprintf_putc8)sprintf_putcQvsprintfsprintf,a_assert;-~]snprintf_putcvsnprintf!snprintfU0Pdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read 4ysyscall_timer4dinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name9lio_seekW;string_to_ip)register_netcardmac_to_stringip_to_stringV=create_shared_memoryopen_shared_memoryclose_shared_memory ?ysyscall_putsn!?get_tick_countqj@mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6Bnwait_for_rpcv_and_wait_for_rpccpCppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvIlist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createLstrcspn(MQd__strtok_r strtokNOomemchrfJ@@q@aintQB5L_7ewmV,(e'ehr .Z%1H id2# 3# pid4# '5# 7# 8z# 79z# :A# -`4N %/{ f0} {GP@q@-FZ,ppbFLFz٢HyI3c-vgl3d@@k@@q<V7IY +,3jbt@J@aintQ_wmV,(Orh]A8Ovalދt@J@2 crc^ p lend b tab @@- @@F @@] qǠ@&@vvd0@B@ qޠA}G@y CjL@@aintQ_wmVg%or,~,v. 0#\1#2#J3# 4#'5#   9s; " 37 XPnilXya3@7@@nilX$X X>XL18@x@"al7fr^90 6x@@X"5nil7X$7XP@@*"OOdDO-X@Z@"%$XunilXXg3 2\@@H"1 X>1X?1u3Xnil3X4X !4X4Xg53 \X@@> "[j nil]X$]XR ]X RlX@@ "k nilmX$mXR\mX ~X@$@ e"}< }Xg nilXX  X X$@o@ "% XP nilXX \X p@@ "d@@ ("3@@: V"93@@f "3@@ "X>XX@@ 'X'C3@5@ ["B B'BX>DXX 8@C@ 'X D@O@ 'XIP@Y@ 'XD \@e@ X>X0Xh@@GS 'newX WX@@s0%j@"/@1haintQB5S_7lwmylV,(l'lG 01r .a%1`id2#3`#pid4#'5# 7#8#79#:H#-<#:=f#! % HH>`4l   % : 5 ! "Z#ot ## %DIR &l] S5 Z ,3 8l( J:  bsr sA  # # #$ #  #x #B # # #? #   PS Q# S T# O5| R U ] ^#N _# `# a#g b# dj e# f#C g# h#V i# j# \ c5" k C, D#v E#E F# G## H#  I#L J# K# L# M#B N#  V#$S W,#( X#d Y#hK Z#l; [#pt l#t < *  # # # #  #Q #C #n #J # ( #$ #( #,W #0 #4& #6D #8xJ #:: #< #> #@ #D #Hu #L #P #R} #T #XA #Z #\ #` #d8S * #h : #x !J # "# '# (#+ )#y -* # .# /# 0#? 1Z #@ 2#v 3# 4# 5# 6#K 7#X 8j # 9#6 :#] ;#N <#] =#D ># ?# @# A#_ B# C# D#n E#Q Fz # :  %J  %Z ? j  z   0   #] # #n  # %  A ' r ' #h #p :# -   [  !# "#!f zv BC DE GH    t !C #nD#1oEG #hF] # ;qGx #]pI #pK #JL] #-]N # 'pP #$pQ#(]S(#,C]UM#0PVS#4  `R !" # # #n$`#%:# 63, #33 #O4:#˙5:#P6 # p7#XW8#\] c  j <:#P=:# >s#.?s#  ::    : :    '   A :A  '  ]  M  x  : c   : ~   :         R   ( s:   M s: . c_n t_7! #io #˙:#Q`# K’#,l# :#ŗ #5&ƺ# ǘ#$:#(C#,= N#0˾#4w#8>.#<#@i#D| Y#HG {#L #PTՒ#T !#X#\nowؤ#`P'#d` #\=# #c## = f7g7bpd jsdB   < ( cv    cv  c  cv     7 7 ]c ]  Cc : i, j !* 3binocv #d:#e:##f3# sg# gq:# r #˙s:#j#t # u #|v #w #wx # .,K2 #2 #2 # # s#.s#$v  Om $ * fsc#5˅#`#Q`# `#˙:#:#<с #@ҁ # ,:#$~ԁ #(:#,u֝#0[ #4ۺ#X #\EC#`C#dC#h C#lC#pC#t N#xd N#|N#!##O# #R##T #` :#M `#Av #U#X v #T :#x1)# :# :#3/# p#":# #:#( #)`#/#s5:#~ 6:#7:#8l#9:#B :5# :5#=#># ?#, @#A#KB#r C#.D# E# F#G#H#eI#J#K#L# M#N#! OE#nowR#S# T:#>U#$V:#` \#::   #  %E U3@  #inov #v #dirv # #5 #blk # # < #(Z:#0num#4str#<  4j< k:#^rl<# :L:kfsc J@@!ctxI"-T @1 @#JtS$errS#S:%U4 @y @ &ctx6' :_(f_(de(tmpk)k)&~k)l(de{ w  %{O "4 | @ @al&ctx*fsct}++ l+}A+ :+:+,- ../(/3~/>}.I7.Tc0 : @@)&ctx1 1)`1l2i:+l*tv2 d+ :<+p :Z3%$@&4u)tbls56s:5s:maxt:6v) 7:@@x,&ctx16:$cur&maxU*buf,w3)\,0h8f8Z8N8B-9r %=:;PRS^ 5y]:5]59 ] 6J_:6: I`6J`  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S !#h  1#x  !A#  "# '#  (# + )# y -!#  .# /#  0# ? 1Q# @ 2# v 3#  4#  5#  6# K 7# X 8a# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q Fq# 1  %A  %Q ? a  q   BC D$EH o%  t  ! C#n D#1o E] #h Fs # ;q G #]p I #p K #J Ls #-] N # 'p P #$p Q #(] S> #,C] Uc #0P Vi #4   ` h ! "# ##n $# %:# 63 , #3 3' #O 4:#˙ 5:#P 6- # p 7#XW 8#\ s y   j <:#P =:# >]#. ?]#  :v:   : v:&  o= W :W  = s  c   :y   :   :        h  >  ]: c  ]: D oy _  _M!#io #˙:#Q# K¨#,V# :#Ţ#5&ƙ# Ǯ#$:#(Y#,= d#0#4w#8>.#<+#@i+#D| o#HG ӑ#L #PTը#T 7#X#\now؃#`P=#d` #\S# #y##S fMgMbpzszB 3/y y y %y % 1 M Msy sYy :,j ! *3b4inoc#d:#e:##f3# sg# gq:# r#˙s:#j#t# u#|v#w#wx#4.,K### # ]#.]#$v#)Om :@ fsy #5#̠#Q͠# Π#˙:#:#<ь#@Ҍ# ,:#$~Ԍ#(:#,uֳ#0#4ۙ#X 3#\EY#`Y#dY#h Y#lY#pY#t d#xd d#|d#!##O# #R9#9#T 9#` :# M # A# U%# X # T :# x1E# :# :# 3K# # ":# #:# ( # )# /# s5:# ~ 6:# 7:# 8V# 9:# B :Q# :Q# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! Oa#nowR# S# T:# >U# $V:# ` \#:3/:: ? %a  q k|/ptrp:$/@/@- ctx/-!i:."q*.V3/@!3@H. ctx2/t.#i4:$1@1@b%&1@1@'.$1@1@%&1@1@'.(2@.2@%&2@.2@'.G),&ptrppr$3@3@.d*retd+e1/"z/"0/,%%-.//33@j4@N/  ctx/z/$4@24@%&4@24@0tx$94@Y4@%&94@Y4@0tx(Y4@e4@%&Y4@e4@. q 1% ,X@" jl4@L@~ aintQ_wmyOV,(O)OG 0h1r  !# "#h ! ] ] A5 H ,, 8O( J3  bVr s:  # # #$ #  #x #B # # #? #    P S Q#  S   T# OB| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ cB" k C9 D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V #$ S W9#( X#d  Y#h K Z#l ; [#p t l#t I  7  # #  #  #  # Q # C # n $# J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S 7#h  G#x  !W#  "# '#  (# + )# y -7#  .# /#  0# ? 1g# @ 2# v 3#  4#  5#  6# K 7# X 8w# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A/# _ B#  C#  D# n E# Q F# G  W  g ? w     0   # ] #  # n #  BC D/E G:H h E  U [  t , ! C4 #n D? #1o E #h F # ;q G #]p I/ #p KT #J L #-] NT # 'p Pt #$p Q #(] S #,C] U #0P V #4 7 = `  ! "4 # #J #n $# %3# 63 ,h #3 3 #O 43#˙ 53#P 6 # p 7z#XW 8z#\    : j <3#P =3# >V#. ?V#4 h , 3zo34 : 4 , 3 o34   n h 4 ? 3 ,  4 ,  4 , 3  4 / , 3z  4 T , 3 5 4 t , ? ? Z 4 ,   z 4 , V3z  4 , V3  h _  _!4 #io, #˙3#Q# K$#,O# 3# #5&Ɲ# *#$3#(#,= #0P#4wk#8>.́#<ϧ#@iѧ#D| #HG  #L #PT$#T ֳ#X#\now؇#`Pܹ#d` z#\#, ###  fgbp sB   I E4 J J  04 k  V4  q4        4       3 ,# )j : @!*Q W3binoc#d3#e3##f,# sg-# g-q3# r#˙s3#j#t# u) #|v) #w) #wx) # .,K### z# V#.V#$v Om Ŷ  Őfs #5? ##Q# #˙3#3#<#@# ,3#$~#(3#,u/#0#4۝#X ޯ#\E#`#d#h #l#p#t #xd #|#!##O# #R##T #` 3# M # A# U# X # T 3# x1# 3# 3# 3# # "3# #3# (, # )# /3# s53# ~ 63# 73# 8O# 93# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T3# >UF# $V3# ` \z#33  3   ]    3@4 #ino##dir# #5#blk # # < #(Z3#0num/#4str? #< h(,3ctx-#buf.#/3#G03# 13#2 #33#643# 54 #$ 6dfs5 Z5 sfs 4 ptrz pz3fs !k3l4@y5@/N"ctxj/#fsl 0$tfsm tp%zn4 <0#go e0 sbp#retq30&|5@5@0'ctx0(4? 1(?71(˙31(1( 1)<C3TA^ B*>35@7@1 'fs8 2(9JP2(: p2+5;+<3(` =z73,pb? -ctx@tl.A3W3-blkBtp.zC33//Y<6@0i6@z6@W112m7@7@3ig33.#g33,bphJ ??fs> Z> 4pZfs 5U4'ctx3 fs5 6667 i836836h83 j9 blk:6Q:6:6;'6;'6z<4 77a44889 :R3;ctx,fs ,ino<<<>M >3,pb,fs @2>@1NA?>@>@1NA9>@?@L1W1LBM#111&A??@?@=1NA?@@@@W1NA?]@@l@@q1NAd@@@@1sA?@@@@1NAd@@A@1sBZ  1hC`9tD}D~E8Eb9E9E:EX:99E:E:E-;F 7E@FsE@Ad0H@9H@Kn 1sAdoE@sE@ Gs;HE@E@12E@E@9B-!1>C9I9S9^Di|Dt~9FbL@0d>B@BB@!Gs;Bq!111G<1C8DE<E=Ed=A+L@AL@&!12+L@AL@9HbL@xL@)12bL@xL@9Bdp!1sA2C@C@O("1+CE7=DB~9NHdC@C@Gs=A?C@C@B"1NAdED@ND@>\"1sAdD@D@v"1sAdD@E@;"1sAdE@F@"1sAdG@G@7"1sAdfH@lH@"1sHdH@H@ 1s=?UjL@@aintQ_wmyOV,(O)OG 0h1rh  !# "#! ]  ] A5 H ,, 8O( J3  bVr s:  # # #$ #  #x #B # # #? #   A% #F # #w # #  PZ S Q#  Ss  T# O| RA UZ ]  ^# N _#  `#  a# g b# dN j e#  f# C g# h# V i#  j# \p c" k C D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  Vs#$ S W#( X#d  Y#h K Z#l ; [#p t lN#t     S #    # ~|   E  # N #  #  # g #  j #  # C # # V #  #  " Et rg s# v t# E u# v# # w#  x# L y#  z#  {#  |# B }#  #$ S #( #d  #h K #l ; #p t #t N #  # N # / # f # U #  # L # U  # #  #  #  # Q # C # n $# J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S U #h  e #x  !u #  "# '#  (# + )# y -U #  .# /#  0# ? 1 # @ 2# v 3#  4#  5#  6# K 7# X 8 # 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A/# _ B#  C#  D# n E# Q F # e  u  ?      0   # ] #  # n  #  BC D/E G:H hc  s y  t J ! CR #n D] #1o E#h F # ;q G(#]p IM#p Kr#J L #-] Nr# 'p P#$p Q#(] S#,C] U#0P V#4 U [ ` ! "R # #h #n $# %3# 63 ,#3 3#O 43#˙ 53#P 6# p 7z#XW 8z#\   Xj <3#P =3# >V#. ?V#R J 3zo3R XR J 3o3R  h R ] 3J R J R (J 3R MJ 3z.R rJ 3SR J ] ] xR J R J V3zR J V3 h  fQ # # # #   #P  #C # #m # #v8 # __!R #ioJ #˙3#Q# K-#,O# 3#1 #5&Ɲ# 3#$3#(ɧ#,= ʲ#0Y#4wt#8>.͊#<ϰ#@iѰ#D| ҽ#HG #L #PT-#T ּ#X#\now؇#`P#d` z#\#J ### fgbps ino #blk #3#B !'gER S S 9R t _R zR  p  R & & & 36j Q7& # {8& # ?9# :#=v|D0f& g3# 5h3# ii3# j3# k3# l3# Em& # un& # %o#( p#,r28-,JPjag!*x~3binoc #d3#e3##f,# sgT# gTq3# r #˙s3#j#t # uG #|vG #wG #wxG #.,K### z# V#.V#$vOm  ŷfs#5] #̫#Qͫ# Ϋ#˙3#3#< #@ # ,3#$~ #(3#,uV#0#4۝#X #\E#`#d#h #l#p#t #xd #|#!>#>#O# #R##T #` 3# M # A # U# X  # T 3# x1# 3# 3# 3# # "3# #3# (J # )# /Z# s53# ~ 63# 73# 8O# 93# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T3# >Um# $V3# ` \z#333     a &3@R #ino # #dir # #5#blk& #& # << #(Z3#0num/#4str] #< h0OinoP #QO#~QO#QO#QO#RO#RO#RO#~S #T # U< # V3#W #X# Y#$cZ#(ctx[#,,^&ino_ #`p#cOctxd#M e#6 zfs5Z51 Q3TOP J3THI <C3TA^ B ,53*T3^ 4 k3VTi^ j :_~T]^ ^ ? fs>Z>1 ! pfsGR ,&ptrz"ppz s fsR A ptrz"pzH l fsFG#3L@M@= $fs%>&i3/>'[3M@'M@M>!(ay>(b>)!)9!*ret3>!+' R (M@rM@>!(fs >(ino  ?, SX?*ctx ?*i 3?' R tM@M@?!(fs ?(ino  @- *ctx B@'c R M@N@`@H"(fs @(ino  @, @*ctx A'q R N@GN@A"(fs BA(ino  bA.ctx R/5 HN@N@A"(ctx4 A,344 3A*fs6 B<3 #T:^ ; 0x' N@O@"B#(fs& NB(blk& & nB,& 3B"ctx( 1, x#223"/ 2"2"' R O@qO@B$(fs C, & =C4ret  "ctx 5z R QC5A  C/AtO@P@C$(ctx>C(ino> C,?D,,?3FD,@] fD6zO@O@G$226zO@O@H$226zO@O@J$227zO@O@L228P@~P@D2%9ctxD%D5E8P@P@-Ei%9ctxYE%E0P@IQ@E%(ctxE(ino|F:,7P@P@220Y(LQ@?R@?F&(ctx&kF,O&F,M 'F,@'3F))&:*,.fs+t*blk, F5=-)G:9.3tp0. @R@T@GG/((ctx, sG,Ā,  G,Z, 3G,n- ] G(num- 3H,A- SSH.fs/ t:0  t51  sH"i2 3"buf3 :4 ,1~< '227OR@R@@2m2b6R@R@B '26R@S@E '22; S@S@<6T@T@S '226 vT@T@b (2* ;vT@T@<6 3H 2/T@U@H((ctxH,˙3H(ret(I:eOtt:L tp5zR ?I:tl:3th>#33U@wW@]I)9fsI9ino I%J9bufJ&lenOJ&i3J= K=SjIK>>Q T?^GV@@A 2_ 2T A)ctx^  ),!!!'(3xW@t[@uK+(fsK,SK,< K- -3,` z9L"p+*blk qL5Ā L*i1 L5+M.ctxtBX@6W@ X@*226PY@fY@*226fY@uY@+226.Z@=Z@-+223)2)2)C0D)6VZ@Z@p+2q2e7*Z@Z@ 2I2='3t[@ `@TMw-(fsM,SM,< M- -3,` z0N"p+:t*blk PN5\3yN5r'3N.ctxtBHx\@1)Ht,2)2)C`D)6V_@_@,2q2e6*]@]@ ,2I2=7V ^@^@2q2e3)r2)2)CD)6V_@_@:-2q2e6*^@^@ Y-2I2=7V^@^@2q2e0[ `@f@.Oc/(ctxWZO,WzO(pbX+O,Y& O,ZjP:Q\ P*blk] .P5^< xP*i_OP)`3)$`3)r'aR :bBxBa@1).2)2)CD)~6V@e@Ze@.EqP2e6*zd@d@ .2I2=7Vd@d@2q2e3)2)2)CD)~6V c@"c@&/2q2e6*b@c@ E/2I2=7Vb@b@2q2eFQ3!0ctxOOM P"fsR"inoS )T"blkU "endV)W&)X!0)9Y3)(8ZGoH0)g!!fA0ctxpb+)))j"fs"ino )zR F31ctxino M )$ 1"fs )z R "blk  0f@y@P64(ctx Q,*Q,M JQ.fst~.pb.ino t~:t~53jQ53Q5\3R5,&/RIout o@108XK22020202020C`J0.SJ0SJ1TJ1T1c/%32/2/2u/CJ/UJ/UJ/Uj@2I2=L 3)'gx3L 35< X1'0 -42M02A0250C DX0~Jd0QYJp0YJ|0ZJ0.[J0m[;r@Ss@5E64[0y@z@/\4(ctx[\,M \*i3\:Qt~:= t~:] t~.buf4~:, 4 O'MnR z@;{@\\5(fsk\-}l&,Zm1 ],` mz:])o\5*ctxpZ]&A 5ctx "fs "b  "i 1 "j 3) ,!!!!!!Aj5ctx),A6ctx),A^h6ctx]]"sb_-)`h6)}an6"minb3"maxb3A7ctx  "sb-)h6)!0)"end)O)O)r'3MfixON)g$Ad7ctxbuf))5)] )zR "blk "i3)]3)X3!A.m 7ctxl "fsn "io 1 )Āp  !Ov8PfsuNN<6 /<{@@x]>(ctx]*i3])+/.fst}*ino G^)5}&f_)M :Z5nA_5A_:,~:&X.sb-t}5] `5 3a5\3a53!b53bB P@BY@L( 9.pb~7@@22LP 95>0b6@@n92 1b5p r:2p5C J|51c<5J5mdJ5dD5}6@@ :226@@ >:E'e26@@ ]:226@"@ |:226@@ :227@@@ 226 @@}:2* ;@@<6 6 @@~ ;2* ;@@<6 15 /;25C D5}QD@@I;"ehpz6@Dž@h;226Dž@߅@;2264@E@;226؆@@;2216 p<2 626C J,6[e<76l2=6x@@=226@@*=2 Lx [=)r'J37@@L226 ,@@@`=2* ;,@@@<6 6@@P@3=226+@<@=2265@@=25C D5}6@@ >22673@`@'d>27;3@`@<7<7J7l7O@@s EmmEbjm6 @@X>2* ;@@<6 6 @@\>2* ;@@<6 6 @@]>2* ;@@<6 3A 2_ 2T >k? }@>l3$}@ //? >&n?@}@)j@c@daintQ_wmyOzsV,(OG 0s1rh s  !# "# ! ]   ] A5 H ,, 8O( J3  bVr s:  /#  /# /# $ #  # x # B #  # # ? # /   PS Q/#  S6 T/# OX| R U ] ^#N _# `# a#g b/# dj e# f#C g# h#V i# j/# \3 cX" k CO D#v E#E F/# G/## H/#  I/#L J/# K# L# M/#B N/#  V6#$S WO#( X/#d Y/#hK Z/#l; [/#pt l#t /_  M /# /# /# /#  /#Q /#C /#n :#J /# ( /#$ /#( /#,W /#0 #4& $#6D #8xJ #:: #< #> /#@ /#D /#Hu /#L #P #R} /#T #XA #Z /#\ /#` /#d8S M#h ]#x !m# "/# '# (#+ )#y -M# ./# //# 0/#? 1}#@ 2#v 3# 4# 5/# 6/#K 7/#X 8# 9/#6 :/#] ;/#N <#] =#D >/# ?# @# AE#_ B/# C# D#n E#Q F# ]  m  } ? /  /  / 0  /#] # #n #  B/C/ DEE/ GPH/ U [  t , ! C# n D# 1o E # h F # ;q G # ]p I/ # p KT # J L # -] NT # 'p Pt #$ p Q #( ] S #, C] U #0 P V #4 7 = `  ! "# #J # n $# %3# 63 ,h # 3 3 # O 43# ˙ 53# P 6 # p 7#X W 8#\    : j <3# P =3# >V# . ?V#h , 3z3:  , 3 z3 n s   3 ,   ,   , 3 / , 3 T , 3 5 t , Z  ,   z  , V3  , V3  s _  _ !#io, # ˙3# Q# K$# ,O# 3# ) # 5&Ɲ# *#$ 3#( #, = #0 P#4 wk#8 >.́#< ϧ#@ iѧ#D | #H G  #L /#P T$#T ֳ#X /#\now؇#` Pܹ#d ` # \# , # # # fgbpsB _[J  J 0k  V q  3 /      3r#)-,;Aj RX!*io3binoc # d3# e3# #f,# sgE# gE q3# r # ˙s3# j#t # u? # |v? # w? # wx? #., K# # # # V# .V#$vOm  Ũfs # 5˶# # Q# # ˙3# 3# < # @ # ,3#$ ~ #( 3#, uG#0 #4 ۝#X #\ E#` #d #h  #l #p #t #x d #| # !/# /# O# # R# # T # ` 3#M #A #U#X  #T 3#x1# 3# 3#3# #"3# #3#(, #)#/K#s53#~ 63#73#8O#93#B :# :#=/#>/# ?/#, @/#A/#KB/#r C/#.D/# E/# F/#G/#H/#eI/#J/#K/#L/# M/#N/#! O#nowR#S# T3#>U^#$V3#` \#333 u   / 3@ #ino #  #dir # # 5#blk #  # <4 #( Z3#0numE#4str#<g%,~,.L 0L# \1L# 2L# J3# 4 # '5#9s;hn3  <R=)4?I cAR# B# C# ED]# E#$ pF#( 0G#, H3#0)L8} ^ 9 # x:}#T # x?#!B C3# E!D#P!N!dirO # P3# Q3# 3 R}#htctx#ino # O 3# # t#! _9`3#z a # b #!xy#dirz #buf{#ctx|# <C3+TA^ B J3WTHI Z X3TVW <3T:^ ; ,53T3^ 4 Q3TOP G>,& ptr!pp"! Y fs   ptr!p"p fs # j3@@}m$ai m%bi &iakh&ibkh')!k3@m@m(dire )e3m)5f,n*ng3 *,h3(bufi)` jbn!sdl+pmn+nnn,W@,@v-v-jz. x-/ctxv/inov /blkv 0w&ny&dbz-&di{1s |}1k!}'A3p@@nZ(fs; )<Jn*=4 *5> *?3)` @7o!pBZ+ctxCo2@@J--2+њ@@S-J->3 U4tl4tp5o-6 7o7 p7 )p88!!'  3@@hp9ctxp)  p+fs! p:Ā" p;i#) tp<@@q- 9ctxCq)^  lq9p-q,˜@ڜ@--'Z!3@7@qS!9fs q)J"r)4 Br* *3)` r!p-:A s:zJs!csS!+ns;ctxt`2@#@!--2 @@7!--,@7@--'!$38@۞@s?"(fs )Js* 4 *! *"3)` #7t!pb%Z!p&-+n'Wt+ctx(ut2X@d@0#"--,@@:--.r!"/ctx0M &fs &ino 131}!pb!=>?y!" ctxM !fs !sdz=?# ctxM !fs !p!t!q-=!#!ino =!3!i3=+ 3= 3=!n!m!s}!r>@@8x A 3$ ctx ino dpM !fs =z!cs=!blk !n=k!!db-!diBVIC$@82>>@@8x? C % ctxA inoA dpBM B!fsD !pbE!=F3=G=9HO>>D ܞ@@t($ctxtEM tFfs ]uG~H?" %-W"-L"6@ 7b"{u7l"uIw"|7" vI"I"~,W;@G@-v-jH"  &-"-"6 7")vI"XI"~J" - #-"6 8#8 #7*#hv74#{v8>#8J#7V#v7b#w7l#dw7x#wI#~7#w7#x7#Wx7#x2@@ &5x2Y@@&-lK@@8xL#X'-#-#-#-#6x8 $7$xI!$HI,$}78$By7D$y7N$y7Z$6z7e$rzMp$J@LY'-l68x2>@@'5Mz2W@@'-v-j,@@-&-K@@82,$Ǧ@ب@ -$-$-$-$67$zI$I${I$}7$/{2@@W_(--,@@p--N @'@g{(EX>{Oe1&db-Fp{Px{N> (@c@{7)EX>|Oe1&diFp}F|Px}d|G!b3}@G!c3}@G eI}@G!eI}@G!g~@+j$d@S@#aintQ_wmyOV,(OhG 0h1rz  !# "#! ]  ] A5 H ,, 8O( J3  bVr s:  # # #$ #  #x #B # # #? #   6% #F # #w # #p$ _g #^ #)# Ԉ# #9 #  P S Q#  S  T# O| R U ]1  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c" k1 C D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V#$ S W#( X#d  Y#h K Z#l ; [#p t l#t     # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S #h  #x  !#  "# '#  (# + )# y -#  .# /#  0# ? 1 # @ 2# v 3#  4#  5#  6# K 7# X 8 # 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q F! #   z  z ?   !  1 0 |  # ] #  # n | # z BC D$E G/H h z    t  ! C #n D #1o Es #h F # ;q G #]p I #p K #J L #-] N # 'p P #$p Q/ #(] ST #,C] Uy #0P V #4   ` ~ ! " # # #n $# %3# 63 , #3 3= #O 43#˙ 53#P 6C # p 7#XW 8#\     j <3#P =3# >V#. ?V#   3o3   6  36 o3 <  hS  m  3m  S   y   3   3   36         )  ) ~   T  V35  y  V36 Z h _  _c! #io #˙3#Q# K#,O# 3#ŭ #5&ƙ# #$3#(o#,= z#0!#4w<#8>.R#<x#@ix#D| ҅#HG #L #PT#T ք#X#\now؃#`P܊#d` #\# ###i fcgcbps ino #blk #3#B :     <  ' R B r  rX~        3,j  !*"(3binoc #d3#e3##f,# sg# gq3# r #˙s3#j#t # u #|v #w #wx #.,eK### # V#.V#$vpvOm Ň afsʏ #5 #̠#Q͠# Π#˙3#3#<ї #@җ # ,3#$~ԗ #(3#,u#0#4ۙ#X ހ#\Eo#`o#do#h o#lo#po#t z#xd z#|z#!##Oe# e#R##T #` 3# M # A # Ur# X  # T 3# x1# 3# 3# 3# # "3# #3# ( # )# /# s53# ~ 63# 73# 8O# 93# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T3# >U# $V3# ` \#3|3a3 . z   Q$ 3@~ #ino # #dir # r#5~#blk # # < #(Z3#0num$#4str #<1 g%,~,. 0#\1#2#J3# 46 #'5#9s;,23G6 6 2a>!b>"b?bc3a?id3>#d3@}3e>#f3-Amx 113BC @@ 1D@@B)E@ @ !16;@F@18#r3!!ctxn|!dboE!bufpq!"fss "blkt %^ u%v+++FFB)*<#"!fs 5~~n""cp%\3%]3%OO8"b3"!ctx_|5`~!inoa a!%[$c~%#d3%h"e3%]f3%#f3%r'g38""3#!ctx|5~!ino !%]3%r'3 p#!fs /".3F#!fs- !ino- 8"3#!ctx|5~Z" !"i3%"3"ret38#3$!ctx|5~Z" !% #3%=3%+++*"$!fs !dbE!cd$2M %$$"ent$%#%%!"i3%~#3%93"blk % %| %g %# G#{6_ #&%!fs HN#3H@S@i$fs $dbEE)` e/2/!%5~/~/g d/nO+% /c$3,/"3/]3M. t|Iino t|/c# M/ "cd$Ibuft|Ictx|t|/r'3/$$k%#%./5$3"ret3J"H@Jp"|@JxRq@J"~@E4@͹@'1S1GK*%ZN3%"$O E#o@v@R'1#0"8m'1"1"1"1"3h4"4"E4@@&'1S1G0#I(1#1#1#1#3B#4#ώ5$}E4@@ (1S1GE4@@,(1S1G64@.@1S1G0F# (1|#1p#1d#1X#D@d@4#P4#4#E#@@(1#E4@@(1S1GE#-@E@(19#1.#E4@"@ )1S1GE#@@$)1#E4@@C)1S1G0!0\)1!1!1!1!3PB!B!4!ΐ4"#0"xj)1P"1D"18"1,"34\"4h"4t"4"p4"4"\6@@10$!*1Y!1M!1B!16!38Be!4p!4|!L5!~E@@j*11E@@*11E@@*L6 @@1D@@B)0$gW+1P$1D$19$1.$1#$3B\$4h$Bt$4$yB$B$4$Ζ4$jB$B$B$4$՗M$G@E %@@xq+1%."  ~@#j$T@@+haintQ_wmyVV,(VG 0o1r%  !# "#! d  ] H5 O ,3 8V( J:  b]r sA  # # #$ #  #x #B # # #? #    P S Q#  S  T# O7| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c7" k C. D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V#$ S W.#( X#d  Y#h K Z#l ; [#p t l#t >  ,  # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S ,#h  <#x  !L#  "# '#  (# + )# y -,#  .# /#  0# ? 1\# @ 2# v 3#  4#  5#  6# K 7# X 8l# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q F|# <  %L  %\ ? l  |   0   # ] #  # n # % BC D$E G/H o: % J P  t ! ! C) #n D4 #1o E #h F # ;q G #]p I$ #p KI #J L #-] NI # 'p Pi #$p Q #(] S #,C] U #0P V #4 , 2 `  ! ") # #? #n $# %:# 63 ,] #3 3 #O 4:#˙ 5:#P 6 # p 7#XW 8#\    / j <:#P =:# >]#. ?]#) ] ! :v:) / ) ! : v:)  c o ) 4 : !  ) !  ) ! : ) $ ! : ) I ! : * ) i ! 4 4 O ) !   o ) ! ]: ) ! ]:  o _  _!) #io! #˙:#Q# K#,V# :# #5&ƙ# #$:#(#,= #0E#4w`#8>.v#<Ϝ#@iќ#D| #HG #L #PT#T ֨#X#\now؃#`Pܮ#d` #\#! ### fgbpsB  >:) ? ?%) ` K) v f)  |  )   :,j /5!*FLx1 WinoX#("Y#j#Z#3binoc#d:#e:##f3# sgY# gYq:# r#˙s:#j#t# u #|v #w #wx #.,K### # ]#.]#$vOm  żfs #54 #̠#Q͠# Π#˙:#:#<#@# ,:#$~#(:#,u$#0#4ۙ#X #\E#`#d#h #l#p#t #xd #|#! # #O# #R##T #` :# M # A# U# X # T :# x1# :# :# 3# # ":# #:# (! # )# /_# s5:# ~ 6:# 7:# 8V# 9:# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O #nowR# S# T:# >U;# $V:# ` \#:::  %    3@) #ino##dir# #5#blk## < #(Z:#0num$#4str4 #<$_fs` # j#a# 8%b:#ctxc# %num:# %:# %:# :# err) #ctx#Z X:TVW,5:T3^ 4J: THI) 3ptrp ! Nfs  =%ifs pfs !~$) T@<@ "ctx"dir"num:#%:4$fs T%z) r&esT'~G) W,&ptrpp($:<@@"fs #,? # p)):#` es%$h%^ %z) ؛&ctxt`* @@D+,@@-(*@%@c++. 8+?+3/P-K'%T~@!R%6) @@ "ctx5C"ino5"adj5:ݜ&fs7 t~%z8) '9~!%q@@s"ctxp"fixp:՝$fsr $inosA$blktm%zu) 'v~%^ wD'y*\@j@++*@@ ++*&@4@*++*4@A@I++* @@r+,@@-('nxx#Լ@!l%:@@|#"ctx"ino $fs p%z) 'n#~''}%. : %3 O0%@@"ctx>"inog#j#$fs %z) Ρ&fp\'1i@@+x2$53ctx4fs 4blk55^ 566666708-(66669w:ctxdirfs ino:j#:%::$:6666; %5@@"zF7"?9_?;~=dir<"֢>$=+>9=t@%Z@Ah_!+/-BC}BC~D3@ @ǭ +BD@@ ++D@@ ++D2@B@!++D@'@%!++D @@M!+,@@-(D@@k!++D@@!++D@@!++EN@@F]QDT@d@c!++D@@r!++G5s+_+S+G/-k-vBBɤB*@@Ba"++*@@0"++*@@#"F+1i@@7FxpR((%k:@@b##5f)ng:),h:Hbufi #` j2fplb#%zm) R'n %x# h#?$1\~@?$2X~@*Jj&@@;0haintQ_wmyVV,(VG 0o1r%  !# "#! d  ] H5 O ,3 8V( J:  b]r sA  # # #$ #  #x #B # # #? #    P S Q#  S  T# O7| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c7" k C. D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V#$ S W.#( X#d  Y#h K Z#l ; [#p t l#t >   W S #  p  # ~| > W   # N #  #  # g # K j #  # C # # V #  # m " t r  s# v t# E u# v# # w#  x# L y#  z#  {#  |# B }#  p#$ S .#( #d  #h K #l ; #p t K#t N #  # N # / # f # U #  # L #   # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S  #h   #x  ! #  "# '#  (# + )# y - #  .# /#  0# ? 1' # @ 2# v 3#  4#  5#  6# K 7# X 87 # 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q FG #   %  %' ? 7  G  W 0   # ] #  # n  # % BC D$E G/H o %    t  ! C #n D #1o E#h F# ;q G#]p I#p K#J L#-] N# 'p P4#$p QU#(] Sz#,C] U#0P V#4   `  ! " # # #n $# %:# 63 ,(#3 3c#O 4:#˙ 5:#P 6i# p 7#XW 8#\     j <:#P =:# >]#. ?]# ( :v:   \ :\v: b. oy   : y    :  :  :\ 4    O O : z ]:[  ]:\ o __! #io #˙:#Q# K#,V# :# #5&ƙ# #$:#(ɕ#,= ʠ#0#4w+#8>.A#<g#@ig#D| ҫ#HG #L #PT#T s#X#\now؃#`Py#d` #\# ### fgbpsB  :     +  A1 a aGm      :,j !*3bpinoc #d:#e:##f3# sg# gq:# r #˙s:#j#t # u #|v #w #wx #p.,TK### # ]#.]#$v_eOm v| Pfsʵ#5 #̠#Q͠# Π#˙:#:#<ѽ #@ҽ # ,:#$~Խ #(:#,u#0#4ۙ#X o#\E#`#d#h #l#p#t #xd #|#!##OT# T#Ru#u#T u#` :# M # A # Ua# X  # T :# x1# :# :# 3# # ":# #:# ( # )# /# s5:# ~ 6:# 7:# 8V# 9:# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T:# >U# $V:# ` \#:ok:P: { %   3@b #ino # #dir # a#5b#blk # # < #(Z:#0num$#4str #<W pfsZ X:TVW %: !ctxk!i "a#fs$$} $&&!:%% 7ptr&p'%Z@@(ctxYk)fs[)i\ $]a*_*a~+%b:+&bf)bufc+Zd:*$&d:,VI@-@@..-@@-..- @@K../h...012~3Y3-h@@K.w4he@t@R5w- @@. 6@@1,- @@. 6@@1,49@E@..-% jd&@@2haintQ_wmyVV,(VG 0o1r%  !# "#! d  ] H5 O ,3 8V( J:  b]r sA  # # #$ #  #x #B # # #? #    P S Q#  S  T# O7| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c7" k C. D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V#$ S W.#( X#d  Y#h K Z#l ; [#p t l#t >  ,  # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S ,#h  <#x  !L#  "# '#  (# + )# y -,#  .# /#  0# ? 1\# @ 2# v 3#  4#  5#  6# K 7# X 8l# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q F|# <  %L  %\ ? l  |   0   # ] #  # n # % BC D$E G/H o: % J P  t ! ! C) #n D4 #1o E #h F # ;q G #]p I$ #p KI #J L #-] NI # 'p Pi #$p Q #(] S #,C] U #0P V #4 , 2 `  ! ") # #? #n $# %:# 63 ,] #3 3 #O 4:#˙ 5:#P 6 # p 7#XW 8#\    / j <:#P =:# >]#. ?]#) ] ! :v:) / ) ! : v:)  c o ) 4 : !  ) !  ) ! : ) $ ! : ) I ! : * ) i ! 4 4 O ) !   o ) ! ]: ) ! ]:  o _  _!) #io! #˙:#Q# K#,V# :# #5&ƙ# #$:#(#,= #0E#4w`#8>.v#<Ϝ#@iќ#D| #HG #L #PT#T ֨#X#\now؃#`Pܮ#d` #\#! ### fgbpsB  >:) ? ?%) ` K) v f)  |  )   :,j /5!*FL3binoc#d:#e:##f3# sg"# g"q:# r#˙s:#j#t# u #|v #w #wx #.,K### # ]#.]#$vOm ū Ņfs #54 #̠#Q͠# Π#˙:#:#<#@# ,:#$~#(:#,u$#0#4ۙ#X ޤ#\E#`#d#h #l#p#t #xd #|#! # #O# #R##T #` :# M # A# U# X # T :# x1# :# :# 3# # ":# #:# (! # )# /(# s5:# ~ 6:# 7:# 8V# 9:# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T:# >U;# $V:# ` \#::: R %   3@) #ino##dir# #5#blk## < #(Z:#0num$#4str4 #<'TL'Tk: Ti^ j! $fs  p?fs sZfs ) ptr p&T&'T'~:T|}Z X:TVW=%7fs J:cTHI<C:TA^ B,5:T3^ 4!&O@@"ctxM #r'M:5#N$&pV%ctxo&fsq &ir'Kr'Y&s'Zt:'u' v'&w:'&x:'Tx:'y'r'z:'A&z:'h'z:'n'z:'z{) '%|:'N&}:(VIL(z'.)|'*+'J'^J'J'1&:*<''++++++++++++++++,,-y.~&QctxP fsR iS/TV/&U:/V:/ZW:/XV/Y&Y/B'Z/&[:/T[:/z\) /]/r'^:/A&^:/h'^:/n'^:/%_:/N&`:(VI%(z'(|'*{/'+++++++++++++++++++*,-y,,-y.&+ctx* fs, end-/l&- i-/.++++.'WVctxV fsX endY/'Y iY/Z+++++0&@@"ctx!1(1~2/n 34-5)A-2-=5H_5S5^5i5t5p6}-5۬5j55ح5-5\7@7@7@8?@@Hx3N8$@@>338 m@w@)3960~:@,@;3:@@339-5ծ5 5-5Y:@@F3:j@u@_3:E@S@x3:p@|@3:@@3:@@38Z@ @M3m<@ @-y:@@ 3:@ @ 38?U@_@<8 3N8$@@0R 33=$@@J;32V2#3d4-p5{5ͯ50555Y--5556~- 55!5-ֳ5995E7Q@7Y@7a@8$@ @W!338$@@ q!338?4@=@!3N8@@!3+9h!6n}8h@y@!338@@}!38@@| "38S@^@v%"38:@H@i?"38s@|@iY"38@@os"38@@p"38Z@@&"3m<@@-y8Z@@'"3m<@@-y8@@v"38S@b@#;38x@@;#338?@@U#3N8?W@`@!o#3N8$@@#33=$@@#;3T25_$34-55ݵ-6}8@@@$;387@@C)$;Vj3J8@@EC$3+=$@@G;3>83 4-5"5.'-:6D}8 @@r$38@@p$;S38@'@^$38cz@@m%;q3v=$@@t;3+#j^@@'8aintQ_wmyOV,(O,(O=-)O ((O)O+*O=(+OEm,3,-O .OG 0h1r4 `9, a# b#, c#+ d# o) e|#* f#}) g#7 i#, k# n, l#$* m#(' n#,' o#0h   !# "# ! ]  ] A5 H ,, 8O( J3  bVr s:  4# 4# 4#$ #  #x #B # # #? # 4    P" S Q4#  S;  T4# O]| R  U" ]  ^# N _#  `#  a# g b4# d j e#  f# C g# h# V i#  j4# \8 c]" k CT D# v E# E F4# G4# # H4#  I4# L J4#  K#  L#  M4# B N4#  V;#$ S WT#( X4#d  Y4#h K Z4#l ; [4#p t l#t 4d  R  4# 4#  4#  4#  4# Q 4# C 4# n ?# J 4# ( 4#$  4#(  4#, W 4#0  #4 & )#6 D #8 xJ #: : #<  #>  4#@  4#D 4#H u 4#L  #P  #R } 4#T  #X A #Z  4#\  4#`  4#d 8S R #h  b #x  !r #  "4# '#  (# + )# y -R #  .4# /4#  04# ? 1 # @ 2# v 3#  4#  54#  64# K 74# X 8 # 94# 6 :4# ] ;4# N <# ] =# D >4# ?#  @#  AJ# _ B4#  C#  D# n E# Q F # b  r   ? 4  4  4 0   4# ] #  # n  #  A) L )#;)\#@]) #@3#@, #@!3#@ *3#@+3#@ B4C4 DJE4 GUH4 h       t !C #nD #1oE #hF # ;qG #]pI #pK#JL #-]N# 'pP%#$pQF#(]Sk#,C]U#0PV#4  ` !" # # #n$#%3# 63, #33T #O43#˙53#P6Z # p7z#XW8z#\   j <3#P=3# >V#.?V#   3zo3   M  3M o3 S  hj    3  j      3   3z   3M   %     @ @ + k V3zL  V3M q h __z! #io #˙3#Q# K#,O# 3#Ź #5&# #$3#(Ɇ#,= ʑ#0#4w#8>.2#<X#@iX#D| Ҝ#HG Ӿ#L 4#PT#T d#X4#\now#`Pj#d` z#\# ### fzgzbpsB d`      2" R R88^ 4z z    3,j!*3bainoc #d3#e3##f,# sg# gq3# r #˙s3#j#t # u #|v #w #wx #a.,EK### z# V#.V#$vPVOm gm Afsʦ#5 ##Q# #˙3#3#<ѣ #@ң # ,3#$~ԣ #(3#,u#0#4#X `#\E#`#d#h #l#p#t #xd #|#!##OE# E#Rf#f#T f#` 3# M # A # UR# X  # T 3# x1r# 3# 3# 3x# # "3# #3# ( # )# /# s53# ~ 63# 73# 8O# 93# B :~# :~# =4# >4# ?4# , @4# A4# KB4# r C4# .D4# E4# F4# G4# H4# eI4# J4# K4# L4#  M4# N4# ! O#nowR# S# T3# >U# $V3# ` \z#3`\3A3 l   4  (\#( #)8#("w,#\#)$3# (*37+43#n*5 )Od,X*`k(#U,3#* #+ # (!3#'"#"+##,$#)%# ,%#$3,&#(+'#,,(3#0b))O#4**O#8'(+#<--,B#@(-B#Dv).R #H*/#XM)0B#\( )#Q4# },4#'4#)4#%-4#;+?# 4#$4#(4#,8SR #00)4#@`(4#D+4#H,4#L-#PX(#,P* iQj4#-k4#w+l4#*m 4 + +ՋQ$ 43@ #ino # #dir # R#5#blk # # < #(Z3#0numJ#4str #< ,, A h  #s%fs  Optrz!pz"@,_@@ٷ#I,^$io` G")+@@e%bh &'3@@%bh "'@@ %bh %val3';*@3@W(ctx\)d3R* -@1@+,*34@l@((fs˦T#t# )Σ )3)` z-p.blkӣ R/+3l@J@|0ctx\'1sbG2~2|G3e4st5 .@4@6  $"*fL@U@)&te7"C+kX@S@غ (rwj3(nrj3T(bhpj 7zl3$bhm  "*T@@޻F (bh ",@@* (bh V*%@@+88@@9D&N,E @)@v #I,D),D ),D3$bhF :[-,@@#3!;)3!O1ctx\x2M<)Q!=bh :O+@@T"0ctx\½;)3!;T3;)3=1jsbT"]>9!@@!+F!>%@$@"+88@$@?D}>%+@K@."+88+@K@?D5%K@W@+88K@W@9D&|*no@@"#)m3!Ѿ@( @@"0ctx\(;"\1sbAe733',3@( @[@c#;)3!4ctx\t1jsbT"X4jbh tp2&a*/3\@@##).3!)^ . ) .#B4Cz5 PBQ6 #,( @@7%(ctx\c#C-%.pbX.sbtvC,dvC~$bh B'(7],BO-oB 7)3!Bz 7.  Cth7/*3Bf+3DVIt @DE(," @>%@@$%+88@@9D>%@@M%+88@@9D>%@@v%+88@@9D8 @* @2V|3!E+$ %ctx#\A%A)&3!Az'3FVIKGG/*S3@~@d&0ctxR\3. T A,U33zV 3(V H%Hb+%I`J%?%b?%K%@> =@G@@&+5 b@f@F+&)]@@&%len\37+^E)x @'ctxu\L)v3!Lw"!sbyAe7z3Ms(K'ctxI\jsbIT"L)J3!!pLM'NNvalO !uP|'A)Q4!iR3/,3@@I4)0ctx\u1sb3)3! Ae7323r'M3T3`3,33z3F$,O&(+'+'+'I?('93'H@'6f'%6Z'T+N'I9r'J'X9'9'> @@ )6}O P)65 <@E@+ /".3_)fs-ino- Q3)LTOLP =%)fsP)@@*0ctx\1sb228~!fs1ino #3z O1cpp AZ323dD*@> /@;@{*+>4)@@*6R)+G)>_)@@*+~)+r)5)@@+) * 2/(*@*Qt @(j-@@B>aintQB5L_7ewmyeV,(e'eG 0~1rh ~ .Z%1v id2# 3v# pid4# '5# 7# 8# 79# :A# -<# :=|#!AH>`4    !# "# ! s ] L5 S ,, 8e( J3  bl   #  # # $ #  # x # B #  # # ? #   PS Q# S T# O| R U ]s ^#N _# `# a#g b# dj e# f#C g# h#V i# j# \ c" ks C D#v E#E F# G## H#  I#L J# K# L# M#B N#  V#$S W#( X#d Y#hK Z#l; [#pt l#t %    # # # #  #Q #C #n  #J # ( #$ #( #,W #0 #4& #6D #8xJ #:: #< #> #@ #D #Hu #L #P #R} #T #XA #Z #\ #` #d8S  #h # #x !3 # "# '# (#+ )#y - # .# /# 0#? 1C #@ 2#v 3# 4# 5# 6#K 7#X 8S # 9#6 :#] ;#N <#] =#D ># ?# @# A#_ B# C# D#n E#Q Fc # #  3  C ? S  c  s  B C D E H   t !C# nD# 1oE9 # hFO # ;qGj # ]pI # pK # JLO # -]N # 'pP #$ pQ #( ]S #, C]U? #0 PVE #4  `D !"# # # n$v# %3# 63, # 33 # O43# ˙53# P6 # p7#X W8#\O U  j <3# P=3# >l# .?l#  33   3 3  ~  3 33   O  ? j  3U   3p   3        D    l3 ?  l3  ~U  _` f  _) ! # io # ˙ 3# Q v# K # , e# 3#  Ŕ # 5& Ƴ#  Ǖ#$  3#(  5#, = @#0  ˻#4 w #8 >. #<  #@ i #D | K#H G x#L #P T Տ#T #X #\ now ؝#` P $#d ` # \ :#  #  `#  |#/ f) g)b pV\ sVg wVB %!U s ~ U s U  U s   4 4ZU  Z @|U  3f, j!* 3b inocs # d3# e3# #f,# sg#  g q3# r~ # ˙s3# j#t~ # u # |v # w # wx # ., K# # # # l# .l#$v Om !'  fsU # 5# v# Qv# v# ˙3# 3# <~ # @~ # ,3#$ ~~ #( 3#, u֚#0 #4 ۳#X #\ E5#` 5#d 5#h  5#l 5#p 5#t @#x d @#| @# !# # O# # R #  # T  # ` 3#M v#As #U #X s #T 3#x1,# 3# 3#32# b#"3# #3#( #)v#/#s53#~ 63#73#8e#93#B :8# :8#=#># ?#, @#A#KB#r C#.D# E# F#G#H#eI#J#K#L# M#N#! OH#nowR#S# T3#>U#$V3#` \#333 & H  X s-~3@#@fszU ({T |3 ` } !-$@4@"fsU "blk~ #-4@@wctx-_3r$fsU %z&-mtp$f wa'buf!}(-t@ )*jY3!k*j.@&@/@aintQB5L_7ewmyeV,(eh'eG 0~1r .Z%1`id2#3`#pid4#'5# 7#8#79#:A#-<#:=f#!  AH>`4l  # )/ ~. *. ]. / . / . . . / / w. 1. $/*0 e/ "0 N/ #J/ #/ #/ # 0 N# ^^    !# "# ! s^] L5 S ,, 8e( J3  bl   # # #$ #  #x #B # # #? # ^ PS Q# S T# O| R U ]9 ^#N _# `# a#g b# dj e# f#C g# h#V i# j# \ c" k9 C D#v E#E F# G## H#  I#L J# K# L# M#B N#  V#$S W#( X#d Y#hK Z#l; [#pt l#t ^   # # # #  #Q #C #n #J # ( #$ #( #,W #0 #4& #6D #8xJ #:: #< #> #@ #D #Hu #L #P #R} #T #XA #Z #\ #` #d8S  #h  #x ! # "# '# (#+ )#y - # .# /# 0#? 1 #@ 2#v 3# 4# 5# 6#K 7#X 8 # 9#6 :#] ;#N <#] =#D ># ?# @# A#_ B# C# D#n E#Q F) #  ^ ^ ^?  ^ ) ^ 9 ^BC DEH ~     th !Cp #nD{ #1oE #hF+ # ;qGF #]pIk #pK #JL+ #-]N # 'pP #$pQ #(]S #,C]U#0PV!#4s y ` !"p # # #n$`#%3# 63, #33 #O43#˙53#P6 # p7#XW8#\+ 1 v j <3#P=3# >l#.?l#p h 33p v p h 3 3p    ~ ^ p  { 3 h  p + h  p F h 3 1 p k h 3 L p h 3 q p h { {  p h    p h l3  p h l3  ~1^_< B _!p #ioh #˙3#Q`# K`#,e# 3#Z #5&ƺ# f#$3#(#,= #0ˌ#4w̧#8>.ͽ#<#@i#D| '#HG I#L #PT`#T #X#\nowؤ#`P#d` #\ #h #1#M#   fgbp2 8s2B T Z  p 19  D lp 19 p 1 p 19     ^ p +1O + O M1O 3 7,_ ejv |!*  3binoc9 #d3#e3##f,# sgi#  giq3# rD #˙s3#j#tD # ue #|ve #we #wxe #  .,Ka#a#a# # l#.l#$v Om   fs1#5{ #`#Q`# `#˙3#3#<D #@D # ,3#$~D #(3#,uk#0ي#4ۺ#X #\E#`#d#h #l#p#t #xd #|#!S#S#O# #R##T #` 3#M `#A9 #U#X 9 #T 3#x1# 3# 3#3# >#"3# #3#(h #)`#/o#s53#~ 63#73#8e#93#B : # : #=#># ?#, @#A#KB#r C#.D# E# F#G#H#eI#J#K#L# M#N#! O#nowR#S# T3#>U#$V3#` \#33  3    ^ )^. 3@@X e.3@@!.{ -`3@r@. ._{ Z"fat"bufb#cpb`$tb` w ^O./p t@@%fs-1%blk-D %num-3T /. /.#j03&903'/03'L.03&z2p "buf1``~@(Gp ),&*ptr$pp(p )*ptr$p//D @@2?%ctx^%fs1 n{   S$sb`"ioh tp#buf&,3&@D &/D +a@,>@J@-.>@J@/0W@m@--.f@m@/1.@@t . h 2/ tt o3s*fs11.@@%ctx"#fs1X0@@ -4/t3)5cu5rv36/w37=/3@ @v8{ 9def3:c3;R/{ ;6/{ 6/{ <"0H=tmp>h?@ d/@Aask3 @s!@(9ctx8{ 9def37.T`t!@!@BctxR9strS{ 9lenS3Q:retU`C/1!@e"@9ctx0 9msg0{ )1-h"@"@T %ctx%ino  W{ $'z310"@"#@f%ctx%ino  .36 W{ V'z31-$#@#@%ctx%ino H .3h W{ 'z31/}#@#@u%ctx{%ino{8 |z W|{ 'z~3C7.#@9$@9ctx:fs13;zp F;{ dCc.<$@$@w 9ctx:fs1;zp ;{ 7j/B$@!%@( Bctx@8,&@eTD3A{ :retC=bufD } ^EY/9  *tv17 *tv28 & a1.@$%@&@]! HJ>{ .>! ?h A2-Ga\?2D/f tl& gl&.hlFV7F8F+N4.j2&@.@ChaintQ_wmyVV,(VG 0o1r%  !# "#! d  ]H5 O ,38V(J: b]  # # #$ #  #x #B # # #? #    P S Q#  S   T# O,| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c," k C# D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V #$ S W##( X#d  Y#h K Z#l ; [#p t l#t 3  !  # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S !#h  1#x  !A#  "# '#  (# + )# y -!#  .# /#  0# ? 1Q# @ 2# v 3#  4#  5#  6# K 7# X 8a# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q Fq# 1  %A  %Q ? a  q   BC D$EH o%  t  ! C#n D#1o E] #h Fs # ;q G #]p I #p K #J Ls #-] N # 'p P #$p Q #(] S> #,C] Uc #0P Vi #4   ` h ! "# ##n $# %:# 63 , #3 3' #O 4:#˙ 5:#P 6- # p 7#XW 8#\ s y   j <:#P =:# >]#. ?]#  :v:   : v:&  o= W :W  = s  c   :y   :   :        h  >  ]: c  ]: D oy _  _M!#io #˙:#Q# K¨#,V# :#Ţ#5&ƙ# Ǯ#$:#(Y#,= d#0#4w#8>.#<+#@i+#D| o#HG ӑ#L #PTը#T 7#X#\now؃#`P=#d` #\S# #y##S fMgMbpzszB 3/y y y %y % 1 M Msy sYy :,j ! *x1 WinoX#("Y#j#Z#3bkinoc#d:#e:##f3# sg# gq:# r#˙s:#j#t# u#|v#w#wx#k.,OK### # ]#.]#$vZ`Om qw Kfsy #5#̠#Q͠# Π#˙:#:#<ь#@Ҍ# ,:#$~Ԍ#(:#,uֳ#0#4ۙ#X j#\EY#`Y#dY#h Y#lY#pY#t d#xd d#|d#!##OO# O#Rp#p#T p#` :# M # A# U%# X # T :# x1# :# :# 3# # ":# #:# ( # )# /# s5:# ~ 6:# 7:# 8V# 9:# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T:# >U# $V:# ` \#:jf:K: 9:#,&:#^&#0# W2#tdb#v %   06S>201J2010221 =1 0>|ii?|#0@v#H0AS1a1S1 i:#g0#H0(" #j#!#G2,& ptr!pp"13:&@&@a#ctx2f$*2&@ (@%ctxfK%ino&db&low:'^:&mid:(buf) &keyB* QS*^2d~@"1: (@H(@Z#ctxf#ino+(",p"0:H(@p(@#ctxf#ino0+j#,pP-1p(@(@nY#ctxf#dir.dbt`.bufd,key/ ""1:(@ )@#ctxf'#inoG+(",pg"k2: )@P)@#ctxf#ino+j#,p"L1RP)@Y*@%#ctxQfQ0zFQ1 StX,keyS,dbT!bufU1^2Vp~@ ptr!p2p0H\*@*@ #3ctxFf0zFG54K567"18*@*@`q#ctx7f/zF9,db:80G9ctxFf(dbH:LI:zJ80("9ctx'f;L'(db):e*V:z+:,:,"(fd-::-:<<7& %2 'U0t1,& ptr!p=m1n*@!.@%ctxmf%inom>j#m(dbo&dirp;?entpL&iq:Y&jq::zr:1s@2+@ ,@C5]5Q5E6AiBqR,@.@y5~6 AAA5B,@-@XCH56@AqA7ADAA Eh:55F]-@m-@A&G30 $.@.@=#ctxfiH.@.@*5F.@.@Dtx1j2.@1@FhaintQ_wmyVV,(VG 0o1r%  !# "#! d  ]H5 O ,38V(J: b]  # # #$ #  #x #B # # #? #    P S Q#  S   T# O,| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c," k C# D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V #$ S W##( X#d  Y#h K Z#l ; [#p t l#t 3  !  # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S !#h  1#x  !A#  "# '#  (# + )# y -!#  .# /#  0# ? 1Q# @ 2# v 3#  4#  5#  6# K 7# X 8a# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q Fq# 1  %A  %Q ? a  q   BC D$EH o%  t  ! C#n D#1o E] #h Fs # ;q G #]p I #p K #J Ls #-] N # 'p P #$p Q #(] S> #,C] Uc #0P Vi #4   ` h ! "# ##n $# %:# 63 , #3 3' #O 4:#˙ 5:#P 6- # p 7#XW 8#\ s y   j <:#P =:# >]#. ?]#  :v:   : v:&  o= W :W  = s  c   :y   :   :        h  >  ]: c  ]: D oy _  _M!#io #˙:#Q# K¨#,V# :#Ţ#5&ƙ# Ǯ#$:#(Y#,= d#0#4w#8>.#<+#@i+#D| o#HG ӑ#L #PTը#T 7#X#\now؃#`P=#d` #\S# #y##S fMgMbpzszB 3/y y y %y % 1 M Msy sYy :,j ! *3b4inoc#d:#e:##f3# sg# gq:# r#˙s:#j#t# u#|v#w#wx#4.,K### # ]#.]#$v#)Om :@ fsy #5#̠#Q͠# Π#˙:#:#<ь#@Ҍ# ,:#$~Ԍ#(:#,uֳ#0#4ۙ#X 3#\EY#`Y#dY#h Y#lY#pY#t d#xd d#|d#!##O# #R9#9#T 9#` :# M # A# U%# X # T :# x1E# :# :# 3K# # ":# #:# ( # )# /# s5:# ~ 6:# 7:# 8V# 9:# B :Q# :Q# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! Oa#nowR# S# T:# >U# $V:# ` \#:3/:: ? %a  q 2RK.@6/@ctxQ/inoQlowS:#^S:QmidS:L2:8/@F/@u ctx/2KH/@/@@ctx/!29"U0#1#,&$ptr%p&2/@S1@Q5ctx/}ino'~:dirKi: j:6(z(1)@0@0@&*k*_*S+,wu"_$ptr%p-2pT1@1@ctxo/iq:.dirrK/51@1@x*H01@1@1Ttp)51@1@|*H01@1@1TtpOq4jA31@3@HaintQ_wmyOV,(OG 0h1rh  !|# "#! ] ]A5 H ,,8O(J3 bV  # # # $ # # x# B# # # ?#   P SQ# S  T#O,|RU ] ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c,"kC# D# v E# EF# G# #H# I# L J# K# L# M# BN# V #$ SW##( X#d Y#h KZ#l ; [#p tl#t 3 ! # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S!#h  1#x !A# "# '# (# +)# y-!# .# /# 0# ?1Q# @2# v3# 4# 5# 6# K7# X8a# 9# 6:# ];# N <# ]=# D># ?# @# A$# _B#  C# D# nE# QFq# 1  A  Q ? a  q    B C D$ E H h  t  ! C# n D# 1o E] # h Fs # ;q G # ]p I # p K # J Ls # -] N # 'p P #$ p Q #( ] S> #, C] Uc #0 P Vi #4   ` h ! "# ## n $# %3# 63 , # 3 3' # O 43# ˙ 53# P 6- # p 7z#X W 8z#\ s y   j <3# P =3# >V# . ?V#  3zo3   3 o3&  h= W 3W  = s  c   3y   3z   3        h  >  V3z c  V3 D hy  _   _M ! #io # ˙ 3# Q # K ¨# , O# 3#  Ţ# 5& ƒ#  Ǯ#$  3#(  Y#, = d#0  #4 w #8 >. #<  +#@ i +#D | o#H G ӑ#L #P T ը#T 7#X #\now |#` P =#d ` z# \ S#  #  y#  #S fM gMb pz szB 3/y y y %y % 1 M Msy sYy 3, j ! *3b4inoc# d3# e3# #f,# sg# g q3# r# ˙s3# j#t# u# |v# w# wx#4., K# # # z# V# .V#$v#)Om :@ fsy # 5# ̣# Qͣ# Σ# ˙3# 3# <ь# @Ҍ# ,3#$ ~Ԍ#( 3#, uֳ#0 #4 ے#X 3#\ EY#` Y#d Y#h  Y#l Y#p Y#t d#x d d#| d# !# # O# # R9# 9# T 9# ` 3# M # A# U%# X # T 3# x1E# 3# 3# 3K# # "3# #3# ( # )# /# s53# ~ 63# 73# 8O# 93# B :Q# :Q# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! Oa#nowR|# S|# T3# >U# $V3# ` \z#33/33 ? a  q Z3t1@1@ opsretu7L3|2@2@J { !3L2@2@v"E "^ F"9G3" H G ,&Io &J3"dKsiM3pN#fsOy ctxP/!(32@3@)A" U"^ u"93" z ,&o &3"d5i3p#fs y ctx!/$|~@rN6j843@9@JaintQ_wmyOV,(OG 0h1rh  !|# "#! ] ]A5 H ,,8O(J3 bVrs:  #  # # $ #  # x # B #  # # ? #    P S Q#  S  T# O7| R U ]  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c7" k C. D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V#$ S W.#( X#d  Y#h K Z#l ; [#p t l#t >  ,  # #  #  #  # Q # C # n # J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S ,#h  <#x  !L#  "# '#  (# + )# y -,#  .# /#  0# ? 1\# @ 2# v 3#  4#  5#  6# K 7# X 8l# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q F|# <  L  \ ? l  |   0   # ] #  # n #  BC D$E G/H h:  J P  t ! ! C) # n D4 # 1o E # h F # ;q G # ]p I$ # p KI # J L # -] NI # 'p Pi #$ p Q #( ] S #, C] U #0 P V #4 , 2 `  ! ") # #? # n $# %3# 63 ,] # 3 3 # O 43# ˙ 53# P 6 # p 7z#X W 8z#\    / j <3# P =3# >V# . ?V#) ] ! 3zo3) / ) ! 3 o3)  c h ) 4 3 !  ) !  ) ! 3 ) $ ! 3z ) I ! 3 * ) i ! 4 4 O ) !   o ) ! V3z ) ! V3  h _  _ !) #io! # ˙3# Q# K# ,O# 3#  # 5&ƒ# #$ 3#( #, = #0 E#4 w`#8 >.v#< Ϝ#@ iќ#D | #H G #L #P T#T ֨#X #\now|#` Pܮ#d ` z# \# ! # # # fgbpsB  >:) ? ?%) ` K) v f)  |  )   3,j /5! *FL3binoc# d3# e3# #f,# sg"# g" q3# r# ˙s3# j#t# u # |v # w # wx #., K# # # z# V# .V#$vOm ū Ņfs # 54 # ̣# Qͣ# Σ# ˙3# 3# <# @# ,3#$ ~#( 3#, u$#0 #4 ے#X ޤ#\ E#` #d #h  #l #p #t #x d #| # ! #  # O# # R# # T # ` 3# M # A# U# X # T 3# x1# 3# 3# 3# # "3# #3# (! # )# /(# s53# ~ 63# 73# 8O# 93# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR|# S|# T3# >U;# $V3# ` \z#333 R    Q$ 3@ ) #ino# #dir# # 5#blk# # < #( Z3#0num$#4str4 #<B4  3 # 34 # 3# ˙3# v3#3@ 43# 4# # ˙3# p[fs 3g3@=4@}3f3 ih3g!33@4@q4@3o43 43"!4=!43t4@4@[J3#?"!4$'44@4@%ctx%ptr%key4 -3@n4 v&343tp'3\(}3[)i]3!Q434@D9@7%ctx}37*fs tT ptr"!4"4 /"33"43 ans3?"43]"3+,-./@E6@N6@ ,O07@ 8@*key=_"m3 M 13D9@s9@w2ctx7!]4r3t9@9@ 2ctxqq35"!4sU&t"4u3s 4  331@ 4  33M, @  B4%33e1`X@ c &x4NS`o@H9j's9@%B@MaintQB5L_7ewmyeV,(e'eG 0~1rh .Z%1cid2# 3c#pid4# '5# 7# 8# 79# :A# -<# :=i#!  AH>`4o    !# "# ! s ] L5 S ,, 8e( J3  blr s:   #  # # $ #  # x # B #  # # ? #   PS Q# S T# O| R U ]h ^#N _# `# a#g b# dj e# f#C g# h#V i# j# \ c" kh C  D#v E#E F# G## H#  I#L J# K# L# M#B N#  V#$S W #( X#d Y#hK Z#l; [#pt l#t   3S # L # ~n|  3  #N # # #g # 'j # #C # #V # # I n" t r s#v t#E u# v## w#  x#L y# z# {# |#B }#  L#$S  #( #d #hK #l; #pt '#tN # #N #/ #f #U # #L #   # # # #  #Q #C #n #J # ( #$ #( #,W #0 #4& #6D #8xJ #:: #< #> #@ #D #Hu #L #P #R} #T #XA #Z #\ #` #d8S  #h  #x ! # "# '# (#+ )#y - # .# /# 0#? 1 #@ 2#v 3# 4# 5# 6#K 7#X 8 # 9#6 :#] ;#N <#] =#D ># ?# @# A#_ B# C# D#n E#Q F# #     ?   #  3 0 ~  #] # #n ~ # BC DE G H ~     t !C # nD # 1oEu# hF# ;qG# ]pI# pK# JL# -]N# 'pP#$ pQ1#( ]SV#, C]U{#0 PV#4  ` !" # # # n$c# %3# 63,# 33?# O43# ˙53# P6E# p7#X W8#\   j <3# P=3# >l# .?l#  33  8 383 >   ~U  o 3o  U  {  3   3   38      + +   V l3 7 { l38 \ ~ _  _e ! #io # ˙3# Qc# K# ,e# 3# ů # 5&Ƴ# #$ 3#( q#, = |#0 #4 w#8 >.#< C#@ iC#D | ҇#H G ө#L #P T#T O#X #\now؝#` PU#d ` # \k#  # # # k fegebp sB              = =  # I e  e    q 3 , j !*  3bLinoc # d3# e3# #f,# sg#  g q3# r # ˙s3# j#t # u # |v # w # wx # L .,0 K# # # # l# .l#$v; AOm R X ,fsʑ# 5 # c# Qc# c# ˙3# 3# <љ # @ҙ # ,3#$ ~ԙ #( 3#, u#0 ٮ#4 ۳#X K#\ Eq#` q#d q#h  q#l q#p q#t |#x d |#| |# !# # O0# 0# RQ# Q# T Q# ` 3#M c#A #U=#X  #T 3#x1]# 3# 3#3c# #"3# #3#( #)c#/#s53#~ 63#73#8e#93#B :i# :i#=#># ?#, @#A#KB#r C#.D# E# F#G#H#eI#J#K#L# M#N#! Oy#nowR#S# T3#>U#$V3#` \#3KG3 , 3  W  y    3@>  #ino #  #dir # =# 5>#blk #  # < #( Z3#0num#4str #< 3  nptrp |59@^:@!cp !len3"chL; m5`:@:@o9!fs!dir !ino #z #c)$D:@:@%W&:@:@'c(C5)ctxG)chٺ*ړ*)Q*;53+cppݙ+str   (4)ch)ctx,=,4,4 +t-4U I.4`@ch^ctx_/5a>lenb3-5.5yfschctx-50X5:@%B@=1ctxGi1msg 22)32;533fstX4cp 4i359L%q%f%[%Q%F6'|7'5@0{%d%Y%N6X8p;@5%%6'''9tp8Q<@:%%6'7+P87<@  ;4mp@ " ;(53@  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S !#h  1#x  !A#  "# '#  (# + )# y -!#  .# /#  0# ? 1Q# @ 2# v 3#  4#  5#  6# K 7# X 8a# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q Fq# 1  %A  %Q ? a  q   A) L )#;)#@]); #@:#@, #@!:#@ *:#@+:#@ B C D$ E H oT % d j  t ; ! CC #n DN #1o E #h F # ;q G #]p I> #p Kc #J L #-] Nc # 'p P #$p Q #(] S #,C] U #0P V #4 F L `  ! "C # #Y #n $# %:# 63 ,w #3 3 #O 4:#˙ 5:#P 6 # p 7#XW 8#\    I j <:#P =:# >]#. ?]#C w ; :v:C I C ; : v:C  } o C N : ;  C ;  C  ; : C > ; : C c ; : D C ; N N i C ;    C ; ]: C ; ]:  o  _   _! C #io ; #˙ :#Q # K 3#, V# :# - #5& ƙ#  9#$ :#( #,= #0 _#4w z#8>. ͐#< ϶#@i Ѷ#D| #HG #L #PT 3#T #X #\now ؃#`P #d` #\ # ; # # # f gb p  sB '-3/C Y  Y ?C z  eC  C     C  " "   " : , 28jIO!*`f3binoc #d:#e:##f3# sg<# g<q:# r #˙s:#j#t # u8 #|v8 #w8 #wx8 #.,K### # ]#.]#$vOm  şfs #5N #̠#Q͠# Π#˙:#:#< #@ # ,:#$~ #(:#,u>#0#4ۙ#X ޾#\E#`#d#h #l#p#t #xd #|#!&#&#O# #R##T #` :# M # A # U# X  # T :# x1# :# :# 3# # ":# #:# (; # )# /B# s5:# ~ 6:# 7:# 8V# 9:# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T:# >UU# $V:# ` \#::: l %    % D(#( #)#("mw,##)$:# (*xD)Vd,*`k(#U,:#* #+ # (!:#'"#"+##,$#)%# ,%#$3,&m#(+'m#,,(:#0b))V#4**V#8'(+#<--,~#@(-~#Dv).!#H*/#XM)0~#\( )#Q# },#'#)#%-#;+# #$#(#,8S!#00)#@`(#D+#H,#L-?#PX(O# ,P* iQj#-k#w+l#*m7<|Q}#-~#w+#6H# =6H# 6#8#6$#06#8 H   m7 5#k#5#774#:# 7  O + `+75 ~#6!~#5#:#h6$:# 6%:#5(76\6|*nv )m!6P:4"xO~"yO~#7Q:$R7:(B@B@n%)&bh '<7(tag(nr:),&:tp**:+(,$V6:B@C@&@&bhp@R%)%nV(err:',:(bh Z !6G:-)E"bhE -6F-'7F.iH:#5H:.errH:#A7I.obhJ !6:N-)"bh -y+~-N#T#n:.max:/#,.err:k406c:C@I@"!1)a1bN16b#7dV27dV026eR3errf:S2J7f:3sbg"! 3tmph(!>3bhi #y+jV#-k:#*l:2'7m#s6p:45E@417*F@48%D@5@l,6X!2˙:2<7D.tag3obh d3nbh 7xE@E@N ,,83,9:;S;'9;4:@6z #A792,7FG@IH@ ,{,o8d,X9;";V;v:;9(#7_:#5_:3cbh`.!#5bV<5!@`='6:I@k\?]7:80K@  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S !#h  1#x  !A#  "# '#  (# + )# y -!#  .# /#  0# ? 1Q# @ 2# v 3#  4#  5#  6# K 7# X 8a# 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A$# _ B#  C#  D# n E# Q Fq# 1  %A  %Q ? a  q   A) L )#;)#@]); #@:#@, #@!:#@ *:#@+:#@ B C D$ E H oT % d j  t; !CC #nDN #1oE #hF # ;qG #]pI> #pKc #JL #-]Nc # 'pP #$pQ #(]S #,C]U #0PV #4F L ` !"C # #Y #n$#%:# 63,w #33 #O4:#˙5:#P6 # p7#XW8#\  I j <:#P=:# >]#.?]#C w ; :v:C I C ; : v:C  } o C N : ;  C ;  C  ; : C > ; : C c ; : D C ; N N i C ;    C ; ]: C ; ]:  o  _   _! C #io ; #˙ :#Q # K 3#, V# :# - #5& ƙ#  9#$ :#( #,= #0 _#4w z#8>. ͐#< ϶#@i Ѷ#D| #HG #L #PT 3#T #X #\now ؃#`P #d` #\ # ; # # # f gb p  sB '-3/C Y  Y ?C z  eC  C     C  " "   " : , 28jIO!*`f3binoc #d:#e:##f3# sg<# g<q:# r #˙s:#j#t # u8 #|v8 #w8 #wx8 #.,K### # ]#.]#$vOm  şfs #5N #̠#Q͠# Π#˙:#:#< #@ # ,:#$~ #(:#,u>#0#4ۙ#X ޾#\E#`#d#h #l#p#t #xd #|#!&#&#O# #R##T #` :# M # A # U# X  # T :# x1# :# :# 3# # ":# #:# (; # )# /B# s5:# ~ 6:# 7:# 8V# 9:# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T:# >UU# $V:# ` \#::: l %    % D(#( #)#("mw,##)$:# (*xD3+4:#n*5~9x##)Vd,*`k(#U,:#* #+ # (!:#'"#"+##,$#)%# ,%#$3,&m#(+'m#,,(:#0b))V#4**V#8'(+#<--,#@(-#Dv).!#H*/X#XM)0#\( )#Q# },#'#)#%-#;+# #$#(#,8S!#00)#@`(#D+#H,#L-Р#PX(Ӱ# , /X}g^:#8_:#99`#!P* iQj#-k#w+l#*m^  + %9RgS#y+T#,U# 9('new% & x'8HK F xG!go: )n ^ n"^rpX"8q:^E3new2 ڀ2#$Y9=|L@L@=%)D%,W&`8R']`=(KL@L@)g)\*L@L@+r,}-9J:v.xI.yI/7K:0}8^:L@L@1)[1,\1y+] 2]`_=H CN M#!l9S:  ڀR3D9oL@EM@f 1)n 4ip: 2`8q /]`r=2*sX 5@y)6M@&M@{)('!M@&M@O7? 74 88:HM@N@ )%)ȉ= %}g: '<{: 9tmp: :5!@;*fC &teC<8N@N@ =)N@N@{)7()N@N@)7>)]Clen\:"+^C88:N@8O@J ==N@N@)*N@N@+=N@N@')*N@N@+()O@$O@)7!j8z: )x ,xseqy"`8{"]`|=?oom@A+r+}A#08F:8O@O@v  1)C 1,D 1y+E 2]`G=/ B=XQ)d)Y)NCp+o+zD=O@O@t ))(O@O@47y 7 )(KO@O@)g)\*O@O@+r,} <9O@iP@  !%) '^rX "`89i: :5.!@ %!  ! %.! !&9JC~@&9KC~@E1Dj:lP@U@VaintQ_wmV,(Orh8OC ]vO 9 # ,&!# ;:"# #(# 3u:( 9# 93# U0p 1q ,&q ptro po  ptro po:XlP@P@/ OW[ iYO jYO Z(  :P@P@ O%9'P@P@PDO&%:.P@SQ@|O,ret-/(:r(TQ@Q@ >Op6blkqjposq3els(zt:unumv3%.Q@Q@}YMAeN9(Q@S@nOblk3VW]low39^3emid3J:B: 9&c:S@S@*LOVblkv93!el(:S@5T@O"blkBretb!el(":8T@uT@Oblkret.el(p"Q:xT@T@\Oblkretel(<#:'T@T@ZO&$pT@T@,%T@T@&txpT@T@-%T@T@' G  ,&q ptro ppo"91T@U@,&03(ret0O2z3[4d)VIN=U@*6'+C>%zFj:U@i@XaintQ_wmyOV,(Oh)OG 0h1rz  !# "#! ]  ]A5 H ,,8O(J3 bVrs:  # # #$ #  #x #B # # #? #   A% #F # #w # #p$ jg #^ #)# ԓ# #9 #  P S Q#  S  T# O| R U ]<  ^# N _#  `#  a# g b# d j e#  f# C g# h# V i#  j# \ c" k< C D# v E# E F# G# # H#  I# L J#  K#  L#  M# B N#  V#$ S W#( X#d  Y#h K Z#l ; [#p t l#t     # #  #  #  # Q # C # n $# J # ( #$  #(  #, W #0  #4 & #6 D #8 xJ #: : #<  #>  #@  #D #H u #L  #P  #R } #T  #X A #Z  #\  #`  #d 8S #h  #x  !#  "# '#  (# + )# y -#  .# /#  0# ? 1 # @ 2# v 3#  4#  5#  6# K 7# X 8 # 9# 6 :# ] ;# N <# ] =# D ># ?#  @#  A/# _ B#  C#  D# n E# Q F, #   z  z ?   ,  < 0   # ] #  # n  # z  B C D/ E G: H h z    t  ! C #n D #1o E~ #h F # ;q G #]p I #p K #J L #-] N # 'p P #$p Q: #(] S_ #,C] U #0P V #4   `  ! " # # #n $# %3# 63 , #3 3H #O 43#˙ 53#P 6N # p 7#XW 8#\     j <3#P =3# >V#. ?V#  3o3   A  3A o3 G  h^  x  3x  ^      3   3   3A         4  4    _  V3@   V3A e h  _   _n! #io #˙ 3#Q # K #, O# 3# Ÿ #5& Ƥ#  #$ 3#( z#,= ʅ#0 #4w '#8>. =#< c#@i c#D| Ґ#HG #L #PT #T o#X #\now ؎#`P u#d` #\ # # # #t fn gnb p< s; tB E     '   = - ]  ]Ci        3, j !* x1 WPinoX #("Y #j#Z #3binoc #d3#e3##f,# sg # g q3# r #˙s3#j#t # u #|v #w #wx #.,K### # V#.V#$vOm ũ Ńfsʚ #5 #̫#Qͫ# Ϋ#˙3#3#<Ѣ #@Ң # ,3#$~Ԣ #(3#,u#0#4ۤ#X ޢ#\Ez#`z#dz#h z#lz#pz#t #xd #|#!##O# #R##T #` 3# M # A # U]# X  # T 3# x1# 3# 3# 3# # "3# #3# ( # )# /&# s53# ~ 63# 73# 8O# 93# B :# :# =# ># ?# , @# A# KB# r C# .D# E# F# G# H# eI# J# K# L#  M# N# ! O#nowR# S# T3# >U# $V3# ` \#333 P z   3@ #ino # #dir # ]#5#blk # # < #(Z3#0num/#4str #<< s<(64buf7#8]#err93#ctx:# ,;;y#;<3#i<<3#=3#<>3# j#?#$O;ygC #ND #inoE#dirF# 4;InumJ3#maxK3#bufL#<M#  $<Y 5<Z#err[ #ctx\# <]3# ;3U@U@^eaA bA <e=ekO4 ;U@V@!str!len"i3"lS#h$i;3*%aA %bA <e=e&ret3<3`;3V@SW@'aA 'bA %<e=e(ret3~)**+,,,-< TW@W@'fs .5<.3C/X;w0; W@5X@o!fs 15<!reto2z &3I<P34ctxM4fsM 4inoN 4fdO5Q#entRy5Ry#iS3#jS35"T35<U$5#V5E;W3 z4 3; 4fs 4fd65<5z 5z#enty55#i35]35\35# 5n33< 4fs 65<4ino 6j# 5 5$5;5<5#5z 5z#i3#c13#c2353;35<359;3Aj3<14fs 4buf4ino 6j# #dir5$5b<5 #33<<s4fs 4buf#dir5b<3r; 4ctx4fs 65<4ino 6<3#wd5z 57;85<9; 8X@ c@D#!ctxp!ino :fs tz2z ;}5`:fd;5<Ts8!*****+X?D,?|>u|!****+?~--,--?z--M>"****+-|- -,-8D-Dx,P-\-h-r9-}b-,->@]"@*@ *+X-) , ,,$A1lb@b@B@N< *CBlb@b@,Z,fC4p*\*Q*F+,h-tO -{ - - -!-D!-!-!D; c@e@"#!ctx 3";~;&"dir#i"2zF"S12<#""ino "2z ""cur3""max3#2#;3&#5N;32)3D#l#E<3'$6T:6^ ; 0=Ni3e@vf@x#$!fsc #1d#1e #Ff Fg31` h$#wdj$"blkk $#dirlA#!f@2f@s*$*$G<V3xf@i@$'fsP #%.Q[%.R %HS HT3.` U&&fdW<Xy(entXy:&/5Y&(dirZ&/n[O&/;[O '/]\38'/E;\3l'MJj&@i@`@"]aintQB5L_7ewmV,(e'e,(e=-)e ((e)e+*e=(+eEm,3,-e .eG 0srh .Z%1id2#3#pid4#'5# 7#8z#79z#:A#-`4 4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0 5 ! "S#ot ##  DIR & s   *    *5!t\#n=u#? -@ F\s3?Rs B?X!Y\#=Z#=^#˙_3# W?`3#$au#xb{# @$au!#n#?#@>3# Z=e#>e#=u#j#u#xu#u#  gC?e{ ,=2=3#@>3#3#f@u# >u#?(!\#>#˙3#7(# n##N=3#]>3#X>u# num3#$f>f5i@/i@'se5oldg5'=z30i@Oi@'chy(%?Pi@i@!(5strM(toP?v(>i@Uj@(>(7( )˙3-)> zF]>3M)  !8=!Xj@j@)? ) zF"@j@j@)<X>u*ɜu9*xub*@[k@9k@u*fprfZ*!0@lk*pm-+xmK+"s@|k@k@^+#+$cp %}?3k@k@+2&m12&m22$s1$s2 8'><k@]l@+n: ,?:4,N?;S,new=ur, uL>|`l@Lm@,O >zu,nz-?{:-N?{y-z}-p~u-K~u=.new~ui.(l@l@)cmp3@Lm@m@.| cp~.?sm@m@. cpr /*@ +Vw)p,@3 +>u+n+?+?3+2=+X>)puPwm@tq@>/` Vwj/2=` /cp/ch'1tag1?;2po2z3X>u3 `=3 zF- m@!n@! . (n@!n@/ 30 . . . . . 1 42/( 34 y= tq@r@\4 prf4z 4f 5buf o32=X   4}@6r@ju@>5 ?4j5N?45>55=55 zF7>8u"6p8uK6cpp96z:6=;375=as@?}lu@kv@8* ?|,8>|L8=|83n~tp?~8z9=lv@v@]9 >9n9?9?9= z932=l3?tp37( X5av@   ->v@w@B:>n:n:? ;?O;??;?;z<,?N6sM+@M)pO 3@@hw@vx@,<>fX<nf<?f<?g=?g3@gM=?i=zj=0x.1=27=xx@4y@=P>>nC>?{>?>?e>?P[???z?? ?=!@ e>4y@y@\@>@n@?@?#A?3[A?A?Bz8B?aB=sB>y@{@B>BAC32=Xprf[Cz{CinCVw(D)pendTD>3Dlen3D5VI{@T@{@}@Dr=E=r,EprfKEzE>EleneF @ 8>9ޞ9s?$dir$de$st:z$fn$cp:^&:<$max3$num3;VI$   ?,}@`@@FP+ lF>+P)fs- >.=/FK/rFz0G)cpp1cp1G^&1G5VId@0x8=..2X/DH/fH<77/H77/H/H= @ >b?@>r>5~@  39?B@x  3=G@?j Y3MjOA`@ـ@ZbaintQ_wmVA +r,#h-]#p.3#h+A0x1#^r2#Ad  AC`@À@I< B<3I etDuI endD<I 3A=Ā@ـ@I ggh1{@W8~@*A46@NjAZA܀@U@baintQ_wmVA r#h]#p3#h+Ax#^r#Ad A܀@?@I< <J etaJ end<J A@@U@J ggh1{@W~@*A@fOj ZAX@+@chaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz t K ! CS#n D^#1o E #h F # ;q G) #]p IN #p Ks #J L #-] Ns # 'p P #$p Q #(] S #,C] U #0P V #4 V \ `  ! "S# #i#n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\    Y j <:#P =:# >]#. ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =::_ST] ^ ^2Be{Tc ^ d2BxTv w'k:Ti ^ j2uBX@@Jfs K5k  old *K QB:VT ^ 2num: AS@W@JK!fs vK"2K"02K!num:L!map L#ret^$b2L%@@&I&=&1'B":X@@%M!fs  QM!map M"Z!HM$i#:M$blk$2M(J$2N(^J$2N(J$2(N(1&%: #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz t K ! CS#n D^#1o E #h F # ;q G) #]p IN #p Ks #J L #-] Ns # 'p P #$p Q #(] S #,C] U #0P V #4 V \ `  ! "S# #i#n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\    Y j <:#P =:# >]#. ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:,5:WT3 ^ 42C.:,@@Rfs+ RZ,HRI- 1SJ/2iS^J/2SJ/2Sj0:S1&0:S ~0:t`!+@@C"J">!+LJ@և@G/"J">#+@@<"J">BTjCZA@@fhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz t K ! CS#n D^#1o E #h F # ;q G) #]p IN #p Ks #J L #-] Ns # 'p P #$p Q #(] S #,C] U #0P V #4 V \ `  ! "S# #i#n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\    Y j <:#P =:# >]#. ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:/".:Vfs- ino-'J:TH I'Q:TO P'sfs =%fs CS@I@S)fsL %T5kO%oldR)DT%CL@@dTfs Tino'T :T LC:U!Z:"+X@f@#I#>"Vq@@#u#i$!"$$'"ۈ@߈@1#%@@##kC5@+@>UV&fs4 &ino4'4:8C%:fs$ blk$2,5:T3 ^ 42<:T: ^ ;2! fs  'RC:,@@jUfs9 Ublk92U 9:V!Z;:"V;@M@;^#t#i"Q@b@>|##"@@G#%@@@##VbbCjVblktVlow:V^: Wmid:4WgE:<@R@hWbbCblktE:T@]@W#bb͘blk͂C:`@@WzbbCWblkt"XKD:BXi:kXD@@XbbCblktD:@@XzFNXblk_bb CYE:@@)Y9zFblkY&EE:@'@UYfbbDCD2:(@@Ybb11CYbb21CZbb2>E#@@QZ2zF"N}Ze@@(x @@D,@@Z\zF+E@@ZbbC[ret!zFNzY[" # NC@!@[bbretSEl$@/@[bbkC[blkkt>\zm\in:\jn:d]!1om"0 v#H $]1D0@9@]bbblk%D"<@@]&,& : ^num :_^& _~^ret!'bb#Cz$^(h &# ( -3'@ɍ@ @ɍ@$^)e@@/x @@CDP@S@ _BsrcOC5_&2O`_zQ_D\T@]@_|srcZ*2[|gDG`@p@_retF|*,&F:+E?p@@ `ret>*,&>:XjlFZA@@_jhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b]rsA v ## #$ # #x#B#v# #?#    P SQ# S T#O|RU ]2 ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k2C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t   # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF"#   %  % ?   "  2 BC DE G dz%  t a ! Ci#n Dt#1o E #h F$ # ;q G? #]p Id #p K #J L$ #-] N # 'p P #$p Q #(] S #,C] U #0P V #4 l r `  ! "i# ##n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\ $ *  o j <:#P =:# >]#. ?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* _5 ; _ !i#ioa #˙:#Q# Ke#,V# :#S#5&ƃ# k#$:#( #,= #0ˑ#4w̬#8>.#<#@i#D|  #HG N#L Ա#PTe#T #Xױ#\nowx#`P#d` v#\#a #6#R# f g bp+1CqBH<B Y_i* 2=qi* 2i* i* 2   i0* H0HR* H:< F !wF"7#E#:#F$#F%:# IF&:#F':#M (#err)i#Gi ,&ptrvppv<C:8TA^ B=YF:@@@8`fs* d`ы^=: ` v`!rec"zia#blk=5a$9% @@&+&XU0i<1,&ptrvpv4F:@@ @Uafs* a a^=: ` vb!rec'zi'1( &%&& ) *1=b|Ei;9,&ptrv++,ieptrvpv-F:i@@ubfs9* b -9 b"z;i&c.rec #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# KC#,V# :#H#5&ƃ# I#$:#( #,=  #0o#4ẘ#8>.͠#<#@i#D| #HG ,#L Ա#PTC#T #Xױ#\nowx#`P#d` v#\#K ##0#lGe   f g bp &B 7=Si 'i2OS 'uS S '  {S ==0 =:HS@:@cI 2numVoutv GS<@Z@cI 'numVoutv FS\@z@ d7I 2numVinv GS|@@6dI 'numVinv ,HS@@bdbm1 bm2 GS@ْ@dbm1 bm2 FSܒ@@dHH~F~I QGyS@@dHwFwIx HHs@@eTr Gn @)@>eTm GfS,@L@je(Td ende2Hei{H\SL@l@epTZ end['H[p'HISl@“@efsF e4G^retHJ0fendJ FJ F6Sē@ @CfRfs3 of44^ret5R 7end7 F7 7G/ @@fmap. G*S@!@fsrc( 2) bH$$@-@fT# !G0@9@gT \j=ZZA<@@mhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b]rsA v ## #$ # #x#B#v# #?#    P SQ# S T#O|RU ]2 ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k2C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t   # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF"#   %  % ?   "  2 BC DE G dz%  ta !Ci#nDt#1oE #hF$ # ;qG? #]pId #pK #JL$ #-]N # 'pP #$pQ #(]S #,C]U #0PV #4l r ` !"i# ##n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\$ * o j <:#P=:# >]#.?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* _5 ; _ !i#ioa #˙:#Q# KN#,V# :#S#5&ƃ# T#$:#( #,= #0z#4w̕#8>.ͫ#<#@i#D|  #HG 7#L Ա#PTN#T #Xױ#\nowx#`P#d` v#\#a ##;# f g bp+1B BHit* 2t=Zi* 2i* i* 2  i* HH;* H:%6 Q7H# {8H# ?9# :#=H,;fs* #5kd#H^#~:#˙:# i#!#"# H##$` $v#(:d* t^=:v;I 5k# ]Iv#:* t:vGi,&ptrvppv|Ei39,&ptrvi]ptrvpv H:<@U@Jg!fs* ",t"^"=":"` vxlj#H=:X@@vg$QZ;tg$;=g$<:g%ctx<g&ret>:ch'#>:h&i?:h'˙?:i'#?:^i'n?:i'@ti#1I:@@jk$Ht2j$=Qj$:pj%ctxj&ret:j'#:'k&i:kk'˙:k'#:k'n:l'tOl(I:)DIt)=):*ctxإ+ret:,#:+i:,˙:,#:,n:,t-I1i@M@{lQ.fs&* l.ino'2l/˙(:l/M )Cm/5k/d{m/` 0vm0i2:m0r3:*n0ret3:tn14~2z5i%o3ctx62#7:_o4%8@4OIݞ@4VIE@5@@RO6667͙@@668ߙ@@9`!2Sjp1QkAD2l^ap0blkm=p2$m=Qq0opn:qjoV:k!+6666|;!<r<sr<r<es<s<s<0t73@ @6F8@ @R=jIiP@@t!fs * !ino 2"˙ :"M   "5k"` v3xljp `jIZA@@qhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:6u Q7=# {8=# ?9# :#=GS,&ptrvppv|ES9,&ptrvS/ptrvpv I'S!fs# "˙#:!ind$2"M $"J%!nr&2"/&^#z(S$b)2: I`S"!fs\ "˙\:"?I]2"M ]"J^!nr_2"/_^$ba2#zbS#Ic2 ItS!fsp "˙p:"Iq2"M q"Jr!nrs2"/s^$bu2#zvS#Iw2%IS@e@t &fs u&ino'9u'u'M u'I:ev'^ =v'Iy'I&y(J~(Sutp)I2y*b2Cz)(J2{*buf{)zS{)J:b|)I:s}+8%7@,I2@-@ @.../@ @..0 @ @1"A(Q+H)nV}2"8"3.s3i~.^.S.H.=.34"5~w~5~6"{z.3.....4#5` 6/X#g1.3v.k.`3U%.J.@4p#57/#k..v.k.`.U3J.@4#57/#..v.k.`.U.J.@48$5݁8@@9.0@@$2$.39.....4$5 56/$g.3v8.k.`3U3J.@4$57/%k..v.k.`.U.J.@4(%59/X%.3v`.k.`3U.J.@4x%5 :JFSh@@N;fsC z;inoC'<CretGSJ?/H=tpa3cj.JZA@@*thaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz t K ! CS#n D^#1o E #h F # ;q G) #]p IN #p Ks #J L #-] Ns # 'p P #$p Q #(] S #,C] U #0P V #4 V \ `  ! "S# #i#n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\    Y j <:#P =:# >]#. ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:62Vfs5 Z5H?2fs> Z>H<C:TA ^ B2,5:T3 ^ 42;J!S@@sfs  I" tp z#S!i$H Ā%2tX&2t\!blk'2+!b'2!j(:"VId@#+G@Y@6$I$>%V%7$t$i#@@@$$#@@E$$#ʮ@֮@K $$#@@P+$$#@ @aI$$&*@6@]$$ejKZA@v@uhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K#,V# :#H#5&ƃ# #$:#( #,=  #0B#4w]#8>.s#<ϙ#@iљ#D|  #HG ӥ#L Ա#PT#T ֥#Xױ#\nowx#`Pܫ#d` v#\#K #B#^#  f g bppn! :#num :#,& :# d# D :# ino'#blk2#:#B ! $:#fs % #,& &'#9 ''# K (:# )j#S< '<2"S] 'HSs cS 'y  {* Bv#J C2#K D:#3K E:# O F:#&t G#S< =<="^ =:Hn>K Gino K'# L#p62fs5 Z5HK:@Я@a:b:2K$:Я@!@[<fs# kJ#:SKC:$@ѱ@ljKfs= Z>HJ?<3ZJ@<_JA<JBK kJD2td!JD2!^JD2!JD2;"JEV"KEV!F2d!1&F2!KG:#-@D@I$$:%KԱ@@‹fs &sbP'JS(fs )ZH)kJ2) K"KH'JS6(fs )K"K6"K6"J:"J:",&:"zSJS@@fs :*iH!zS܌"wJ݃ ޱtH" K!MJ")K!1&:+lKNR@+VIg$@,%f-J%2-^J%2 -J%28-J&:d.@@,$$$$/@@01%`$$2%003 000*4KsS@v@5fsr -ztS3gj&LZAx@ @ xaintQ_wmV,(OG 0]r]A5 H ,,8O(J3 bV ^ ## #$ # #x#B#^# #?#n n  P SQ# S T# O|RqU ] ^# N _# `# a# gb# d~ je# f# C g# h# Vi# j# \c"kC D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl~#t n # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF# n nh n? n n! nBC DE ]d tz t K ! CS#n D^#1o E #h F # ;q G) #]p IN #p Ks #J L #-] Ns # 'p P #$p Q #(] S #,C] U #0P V #4 V \ `  ! "S# #i#n $!# %3# 63 , #3 3 #O 43#˙ 53#P 6 # p 7o#XW 8o#\    Y j <3#P =3# >V#. ?V#S K |3od3SY S K |3 d3S  ] n S ^3 K  S K  S) K 3 SN K |3o/ Ss K |3 T S K ^^y S K    S K V3o S K V3  ] n_ % _ !S#ioK #˙3#Q!# K8#,O# 3#H#5&|# >#$3#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ԥ#PT8#T #Xפ#\nowq#`P#d` o#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S ' nS ==% =3'~3WT| }'oL x@(@rfs ZHҏcrc!HJ"> (&!n'3"LN(@V@8fsM d#ZMH$5LWI%TU %KV%hLVH&iX'!ULX'!-LX''(sd)fs *LgSX@Ƿ@]fsf +sbh8t`bgi>ې!j3ikH,@&K!_Lu3!Lv3!KLw3-X&~./,. p&0(11`0<2+@@^/Js/>-I&.X3LC3ȷ@ @fsB ё#ZBHbjjMZA @@yhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K#,V# :#H#5&ƃ# #$:#( #,=  #0B#4w]#8>.s#<ϙ#@iљ#D|  #HG ӥ#L Ա#PT#T ֥#Xױ#\nowx#`Pܫ#d` v#\#K #B#^#  f g bppn! :#num :#,& :# d# D :# ino'#blk2#:#B ! $:#fs % #,& &'#9 ''# K (:# )j#S< '<2"S] 'HSs cS 'y  {* Bv#J C2#K D:#3K E:# O F:#&t G#S< =<="^ =:Hn>K Gino K'# L#pGS,&ptrvppv|ES9,&ptrvSAptrvpvLS @@ fs (!AM"i Hu#L!'#8M!''|MS@@ڒ$G  ino'S%blk2$:"iH&#:@@ _ a 7 b V'#_'"_e(n)M:@'@*G )M S(@f@+G +j)NMSh@@9+G e,%M@Ϲ@H$G ϥ$M]:]  HfMSй@B@$G ݥH$5k$` v"i'-ret:P: jvU0S*1,&ptrvpvLSD@@$G ,%ino'%blk2!: #Mj#zS'1.&///0&1̗&M<S@;@ fs9 $,&9'Y$99'Ϙ$:j$M;I'G =#z>Si2len?k3af@4&G//0&5X@@X///6j@@//7}@@1ə8@ɻ@h/*7@ɻ@6LS<@|@d src!2#G @#zS_9LpS|@@ fso $MoԚ:G qtx#zrS)emjNZA@Ͻ@{haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# Kq#,V# :#ţ#5&ƃ# w#$:#(O#,= Z#0˝#4w̸#8>.#<#@i#D| e#HG #L Ա#PTq#T #Xױ#\nowx#`P#d` v#\w# ###I fCgCbppvp! :#num :#,& :# # D :# ino#blk#:#B  q! $:#fs %o #,& &#9 '# K (:# )#o }o o o   {w* Bv#J C#K D:#3K E:# O F:#&t G#o }o :N /,dir 0#˙ 1:#buf 2#5k 9`# ` :v# ;#:Z:Z::v',>K Gino K# L#fG,&ptrvppvptrvpvM%@@4G `˙:ЛM 5k#`` $v<z&h ctx'\!'0""# '$%1@=@;"&1@=@$'MC:@Ͻ@&(fsAo ȜMA` Bv)ctxD& retE:P iojSNZAн@@n}haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# K“#,V# :#ţ#5&ƃ# Ǚ#$:#(O#,= Z#0˿#4w#8>.#<#@i#D| e#HG |#L Ա#PTՓ#T "#Xױ#\nowx#`P(#d` v#\># #d##I fCgCbppvB o o o o  8 {8^o ^Do :jNн@`@J(fso v^ bufv˙: zpQend 5( V]V '^N?`@x@Iu!fs=o ^ =!buf>vtNFx@@u!fsDo ^ DMNEv˙E: "6Np@@!fsno ^ nMNov qjNZA@@~haintQ_wmVr8Vr}Hr d % N@@͞c msg len: bufcN num:w N: padr valr& i:Z c:mucpiscptro Hz ,Nynwlenw:Nx:gzrOzr Ozrucp{iscp|tc}:NG9bufFcinF9aHrbHrcHrdHr? rN"buf!cin!9sum#rb0$rb1$ra%rb%rc%rd%rn&:N@@ q: n> len: J92 NĢ NgrNrP pĦyi:inƗbufƀ\N:D@@\Q@@f"q5{|ʤ(W8'HP'ե'1@j@ 1@j@E&٦/#r}rjLOZA@@haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b]rsA v ## #$ # #x#B#v# #?#    P SQ# S T#O|RU ]2 ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k2C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t   # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF"#   %  % ?   "  2 0} # ]# # n}# % BC DE G d%  t !C#nD#1oEi #hF # ;qG #]pI #pK #JL #-]N # 'pP #$pQ% #(]SJ #,C]Uo #0PVu #4  `t !"# ##n$#%:# 63, #333 #O4:#˙5:#P69 # p7v#XW8v#\   j <:#P=:# >]#.?]#  :vk: ,  :, k:2  dI  c :c  I   o   :   :v   :,        t  J  ]:v+ o  ]:, P d _  _Y!#io #˙:#Q# K‡#,V# :#Ů#5&ƃ# Ǎ#$:#(e#,= p#0˳#4w#8>.#< #@i #D| {#HG #L Ա#PTՇ#T #Xױ#\nowx#`P#d` v#\# ###_ fYgYbpp! :#num :#,& :# # D :# ino#blk#:#B !'! $:#fs % #,& &#9 '# K (:# )#     , * Bv#J C#K D:#3K E:# O F:#&t G#,  :N /Bdir 0#˙ 1:#buf 2#5k 9v# ` :v# ;#:p:p::v2B>K Gino K# L#|I^5kc#]Idv#:p::vG5,&ptrvppv_ptrvpvHk:@)@mdirgh:5ipni: ,j:bufj` jv xll!vO":A"fs "buf #n :#O!:$5#p$]$:%O:,@@&fs ŧ',':'` vo ctx(nV)v*ctx@X(zAȫ1'NZ..,'2)35S@a@X.H4S@a@2T5ZO{@@fsq dirr˙s:M t 5ky` zv*xl|p^ujOZA@S@ځhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' { zQ#### #P#C##m##v8 # BC DE d % ( .  t  ! C #n D #1o E #h F # ;q G #]p I #p K' #J L #-] N' # 'p PG #$p Qh #(] S #,C] U #0P V #4   `  ! " # # #n $# %:# 63 ,; #3 3v #O 4:#˙ 5:#P 6| # p 7v#XW 8v#\     j <:#P =:# >]#. ?]# ;  :vk:   o  :o k: u A d {   :        :    :v  '  :o   G    -  b  b  M   ]:vn   ]:o  d {_  _! #io #˙:#Q# K#,V# :##5&ƃ# #$:#(ɨ#,= ʳ#0#4w3#8>.I#<o#@io#D| Ҿ#HG #L Ա#PT#T {#Xױ#\nowx#`P܁#d` v#\# ### fgbpB    3  I 9 i iOu  {   :  ptrvpv#$fs O#@9@("T "vg$ n%!n&:Ԭ"@/@?0zO@ <@Y@#fs? $^ ?#buf?v%zA POM \@@<&fsL h^ LMNLvzN ӭ PO'bufP( @@_)G *,&ptrvppvOi @S@&fsf &blkf2M gPg:Oh&zj R k!bufl+VI@,'s{))-'./()-((.'xwjRZAT@@vhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' { %7 {Q !|R"#0S##Q$#S%# S ,S-#P.#gS0#Q1# BR 7 Q8#P9#rS:#P;# Q<#7|BC DE dc % s y  t J ! CR #n D] #1o E #h F # ;q G( #]p IM #p Kr #J L #-] Nr # 'p P #$p Q #(] S #,C] U #0P V #4 U [ `  ! "R # #h #n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\    X j <:#P =:# >]#. ?]#R J :vk:R X R J : k:R   d { R ] : J  R J  R ( J : R M J :v. R r J : S R J ] ] x R J    R J ]:v R J ]:  d {_ $ _!R #ioJ #˙:#Q# K#,V# :#G #5&ƃ# #$:#(#,= #0A#4w\#8>.r#<Ϙ#@iј#D|  #HG Ӥ#L Ա#PT#T #Xױ#\nowx#`P#d` v#\9#J #_#{# fgbppm! :#num :#,& :# # D :# ino& #blk1 #:#B ! $:#fs % #,& && #9 '& # K (:# )#R ; & ;1 !R \ & GR r bR  & xLQ #R #R #ZQ '#TR #tnR #xP #|7S #Q #Q 9#Q #hP #S #P 9#[P !#P "#yS ##R $#S %9#  {9* Bv#J C1 #K D:#3K E:# O F:#&t G3#R Y < Y< ?{ < :e6 Q7< # {8< # ?9# :#= =Z!4R #fs5 #ino6& #7# 8:#K G3ino K& # L#  I {3P$'buf(#P):#*:#\+:# S,:#˙-:#Q.< #/v# IGR ,&ptrvppv/".:.fs- ino-& R Xptrvpv?PR T@@ ptrv!,&:"rS:R#R:$eh %qQ`R @[@3&S^_&_'atlZ(PR \@@̰a&Sblk< 'zR P)ix %DQR @@)&SU*˙:&Q+ix ex %RR @}@&S &˙ : &Q u,,)eh M)ix ex ,zR ֳ)blk1 b'Q< PR+//6%@0@72@@,ZG G,eRp8@@/!/6~@@,UR%PR @!@7&S&˙:0&Qh,)ix eh ,zR 4VI6]@%HSSR $@@~&SQ&_SR< &R< &˙R:T)ecTR ,zTR ,QU:*,&QV:Y,SW:l,PX:,%Y:,QZ< +['Q\P'2Q]'^Z4sx@48%@6@-@+eQ9P@@Y!S::i:Z;.@%@/A6@%@Su#S?zR 4?V::i::eh 4VI@@(//0(7;@;@G//6'@;@1 =@@//6@@16{jSZA@ @ haintQ_wmVr dS5u@ @Vfd4:S4:|{j3TZA @@uhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K!#,V# :#H#5&ƃ# '#$:#( #,=  #0M#4wh#8>.~#<Ϥ#@iѤ#D|  #HG Ӱ#L Ա#PT!#T ְ#Xױ#\nowx#`Pܶ#d` v#\'#K #M#i#  f g bppn! :#num :#,& :# o# D :#s ino'#blk2#:#B !! $:#fs % #,& &'#9 ''# K (:# )u#SG 'G2-Sh 'SS~ nS '  {'* Bv#J C2#K D:#3K E:# O F:#&t G#SG =G=-i =:Sy>K Gino K'# L#{SptrvpvTTd @@LG c/@O@i' /@O@!tx"h@t@n h@t@#TP@@$bbOn'@@U @@!tx"@@W @@#S[@@i%bbZ & #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz t K ! CS#n D^#1o E #h F # ;q G) #]p IN #p Ks #J L #-] Ns # 'p P #$p Q #(] S #,C] U #0P V #4 V \ `  ! "S# #i#n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\    Y j <:#P =:# >]#. ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K#,V# :#H#5&ƃ# #$:#(Ƀ#,= ʎ#0#4w#8>.$#<J#@iJ#D| ҙ#HG Ӱ#L Ա#PT#T V#Xױ#\nowx#`P\#d` v#\r#K ###lGe  <e!S#fs  #!#end!# F"#3##T$#V%S#P&\#  f g bpB S '2S 'S$ SD 'D*P l {lS ==x =:)Va#  {cGS,&ptrvppvSEptrvpv\V:xnrV ӻ !UV:"U:S@@#T9 /$0U@@M%T $kU@@y%T $TS@)@d#Tσ#!S&neqS'end'T#Hdt'!U:nrV v!UV:(3V",@y@)map! *i#*j# +j\@l@),,|-\@l@./TAnrV v!$VAH(Uk|@@;0Tig0^ j2)numj:*il: +@@t,*1 -@@25/UnrV v!$VA(U]@^@10T[]0^ \2)num\:*i^:+#@7@f,1-#@7@23U?S`@@'0I; S0!<S~0=)num=4in>v3@[@lq,.->@[@.:?9[@k@m,.-[@k@2: $WS@@S&src %2$T~S@%@:%y&endz%F{%4|^ &ret}5U/(@p@#T- #}3.:&arg.$lV:p@@C#T o#V29E@@,a1W-@@.lk:Ti^ j23VL:@)@$0TJP0^ K2)numK:*iM::+@@U, ,$PU:,@n@X#T #V9j\@j@,1|-\@j@.$W:p@@!k#T M#V29@@,1-@@.5T@.@#T:@@,.-@@;:tx:@@,.-@@;:tx9@)@,.-@)@2:<tT S0@@A0!Sm4neqS)bm1  )bm2  *i 2U=@@, ,+@@, ,Aˀj\WZA@+@ŽhaintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# K“#,V# :#ţ#5&ƃ# Ǚ#$:#(O#,= Z#0˿#4w#8>.#<#@i#D| e#HG |#L Ա#PTՓ#T "#Xױ#\nowx#`P(#d` v#\># #d##I fCgCbppvB o o o o  8 {8^o ^Do :jWW#j# #n!#"# G,&ptrvppv,ptrvpvkWG@@~fsDo dirDinoEjWE:bufFnF  gpHT!WIN"retI!zJ#a@$@@M%%&@@',()7%))*!$L@e@Uh%%&V@e@'L$#@E@s%%()v%%))*+@@%&@@*!,W@z@`fso dirino-n .buf!z=()l%%))*+:@E@%&:@E@*!W-:|@+@f85(8-n):-,*:/buf+ ` ,v.gp.>0z/+@@7%%&@@' '0jXZA,@@ѐhaintQ_wmV,(V=-)V ((V)V+*V=(+VEm,:,-V .VG 0dr4`9,a# b#,c#+d# o)ek#*fv#})g#7i#,k# n,l#$*m#('n#,'o#08VC d %WA X:,@k@+* fd:W n ch%sWl@@   ,:*Xfd:9rc:X: X],&^lowout#D@* std@@mid  j Y:tj[XZA@6@6haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:eXS@d@fs ?j~=b]t`4X1Sd@@+fs/ W/~0=b2]t`KXBS@6@CfsA oAbA=jYZA8@@aintQB5L_7ewmV,(e'eG 0srh .Z%1Jid2#3J#pid4#'5# 7#8z#79z#:A#-` 4V] L5 S ,, 8e( J3  bl  G # # #$ w#  w#x w#B w# G# w#? w# W W  PsS Q# S T# O| RZ Us ] ^w#N _w# `w# aw#g b# dgj el# fl#C gw# hw#V iw# j# \ c" k C Dw#v Ew#E F# G## H#  I#L J# Kw# Lw# M#B N#  V#$S W#( X#d Y#hK Z#l; [#pt lg#t  W  # # # #  #Q #C #n #J # ( #$ #( #,W #0 w#4& #6D w#8xJ w#:: w#< w#> #@ #D #Hu #L w#P w#R} #T w#XA w#Z #\ #` #d8S #h #x !# "# 'l# (l#+ )w#y -# .# /# 0#? 1#@ 2l#v 3l# 4w# 5# 6#K 7#X 8# 9#6 :#] ;#N <w#] =w#D ># ?w# @w# A#_ B# Cl# Dl#n Ew#Q F# l W  W  W?  W  W  WBC DE s @  P V t ' ! C/ #n D: #1o E #h F # ;q G #]p I* #p KO #J L #-] NO # 'p Po #$p Q #(] S #,C] U #0P V #4 2 8 `  ! "/ # #E #n $J# %3# 63 ,c #3 3 #O 43#˙ 53#P 6 # p 7#XW 8#\    5 j <3#P =3# >l#. ?l#/ c ' 3z3/ 5 / ' 3 z3/   i s W / : 3 '  / '  /  ' 3  / * ' 3  / O ' 3 0 / o ' : : U / '   u / ' l3  / ' l3  s W_  _!/ #io' #˙3#QJ# K#,e# 3#$ #5&Ɲ# #$3#(#,= #0@#4w[#8>.q#<ϗ#@iї#D| #HG #L ԍ#PT#T ֣#X׍#\nowؒ#`Pܩ#d` #\#' ###  fgbp B    / :  :   / [  F/ q a/     w   W /       3 , j,!2/ #X3#X4#95 # ,&6 #Y7 #;:8 #95#0:5# W2;J#$tdb<;#( 0>ii?#0@z# L0A1a1 X,5ino- #9.#    Z#Zw#|Xw#w#X># l WU0/ 1,&ptrpG/ ,&ptrpp/ Gptrp|E/ 9,&ptr !X 8@U@2"o^#cY"5X@r@o"o $ino! $pos!3%el#5H&z$/ ':% %num&3(@@6)))*(*+#0YU5t@5@"oS0$inoT f"T3,VWV]%lowW3'^W35%midW3^'J:X 'B:X &#X/ 8@@"o&$ino e"9%el5%key, t`#Z/ @@ "o6$ino "9%el5%key, RQ !Y/ @R@"o0-out%ret/ }%iebad: a.YIT@@ /oH0s@@O)01s@@2<tx3@@[)01@@ <4tY_/ @@15fs^ ]/˙^35ret^6o`7za/ 8VI|@9@*e))*X*  :Y/ @@;5fs g/˙3/,&e/;retՙ7oC7z/ 6[z˙3>,&e-ret ?VY@uu@outJ6A?YQ@in@uuQAptrWAtmp A l:X/ $@@H5fs t/J/˙3;ret 7o7z/ AfnJBY/ H@n@"o<$ino $ret'XTDx@@ ))D@@4))D@@6S))D8@B@r))(I@U@&))!Y>/ p@@"o<$ino< J$ret='X? D@@F ))D@@R*))D@*@`I))DH@T@Gh))D^@k@I))(@@^))FjY3j9ZZA@?@haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:"Z0S@@qsfs/ blk/2buf/vEZS@?@fs blk2bufvzSMK!joFZA@@@<haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  {  S#   #~-|  # N # # # g#  j# # C # # V# # -"tr s# v t# Eu# v# #w# x# L y# z# {# |# B}#  #$ S#( #d #h K#l ; #p t#t N# # N# /# f# U# # L# # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S #h   #x ! # "# '# (# +)# y- # .# /# 0# ?1 # @2# v3# 4# 5# 6# K7# X8 # 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF # { % { % {? { { { % {BC DE d? % O U  t& !C. #nD9 #1oE #hF # ;qG#]pI)#pKN#JL #-]NN# 'pPn#$pQ#(]S#,C]U#0PV#41 7 ` !". # #D #n$#%:# 63,b #33 #O4:#˙5:#P6 # p7v#XW8v#\  4 j <:#P=:# >]#.?]#. b & :vk:. 4 . & : k:.  h d { . 9 : &  . &  . & : . )& :v . N& : /. n& 9 9 T. &  t. & ]:v. & ]:  d {__!. #io& #˙:#Q# K#,V# :## #5&ƃ# #$:#(#,= #0(#4wC#8>.Y#<#@i#D| #HG Ӌ#L Ա#PT#T ֩#Xױ#\nowx#`Pܯ#d` v#\ #& #F#b# fgbppI! :#num :#,& :# # D :#gw ino #blk #:#B ! $:#fs %#,& & #9 ' # K (:# )#. " " . C .. YI. y y_L֩Q #R  #R  #ZQ  #TR #tnR #xP  #|7S  #Q #Q #Q #hP #S #P #[P !#P "#yS ##R $#S %#  { * Bv#J C #K D:#3K E:# O F:#&t G#. @ @ &b :Lrtz-`! . #fs!#Z" #[# # [$# #\% #\& #['# # ( # Z)#$*:#(ptr+#,[,:#0Z-#4Z1#8j\2v#<\3:#@hZ4:#DP5#HT>K Gino K # L#  {. h# v : {G. H,&ptrvppv. rptrvpv|E. 9,&ptrv <!\<. @@~@`"fs;#i=:$<[@@1%}h&Z&j\v![Z:@@%}hA&\:%^\:`'KL:((\. @S@%}h#fs)<\. T@t@*}h*Z:+[J. 8}Ih,~K ,zL. +Z. z}h~"blk bbI)Z. t@@1\-}h].ino\-y*.: /z. /[:m0[@1*23*44+18(+e2V2J3@+4b4n )[. @7@J*}h.ino\*y(\J. 8@J@v"fsI'zK. 5X+O202$3p+4< 5+T9202$3+4<L6H@@Ve2[7@@4gx5H+b2[3+4g6r@@]2228@@202$7@@4<9H'@;@a:[7'@;@4g)f[t. L@* @;fsrB;inor b-sy-.s:,Zu,^ u/uu/nu/zv. <\w~/[w=ptrx/ y:=iy:/ y:/0VI @)[. , @ @;fs;ino -ybufy/,&:k,4/z. =t)sZ. @ @.fs.ino *y)Z . @@;fs @;ino  w- y-. : ,Z ,^  / [/n =ptr/z. / :=i:,:/ :=io& =)[m. @@uF.fsk.inok *ly)\+. @@;fs*;ino* 1<,~/z-. )z\. @!@ ;fs!;ino -"<~=i:-/z. @$\$@@%}h6H@@O@s2[7@@O@>gtx6HV@k@2[7V@k@>gtx9Hr@}@2[7r@}@ g!%[k. @@H!"fsi$%i:D&~[jH!?}lh'zm. 'V[n(5+Y 202$3, <5r, 2228@@202$7@@4< 6H@@ 2[7@@ g50, 202$3H,4<> 6H@,@#!2[7@,@4gj 9H,@<@2[7,@<@ ghIjO]ZA@@ĝhaintQ_wmV,(Vr% d%  t !C# nD# 1oE-# hFC# ;qG^# ]pI# pK# JLC# -]N# 'pP#$ pQ#( ]S#, C]U3#0 PV9#4 `8 !"# ## n$# %:# 63,# 33# O4:# ˙5:# P6# p7v#X W8v#\CI  j <:# P=:# >]# .?]#   x : v k :    x :  k :  d  ' : '  C 3 ^  :I   x : vd   x :       8   ] : v 3  ] : dI"]=@=@~ ; n;x 9<:-  <z \I@@@ G ^ G]c 9H:$  HvD 8]Y@w@d WW ^ W] 9X:  X  ]x@@- Mzxptrarg!Qj]ZA@@ߞhaintQB5S_7lwmV,(l'l,(l=-)l ((l)l+*l=(+lEm,:,-l .lG 0zr .a%1id2#3#pid4#'5# 7#8#79#:H#-<#:=#! % HH>`4 4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0  z  % ]:fbuf cp]]ret: %t]#@@JS!v!]"]": ]$z%fd&:`,(,w :\]Q@@PPMʐjZA@@+haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# K“#,V# :#ţ#5&ƃ# Ǚ#$:#(O#,= Z#0˿#4w#8>.#<#@i#D| e#HG |#L Ա#PTՓ#T "#Xױ#\nowx#`P(#d` v#\># #d##I fCgCbppvB o o o o  8 {8^o ^Do :j]n#]:##˙:# 8%:#,V#sb#]h@@fsfo Kdirfnfinog4˙g:xzilsjTk~qq$:@@D5D'n :G,!:}buf"` #v ls%Jx&D"]':K]':t]':!ret(:'tj^ZA@C@aintQ_wmVrhW: ^{r@C@fdz3nzr ]z3 jY3 jB^ZAD@@=haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# K“#,V# :#ţ#5&ƃ# Ǚ#$:#(O#,= Z#0˿#4w#8>.#<#@i#D| e#HG |#L Ա#PTՓ#T "#Xױ#\nowx#`P(#d` v#\># #d##I fCgCbppvB o o o o  8 {8^o ^Do :j^n#len:##a:# (^3D@@dfs1o dir1n1(]2:Hbuf2h2z4ls5h6^$:@@5n :,!: buf" ` #v4!ls%'j^ZA@(@yhaintQ_wmV,(V,(V=-)V ((V)V+*V=(+VEm,:,-V .VG 0dr%4`9,a# b#,c#+d# o)ex#*f#})g#7i#,k# n,l#$*m#('n#,'o#0 ]H5 O ,38V(J: b]rsA  ## #$ # #x#B## #?#   P SQ# S T#O|RU ]X ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"kXC D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t    # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h   #x ! # "# '# (# +)# y-# .# /# 0# ?1( # @2# v3# 4# 5# 6# K7# X88 # 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QFH #   %  %( ? 8  H  X BC DE G d %    t  ! C #n D #1o E4 #h FJ # ;q Ge #]p I #p K #J LJ #-] N # 'p P #$p Q #(] S #,C] U: #0P V@ #4   ` ? ! " # # #n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\ J P   j <:#P =:# >]#. ?]#  :vk:    : k:   d   .  :.    J  :  e  :P   :vk   :          ?     ]:v  :  ]:  dP _[ a _$! #io #˙:#Q# Kt#,V# :#y #5&# z#$:#(0#,= ;#0ˠ#4w̻#8>.#<#@i#D| F#HG ]#L #PTt#T #X#\now#`P #d` v#\# #E#a#* f$g$bpQWB hn  P X c  P X  P  P X    ?P n ?n %aP n :K( d) #Q # }, #' #) #%- #;+ #  #$ #( #,8S #00) #@`( #D+ #H, #L- Ц#PX( Ӷ#P* iQ j#- k#w+ l#* md  + + gJ_A~:#%:#c #^c # ^:#buf#err͏ #G x,&ptrvppv ptrvpv8C%:fs$P blk$c sfsP r^y:@f@v!x"K^ h@@#fsP #blkc #num:=$/i$/%j:&9:&z 'buf~@:(^:@@&]#fsP R$,њr$҄ )c ):$` vS*es]&$c &zُ "_/ @e @#fs,P E$,&-$˙-:)^. &z0 *jsb1+A,6,`,T-,.l/^^ 0fs\P 1Jt\1,&]c 1˙]:2z_ *buf`*fda:2^a:*ibc 3VI44.5^^ AfsP >_X ,&c ˙:buf6Zy 6y endy iy 6eRy 6z 6es7VIn8844. ^ h @&@7S9fsP c!,&c !˙::z :>_X B;st<^Sv<:tpf:=fd:k>VI@!@?-,,,,-(-@@...@ . A~A"HB-c#@C!@"@8,,?x-o,--.D%@%@l,?-@,3,(,,--.>@IK @Tw .^@i Br!$@+x.,-(..EH., %d _ &@(@ 9fsP !!P U!;st:z u!;bufSwjsb6:=i!62)E`.,Fj Y:Jj{_ZA(@(@haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# K“#,V# :#ţ#5&ƃ# Ǚ#$:#(O#,= Z#0˿#4w#8>.#<#@i#D| e#HG |#L Ա#PTՓ#T "#Xױ#\nowx#`P(#d` v#\># #d##I fCgCbppvB o o o o  8 {8^o ^Do :jG,&ptrvppvf_(@(@!xfso *"Z"" [_ ^ x !dir~""z "#buf!"]":"$ ##:%x.'&&'.('9j_ZA(@/@=haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' { %7 {BC DE dt%  t[ !Cc#nDn#1oE #hF # ;qG9 #]pI^ #pK #JL #-]N # 'pP #$pQ #(]S #,C]U #0PV #4f l ` !"c# #y#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\ $ i j <:#P=:# >]#.?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {_/ 5 _ !c#io[ #˙:#Q# KH#,V# :#X#5&ƃ# N#$:#(#,= #0t#4w̏#8>.ͥ#<#@i#D| #HG 1#L Ա#PTH#T #Xױ#\nowx#`P#d` v#\#[ #7#S#  f g bp%+B <Bcn$ 7nBTc$ 7zc$ c$ 7LQ #R #R #ZQ '#TR #tnR #xP #|7S #Q #Q Y#Q #hP #S #P Y#[P !#P "#yS ##R $#S %Y#  { c1$ M1MS$ M:= i {Gc,&ptrvppv6Bfs5$ Z5X%`QVaPVbPV|Ec49,&ptrv sOfs$ !_Wc(@ )@ #"fsV$ 5##_V T#!`ac )@8)@s#"fs`$ ##5``[ #!_ic8)@g)@ $ "fsh$ 7$#5`h[ V$$_!Bh)@)@$%fs $ $&kJ B%%i XU%'bg":(K#:)/$:u%*)@)@-++$_Tc*@/@%Z&nPn%&Pn&&˙Q:w&&@Q:&&RV/'& Ry',_SZ'fsU$ )zVcM(-iW))X_)(_Y:(Y:)_Y:))kJZB)-blkZB!*)2[4*'cp[.aI<+@/i.c++|0.1iV*@~*@m++|2m*@~*@3h*1i*@+@8++|2+@+@3*1i+@+@i++|2+@+@3*1i6,@V,@++|2E,@V,@3*4.+50+6z.@.@++6.@.@*+++7i.@.@++|2.@.@3N+2/@/@8gd<N+74/@/@C+C$ 9_@c/@/@+,n=n,˙=:,@=:,>V , >y,_?Ze%j<`ZA/@1@haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b]rsA v ## #$ # #x#B#v# #?#    P SQ# S T#O|RU ]2 ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k2C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t   # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF"#   %  % ?   "  2 BC DE G dz%  ta !Ci#nDt#1oE #hF$ # ;qG? #]pId #pK #JL$ #-]N # 'pP #$pQ #(]S #,C]U #0PV #4l r ` !"i# ##n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\$ * o j <:#P=:# >]#.?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* _5 ; _ !i#ioa #˙:#Q# KN#,V# :#S#5&ƃ# T#$:#( #,= #0z#4w̕#8>.ͫ#<#@i#D|  #HG 7#L Ա#PTN#T #Xױ#\nowx#`P#d` v#\#a ##;# f g bp+1B BHit* 2t=Zi* 2i* i* 2  i* HH;* H:%U`j- #erri#d`Ai/@0@+fs@* +-@>,zBi^,rbCAhD~E=, F`-:0@1@,bfs(* ,(t*- )^ *= +:` ,vb-!rb.bAϞj`ZA1@-2@8haintQB5S_7lwmV,(l'lG 0zr .a%1Jid2#3J#pid4#'5# 7#8#79#:H#-<#:=P#! % HH>`4V]S5 Z ,38l(J: bs  G # # #$ w#  w#x w#B w# G# w#? w# W W  PsS Q# S T# O| RZ Us ] ^w#N _w# `w# aw#g b# dgj el# fl#C gw# hw#V iw# j# \ c" k C Dw#v Ew#E F# G## H#  I#L J# Kw# Lw# M#B N#  V#$S W#( X#d Y#hK Z#l; [#pt lg#t  W  # # # #  #Q #C #n #J # ( #$ #( #,W #0 w#4& #6D w#8xJ w#:: w#< w#> #@ #D #Hu #L w#P w#R} #T w#XA w#Z #\ #` #d8S #h #x !# "# 'l# (l#+ )w#y -# .# /# 0#? 1#@ 2l#v 3l# 4w# 5# 6#K 7#X 8# 9#6 :#] ;#N <w#] =w#D ># ?w# @w# A#_ B# Cl# Dl#n Ew#Q F# l W % W % W?  W  W  W B C D E z @ % P V t ' ! C/ #n D: #1o E #h F # ;q G #]p I* #p KO #J L #-] NO # 'p Po #$p Q #(] S #,C] U #0P V #4 2 8 `  ! "/ # #E #n $J# %:# 63 ,c #3 3 #O 4:#˙ 5:#P 6 # p 7#XW 8#\    5 j <:#P =:# >s#. ?s#/ c ' ::/ 5 / ' : :/   i z W / : : '  / '  /  ' :  / * ' :  / O ' : 0 / o ' : : U / '   u / ' s:  / ' s:  z W _   _! / #io ' #˙ :#Q J# K #, l# :# $ #5& Ƥ#  #$ :#( #,= #0 @#4w [#8>. q#< ϗ#@i ї#D| #HG #L ԍ#PT #T ֣#X ׍#\now ؙ#`P ܩ#d` #\ # ' # # #  f gb p B    / :  :   / [  F/ q a/     w   W /       :  `L"M3#3  "`S1@1@-fsP blkP `QJ` R-stT y`'/ 1@2@-, fs . f ,0.-!2\.` " &S|.!z(/ .!`) ."buf+Y~ a S  J 8 %i W#`b/ 2@-2@/fs_ f_,-`2a3 "stctj`ZA02@7@haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {BC DE dd% tz tK !CS#nD^#1oE #hF # ;qG) #]pIN #pKs #JL #-]Ns # 'pP #$pQ #(]S #,C]U #0PV #4V \ ` !"S# #i#n$#%:# 63, #33 #O4:#˙5:#P6 # p7v#XW8v#\  Y j <:#P=:# >]#.?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ !S#ioK #˙:#Q# K8#,V# :#H#5&ƃ# >#$:#( #,=  #0d#4w#8>.͕#<ϻ#@iѻ#D|  #HG !#L Ա#PT8#T #Xױ#\nowx#`P#d` v#\#K # #%#  f g bpB ,2S^ '^2DS 'jS S '  {S ==% =:GSb,&ptrvppv|ES9,&ptrvV4aV fs !.a!a!oa"min#`:"retVVS1ptrvpv$Ta>S02@7@1/%fs= ]/&z?S}/&Aa?S/'sb@8t~(A~&`B/#`B)apbC]0&C]$0&IaD2L0&aD2l0&D20&aD20&aE:1&IE:N1*ay2@*a4@*#aƯ4@+b.K,,,u-+2@2@,J,>.2@2@V/2@2@ػ,.2@2@&0/q&.a}V}1&a}V1&oa}V2)grp~V/2#K~V&ua:2+(/[,,,,1H/222?31h/&2s31/#^2cjibZA7@3A@haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' { %7 {BC DE dt%  t [ ! Cc#n Dn#1o E #h F # ;q G9 #]p I^ #p K #J L #-] N # 'p P #$p Q #(] S #,C] U #0P V #4 f l `  ! "c# #y#n $# %:# 63 , #3 3 #O 4:#˙ 5:#P 6 # p 7v#XW 8v#\  $  i j <:#P =:# >]#. ?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {_/ 5 _ !c#io[ #˙:#Q# KH#,V# :#X#5&ƃ# N#$:#(#,= #0t#4w̏#8>.ͥ#<#@i#D| #HG 1#L Ա#PTH#T #Xױ#\nowx#`P#d` v#\#[ #7#S#  f g bp%+B <Bcn$ 7nBTc$ 7zc$ c$ 7LQ #R #R #ZQ '#TR #tnR #xP #|7S #Q #Q #Q #hP #S #P #[P !#P "#yS ##R $#S %#  { c1$ M1MS$ M:=)Vsas#  {c  {Gc,&ptrvppv!U:nrV v!UV:c'ptrvpv">.c7@|:@3#fs$ 3$b:3$b:4%i X:4%j!Vr4&\b":4&b":4!vb#V&z$c5&M %5&J%5!%&:%blk'B5'Tb(Bt`&a)7_6(-bd8@(bb8@(ay8@)8@(8@7d**+8@(8@,)S8@i8@?**+^8@i8@,-/*./,)9@:@Y**+9@:@/60[:@i:@*+[:@i:@,b:&fs$ a:Efs$ 1?bPc|:@:@62fsO$ 63bQ:.73bR:W71bCc:@:@74fsB$ 1 b>c:@:@74fs=$ "j.c:@@@7#fs$ 8$b:N8$b:n8%iX8&a8&a-9%buf9&zc9&\b:L;&b:;!%:&b:;%cntV<%blkB<'TbBtD&|bBO=&a7=&%b7=5a!?@5a@@-/L**./,6//m*.0,7;@;@#*+;@;@/I>7<@<@+*+<@<@,7<@+<@-*+<@+<@,-80*8i>.P0,)<@<@=*+<@<@,)C>@W>@n*8>+L>@W>@,7>@>@'*+>@>@/>6h0*.0,9@@@@*+@@@@,1bHc@@ A@>2fsG$ >1a9c A@A@3?=4fs8$ :a4c A@3A@_?4fs3$ 6jddZA4A@@NaintQ_wmV,(Ojh"]'O,(O=-)O ((O)O+*O=(+OEm,3,-O .OG 0]1rh  =!# "#4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0 >' f k f k cfFzdG,#mH,#$dI#J#iK|# 343 06 >2 0 1 J2 0 1 0 2 2 1 =1 h; Fc of d c0>"ii?"#0@d#A0A a1 n#Zmz# fd3#cv# om3#f3#k#vl3#$zlD#(i#,#0˙O#c#x#S##logM#Zj 1#~ 3#d O#Rf J#'e #$ 3#c3#cz#(k3((z3c!vo17OGG(kvh#Wkz#8hOAmO:cx#]v#iv#xkv# gO#!O#e\n\#qO# }gO#$nځ#(goہ#,e܁#0Po#4lllm 3#9O#kO#ox# offO#gO#h3# Nfbn#h#>f#nl# o#h>#3zv3b3vO3333>333dPNf#e ?d9#5l<J#WC[ #jdC[ # UoH3#bhM3#bmPv#YmB iC#lC#!j,[ x-[ #-[ #n.# /v#  0"# d>4A@?A@? tdb=fQ@A@kA@? tdbP?iRO@hg3lA@A@!@c tdbeM@ ne!gf3@!nf3@!ćf3@lenfd"flh'reti3A,mf3A@eB@1A tdbe]A!ke3Afx3hB@B@A tdbwArety3AUi23B@B@B tdb1CBoff1aB{cO3B@2C@tBy tdbNBoffNBiPB#9QOBmz4C@}C@ C bufz9C!,&OWCiOuC"pg3C@C@C tdbC$eC@C@C% tdbPVc3C@C@Cq tdbD!n2Ddq ED$:fC@aD@XD tdbD!HfDhOD% D@aD@offO/E=i3dD@D@OE4 tdb{E!nEdq E&offtpCn3D@@E@E tdbF!n@Frec iFd3@E@E@F tdbF!nFrec G&rT$RlE@E@$G+tdbPG!Hf{GhOGPn!3E@F@Gxtdb Hlen 0H ć 3,d<3F@F@rHtdb: n: g;3 n;3 ć;3len;dd3F@F@H:tdbH nR vQf vF@NF@Htdb  I&el[ R#fvIHj3PF@'G@:ItdbfIoffIrec IZf 3(G@G@ J>tdb 9Joff bJ!x J#m J&i tpj* 3G@G@Jtdb(  K!n( 3Krec) QK'Ki+ tx:c(l G@H@dKtdb K'j tt$k2 H@UH@Ktdb1 Kn\XH@bH@L<tdb[jf3dH@oH@GLjtdbehopH@~H@sLtdbni3H@H@Ltdb~'jt|rg3H@H@LtdbcdH@H@L1tdbk3H@H@#M_tdb(|jH@H@OMtdbfOH@I@{MkeyGM#?OMiOM$eI@I@Mtdb Wo3S@T@W1tdbKW!,&kW!mW&buf1w,0"n+3"ret,3B-llZ3T@V@4XtdbX`XoffXXbufXzPYlenYvpYcvY3Yel[[ Y+/U@,0#c_v7Zh3 V@V@Z>tdbZoffZbuf[lenv>[n3V@W@[tdb[off\bufzQ\lenv\cv3\%hW@W@reto]h3W@X@:];tdbf]!}g3]#l;]),&3ret3]+/nX@rhx3X@[@7^tdbwc^#hy^#ey^) z"pz"_'.{Otl&rec|D,0ofsOT_lenO_.n /tdb0k3>1S/ino"il [@lb@ `!n8`!}g3`!n3a!~3 b! tb!l  c!Zj &dtdb d&st =rev3=e#.l3evp"Df)fO2/+l^@3\@)\@T450n#j3bf6 L_@z_@7'f7f%L_@z_@83f&olb@b@f n }g3 n3 ~3 4n"b@-c@gmtdb=g!nqglenvgbuf"g3e30c@c@h tdb:hkey(yh!nhlenvh!c% i!pz7i# (ci#g3i3%((z gI c@d@itdbG ikeyG ( j!gG O!jrH cj'ejJ tlBh3d@g@ji tdbjoff kbufklenvkel[ l#l[ bl+/df@518 #cvl*,f@If@R )HfO,H1# "l:kO3g@}j@l tdbNm+/i@cc-3j@j@lm tdb+ ,&+ m,3i3j@Tl@mr!tdbm!3m!k3nop3n)BeDi3n)lzm3Tl@ml@n!tdb 3 k3m3pl@l@ o!tdbkey(4i3l@l@6oY"tdbbo!3o!k3oret3ocd l@hm@o"tdbb pkeyb (Fp!gb Op!-b 3precc p#eje Op4g 3hm@m@Dq4#tdb pqkey (q!g Oq&rec \e 3m@m@q#tdb key (q#g Orn 3m@Vn@r$tdb Erkey (r c % p z#ej r&rec Xret 3r#g Orf (Xn@n@ s$tdb 7skey (ys#ej s&rec T"ret (#g Osg6 3n@q@sd%tdb5 s!n5 trec5 2t#D7 [t#\7 t+/ o@+\W Eo@+/} lo@5h1P%&l[ P#g\  u,1&rF P0Je<3%/tdb;/off;"i=0wnI3%/tdbH/offHk 3q@r@Yu&tdb u!ej urec >v#m rvi v'`e P3d%q@q@ p&4%4v%%q@q@8%v6%q@ r@ 4%4%mj$ 3r@Os@v'tdb# w!g# O9wres% 3mw&rec& P#ej' w+/A s@,1#x2 w0d 3j'/tdb 1g O"res 3)ej "rec fH 3Ps@t@w(tdbG xkeyG (4x!gG OLx#ejI x&recJ LretK 3x9'1W 49'4-',18E'y8Q' y:]'Dg| 3t@u@Lym(tdb{ key{ (xy#g} OyThz 3u@w@y(tdbx y!.gx yrecy 3z'g{ 3tp+/ u@,2)n meT (w@w@gz2)tdbS z"keyU (&recV Tl 3w@~y@z)tdb  {fn @{!p z`{tl {&key (t@'5c (t&rec Pret 3{'9 3tH;out x@f% 3y@y@{Q*tdb# |fn$  p$ z&tl& \ret' 3X|d> 3y@dz@v|*tdb< |fn=  p= z&tl? \ret@ 3|0et 3+/tdbs /keys (1gs O15cs ("recu )ejv 0l c+/tdb 1g O/r 1  v)ej 0i ,/tdb 1  v/rec )ej )m )bj <  +ej #m #] v#)i +2sx 2/ 0h x,/tdb 1  v1ej /rec 1m )1h )bj 0Km<3,/tdb;1,&;"rec=)n>2/{=)Vm^ h 3dz@@@|.tdb }key (M} 5c ( !N 3}&rec L#g O}#ej }p G~ret 3~2/"28% >*2 -4*4*7*~4*,02:*8 +~3+{@{@ .7J+%4@+44+4(+,H28V+Y9c+`24+4+4u+,28+?+?+?+@,}@@,}@>,2 .4S,4G,4;,7/,4#,,2:_,8k,9x, 3 7,ˀ4,,`3:,?,@,}@,3?,j/3@@@;x/tdb.gkey.( 1c.( 'g0OtX#5c1(ret23߁+5P4@,3)ei>"o- 3@@/!e, )!ej, <key. ([' . (le7 3@ƃ@sk0tdb6 !i6 k0#e8 &rec9 P#ej: ߃)m: ret; 3+/n @3m%3ȃ@@>0tdb$key$(i3@@j0tdbkey(ck3@F@(1tdbkey(`nA 3H@j@„u1key@ (! @ ( p@ zjm (l@B@1tdbl B!pnl (#jn O<"keyo (&recp Tkq "ei 3D@@ņg2tdb ret 3x#m ])n #ej &rec P0d 2/tdb 1g 31n "rec )o )j h 3@@7U3tdb ci 3'ej tp"top 9g23 42424y2,4:2L82ˈ82(4j @-@ 3tdb 5i 3k0l33/tdb1n/lend)93="tv0yms34/tdbq1nrq "elt[ )fuv) v""pv")RfwJ"recx )*fy)@ly)bmz)!{O)j{O0n$34/tdb 1f!41*f"q 1@l#4"rec%)Rf&J)h'vd30@@~^6tdb#RfJ#nA'.Otp>3(45434343,@483,`4?35x45"el2[ 9344343,48484R?48+4ϋ854f8A4Ɍ8M4U8Y48e4g8q4ʎ8}42948544444444,p5:4?484n6l 'SD6/@^6'5lP.@'ni@P.@'he~@AjY3Bk (x@qLj}pZA@ޝ@jhaintQ_wmV,(Vjh"d,(V=-)V ((V)V+*V=(+VEm,:,-V .VG 0dr%4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0  d %WA  t!C#nD#1oEt#hF# ;qG#]pI#pK#JL#-]N# 'pP#$pQ0#(]SU#,C]Uz#0PV#4`!"# ##n$#%:# 63,#33>#O4:#˙5:#P6D# p7#XW8#\j <:#P=:# >]#.?]#   : k :  7  : 7 k : =  dT n  : nT  z   :   :    : 7     *  * U  ] : 6 z  ] : 7[dq@bufA#^ B#oC:#!DV# EV# oLY!M:#devN:#˙O:#oP:# nQ#&tRY#S#iptrpG,&ptrppp@@#.~C*pz #ŐoS@}@ P#^ Q]PpR&tTpTtppTiU:?p@@]p #^ ]ђ9:buf7/,&vOv&:ߓzo@p@@G}s ~#rp:&tzAatpi:,Gq@7@JI v #ϕz qp8@@ n, n#U&to~^ o]%q@@` ^ ]<9:!buf7֗ #&t"p@z`cpLp:Ę2p@@ "^ $"9:#buf7 Yp@@Tj  #^ ]ә9:buf1zi,&vv&:;$o@pE@@Y2 C^ C]9D:0!bufDh F#&tGpG2 XzHcpITiJ:jJ:B p@9@؝ "^ "9:#buf "p<@ę@4 `+p!arg #Atmp]_endwpę@J@ n>,&:!buf7 #z&vN Ap:L@@l 9#&t;i<:ɡ%i@@E&|'@@(ttfp&@@ܡ$ %#1z'O&t(mi):%@@1&&'@@(tp6q,@@+բ?q+:D -#z.ܣp@`@< #z)i@@$&|'@@*)i'@G@&&|''@G@*%iG@X@'&|'G@X@+q`@ޝ@&DnR˙:"nio, #z~:sta@-5&&.5+-5&&.6+)@@&&'՜@@*))i@@ &|'@@+%i@@ &|'@@+/Rqsp@0j Y:1p@ګjfqZA@ @haintQ_wmV,(VG 0dr%]H5 O ,38V(J: b] k ## #$ # #x#B#k# #?# { {  P SQ# S T#O|R~U ]' ^# N _# `# a# gb# d je# f# C g# h# Vi# j# \c"k'C D# v E# EF# G# #H# I# L J# K# L# M# BN# V#$ SW#( X#d Y#h KZ#l ; [#p tl#t  { # # # # # Q # C# n# J# ( #$ #( #, W #0 #4 &#6 D#8 xJ#: :#< #> #@ #D #H u  #L   #P  #R } #T #X A#Z #\ #` #d 8S#h  #x !# "# '# (# +)# y-# .# /# 0# ?1# @2# v3# 4# 5# 6# K7# X8# 9# 6:# ];# N <# ]=# D># ?# @# A# _B#  C# D# nE# QF#  { % { % {?  {  { ' {0r # ]# # nr# % {BC DE d%  t !C#nD#1oES #hFi # ;qG #]pI #pK #JLi #-]N # 'pP #$pQ #(]S4 #,C]UY #0PV_ #4  `^ !"# ##n$#%:# 63, #33 #O4:#˙5:#P6# # p7v#XW8v#\i o  j <:#P=:# >]#.?]#  :vk:   : k:  d3 { M :M  3 i  Y   :o   :v   :        ^  4  ]:v Y  ]: : do {_z  _C!#io #˙:#Q# K“#,V# :#ţ#5&ƃ# Ǚ#$:#(O#,= Z#0˿#4w#8>.#<#@i#D| e#HG |#L Ա#PTՓ#T "#Xױ#\nowx#`P(#d` v#\># #d##I fCgCbppvB o o o o  8 {8^o ^Do :j]n#]:##˙:# #8%:#'{qI@@UpfsFo dirFΦnGinoGR˙H:zJlsK\oq&:@ @5!n":7,#: buf$ ` %vo!ls'(jqZA @g@QhaintQ_wmVr]H5 O8VPSQ#ST#O |R U ]?^}#N _}#`}#a}#gb# djer#fr#C g}# h}#Vi}#j# \ c "k? C D}#v E}#EF# G##H# I#L J#K}#L}#M#BN# V#$SW#( X#dY#hKZ#l; [#ptl#t   q: @g@;JjrZAh@@aintQ_wmVrhzkq3h@@0 z\ cpz q3 q3ǩq13@@ / r0Gz quh/@ rul/@jrZA@+@#haintQ_wmVr d%(rG@+@} Eu argEk 3FrjPrZA,@`@}aintQ_wmVr5 HHrO;r<v,@`@crc;v*;6len;Oacp=   A k Xr /@ d,j!sr`@@haintQB5S_7lwmV,(l'lr .a%1?id2#3?#pid4#'5# 7#8#79#:H#-<#:=E#! % HH>`4K z A r#hz#p:#    % +Ax#^r#   Al rQ:`@g@ s\:h@o@r?FargDsp@i@`?fn?Ztmp?xfd:˙:)(6:ral@C@et۬elVel2raD@ܢ@̭0etel1s:ܢ@@0Zbs9Ose@@\}3da nf:tletgȮ urhatp si:cpj?!]s@"r@z@msg#%$% *3~@ t:~@ r0~@ V&j Y:'*A5~@'dr6~@Xjusr@@h 7VD%ints>@@0num,\ chI{ iI p% % ? ls 2@ % buf~@[jsr@,@s!0s:haintQB5h_7wmV,('r .v%1Tid2# 3T#pid4# '5# 7# 8# 79# :]# -<# :=Z#! : ]H>`4`   :s,    v  %s2@@ s0}30vfmt0٢1% %   %sE_@,@_sDxF.  sP_,@@@LxQxs@@@s}3vfmt$٢%Zs9@,@z9s6}37vfmt8s:%8F ks.q@2vjU*u?#t@#dtA#tB#"uC#tE`t,@@ &ta p uE st R@x@devr&arg%tO3@0@MtNM JtN&tPa@6hal9x3pڀwNut0@ԧ@*# &tsaVSX6~dV@_@devSp6d u@@tagUS6 d @@badUt"3~@jutԧ@*@DaintQ_wmV ((OG 0]rhpu,t4Ft&#vt'#u(F#mt)#gu*# t+3#Du,d# zu-o#$u.O#(t/#,3u0#0QW! =t]#^u^#t_o#u`o#taO#Ftb#u[v!k3#&tlF#tvm#vn# poC#9CxC#C#St>*u?#t@#dtA#tB#"uC#tEI 8X VC xWC u9ԧ@ߧ@ dev8  v@@1zF u3@\@BxzFnvxdev us\@@ڴ&trFzFt -v3@@1zF]tv}vuQv Ce1 dCl9x3N ڀwCBv @@dev@@)$@@f+T16*Bg@ũ@tag+v@*@zdev\}jvt,@<@lhaintQB5S_7lwmV,(l'l,(l=-)l ((l)l+*l=(+lEm,:,-l .lG 0zr .a%1id2#3#pid4#'5# 7#8#79#:H#-<#:=#! % HH> 4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0 5! "Z#ot## % DIR& v n #x # vR,@l@ĶCQCdpSxS, v%l@Ԫ@?s$k $:ret& %w7Ԫ@@Es6v?@4@qn>>CƸdp@v_4@@ޞ]Hu]G]Csv^ dir`dpa޹bwwc:std    %v@<@(8HuTtpvtlvthdir86n  N v>q@#jwt<@@haintQB5S_7lwmV,(l'l,(l=-)l ((l)l+*l=(+lEm,:,-l .lG 0zr .a%1id2#3#pid4#'5# 7#8#79#:H#-<#:=#! % HH>`4 4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0pu   ,t4 Jt &#vt '#u (J#mt )#gu *# t +:#Du ,# zu -#$u .l#(t /#,3u 0#0 U [ ! =t ]#^u ^#t _#u `#t al#Ft b# 9 x # #   /wE<@@t' cpDchF%ɺ [w>@@R cp=) @Y@@GVwXspZJwX:&tWJkwWcpWdevYretZ: w:D&tJdevcpDtmpendnret: w:ocpDp{w:cpDqw1:&t0Jdev0cp0Dn2?3ret4:>w:"nD?DcpDendw}@@&t|JȻ~buf_fd:'w:stVIa@ 6devqendl!6"## 7$%9&7h]### 87%m%н$!h79# ## 7$!7c### 7% %!$"%-$8'o@ۯ@ӻ#(J @O@#[ 8%e )%*kRjwt@@haintQ_wmV ((VG 0dr%pu,t4Ft&#vt'#u(F#mt)#gu*# t+:#Du,k# zu-v#$u.V#(t/#,3u0#0QW! =t]#^u^#t_v#u`v#taV#Ftb#9x##St>:*u?#t@#dtA#tB#"uC#tEEw?@E@% &t=FQ Dw= ?> dev@ cAFtp tBtl vBth retC outco@ %wH@@L &tFx w va:n dev c Ftt ret!0jwt@@haintQB5S_7lwmV,(l'l,(l=-)l ((l)l+*l=(+lEm,:,-l .lG 0zr .a%1id2#3#pid4#'5# 7#8#79#:H#-<#:=#! % HH>`4 4`9,a# b#,c#+d# o)e#*f#})g#7i#,k# n,l#$*m#('n#,'o#0pu   ,t4 Jt &#vt '#u (J#mt )#gu *# t +:#Du ,# zu -#$u .l#(t /#,3u 0#0 U [ ! =t ]#^u ^#t _#u `#t al#Ft b# 9 x # #  St >>*u ?#t @#dt A#t B#"u C#t EI  l9 x:l ڀ w w: dev ptag.> w::@@&t9Jp;5tmp<tw=Jt>? fd@:Fret@:stAVIp@ 8devyl@8|}`8'@˴@@p@֩ %j Y:jxt@b@UaintQ_wmV ((OG 0]rhpu,t4Ft&#vt'#u(F#mt)#gu*# t+3#Du,d# zu-o#$u.O#(t/#,3u0#0QW! =t]#^u^#t_o#u`o#taO#Ftb#xx !3# dev# p*#9*x*#*#St>*u?#t@#dtA#tB#"uC#tE0 9. add+* ,* x-* 8X V* xW* Ce d* x.3@@f\zF,-\?-\tag/bhxk@W@&tjF2jb[ڀltmplpm*3yFX@@1devE EbDpG*z@@tmpM]xX3@@devVVb/?WbOtagYoxN@i@J&tKFLb?MbڀO$devPXpriQ3xpR*yxS3oxq@ɸ@tmpcGx>l@@uzF= x.@@Ktag-w@@6 !@@f""!@@7 !@@f""/x@@K#devG$zFy3@Ǻ@rDwb%x%yn?cp&VI@@@cxȺ@@ tag %yK2 addJ* ڀJ* x3@b@devnb6?b'xtڀvalx'VI@ ?@O@ % !B@O@L "A  p@@V % !y@@L "u"! @@ % !@@L " 3jytd@d@RhaintQ_wmV ((VG 0dr%pu,t4It&#vt'#u(I#mt)#gu*# t+:#Du,k# zu-v#$u.V#(t/#,3u0#0TZ! =t]#^u^#t_v#u`v#taV#Ftb#9x## 9. add+ , x- Lyk:d@k@U &tjI'Vyj:Rgy:l@z@:&tIret:Fy:|@@f&tIret: %yK addJ ڀJ{y3@d@&t2Iv2˙2:Mdev4mtmp4p5u5-8by\o3@@@L6@@@L %vyk6}jtd@@`haintQB5S_7lwmV,(ljh"z'l,(l=-)l ((l)l+*l=(+lEm,:,-l .lG 0zr .a%1id2#3#pid4#'5# 7#8#79#:H#-<#:=#! % HH>$`4 4 `9, a# b#, c#+ d# o) e#* f#}) g#7 i#, k# n, l#$* m#(' n#,' o#0] S ,5 Z 8l  bsr sApu   ,t4 t &+#vt '+#u (#mt )#gu *# t +:#Du ,# zu -#$u .l#(t /#,3u 0#0   !  =t ]+#^u ^+#t _#u `#t al#Ft b#y x  % x 9 Tx T# T# +,,e Su u fd:#&t#dev#%# 6z#buf## S" : x # %#]&z#'l#{(l# )#o*# %3!4#5#6#7# 8#Q 9#C:#\~;!#D<1#8xJ=#:y>A#<?#\@#`A#d8SBe#hCQ#xDa#E# F#G#+H#yIq#J#K#L#?M#@N#vO#u|P#Q#R#KS#XT# U#6V#]W#N X#]Y#DZ# [#\#]#_^#Q_# 1 u SA u Q u %a u %q u?  u  u  u  u {i i #p#({##{y #he# y #0#~ #l{y #x;#|#U# Sy u  u  u % u tl ##Ӆ#|# #z#Q~l ##,[~| #.~ #4e~l #@ e#TQ#d | u  u S u [{< e#G} #~e#e#$y#4  u ; Ci #}#|#-#~###\#P#1 # ^e#e#~e#  u |  ށ #Ey #ƃe# S u a crcѾ# Ҿ#Ӿ#Ծ# @ ! #,&̾#˙;#$ξ# G~q# # nq#0  u zP X۾#އܾ#gݾ#e# {Q#P #,}# S` ut~w~#i} #1# e|# ڄ#ˆ#/1#1#JS##W##fz# # #$}#(#*#,#0"#2 #4@#@i #C&#Gz #R"*#Z}1# S u   u  u S* u S: u|v{#]z #1# ,#  # #ɉ 1#K 1#ф S#d#z#{##l# #$i #'Ȅ#+$ #61v#>61# S u 9n9#P# {# S# #2!#y"#f##$#e%#,&&# I u +@;Gz<#=#.|># z?# ƅ@#|A#%B##z# P# #id#fG~#O#ʂ#{# Â# ##ʊ##z##Պ##"e #$  f#%zz #@ #D} #Fņ#JL#N#R#T }#X5L#\*#|^#~~# v ux## #+Q!# q"# P## +&F#'#$(#K)#z*# q+#,#~/i0#1#92#3# u\67#E8#P<S=#O>#}?# @# ( uCG~D#qE#EF#U|G#PH# I#yJ#K#}L#M# N#$,O#(}P#, Q#0oR#4S#8T#< {U#@V#DӆW#H5XL#PY#pZ#|[#=~\#]#o{@e(idg#h#i#pzj#k#m(# 8 u^(:d@@ 'len':end) S.:@@<.΄h@@{dir9:i:% (:@@CU ć&!id&!buf'"{ :@H@o{ #id $~l%buf&,&l#il#crcl' (~65@ ) r:H@~@ ćid buf)(":t@*  Up~q( Dilbl+@@,-.@@/0/  %! u':@@'Y! ć!id!buf#dlY! :@@S! ć!id!buf#iso!*  }b:@ @" ć_!id`!bufa zS: @<@|" ćP!idQbufR#csbT|"* U  a QzD:<@l@>" ćA!idBbufCj#rosE"* F  ~7:l@@H# ć4!id5!buf6(8 L1@@#dev5tagi2str#G %# u$~:@:@$ ć!id!buf#osb$ -r}:<@@n$ ć !id buf#jsn$* +  |:@@I$ću!idbuf#rs4$'   :@~@Q% ćid buf-#rsQ%',l*   :@@%ć!idbuf#xs%* R 1@o@p&&devidbufes&& 3 W ؉:p@@u& ć!idbuf#es&&Jz:@@& ćx!idxbufy#es{&&`:@@#.' ć^!id^buf_O#esa&&:@0@z'ć!idbuf4ovhG|4ovl~*Ȑ60@2@% (pr4Qoff5 len5375W8т:4@G@(ć:idZbufz4j:thbs:(!tl#m( |k:H@@(ćhidibufj/#swsl(  F:@@Oj) ćC!idDbufE{#hfsGj)(ZHp)[*I  %) ug:@@*ćd!idebuff'#nsh*#mfti*'Pj*(Zkp)W(_}k*~cpkG*Gl:{*|l:*m:*Am:'m:inl *nl+*nlT'zo:*ʈp}offq *zr#valr    %+ u;:@8@L,ćx!idbuf#vs,#ms,#dir(Z,V' *'Q#tmp*V*e:*):*1'̉*PO*B{'''<*g**}'*x;'ۂ'68'Q}''{'9: ` : %, u >:8@@o4-ć;id<buf=#ms?,-:@B@-.I2f-t2buf-cpi7t  %- uO{:D@@-now(<|~@4ret:y@y:@@I.now8<|~@2ret:y@ފ7:@e@. ć5!id5buf6<#es8&&M{:h@@r. ć!idbuf#es&&9a:.8,/-/'68///%/?0/_$B0%val?z:X@@qO1ć!idbuf#sbdO1*  @0e@l@41-0(+0@@-0F Ou:@X@d1ć!idbuf#sbdO1* @0@@1-0+0@ @-09$}2%valA$&q2%str$&߀$:%buf%&<%:#i':#j':#c(l{\:X@@W5ćY!idZbuf[(]'4^5* _5*key`5='{a5sbdbj)f'cl'dl'yelofffly*,gl'(hl*zil6*jlT'6kl*Ѐll}'ml*nl*}ol'eplextq:'-zr*r(Zsp)[( s5{@0@@=4,0@0@@W4,0@0@@q4,0@1@@4-28@0@ @4,0@0<@G@4,0@0G@R@4,0@1@@4,2@0@@|5,0@1@@}/5-2V@1@@~M5-2i@0@@k5-0|@1@@5-2>29,F2-:2,.2,"26090R2/\2/f2 v  F ( %5u l6 u5(o~66@ -6 u(}6y@ #O6 uV(`?6@q@BjY:jXt@@aintQ_wmV,(O=-)O ((O)O+*O=(+OEm,3,-O .OG 0]rhrs:y4`9,az# b#,c#+d# o)ed#*fo#})gz#7i#,k# n,l#$*m#('n#,'o#0X>3@@Pfd=3| n= ch?s L@@fdK3 XM3 XQV ,&R ^S+lowS@H9 st@@midUj^t@C@aintQ_wmVrhrs:yr$}@C@mfd~3n~}]~3 jY3[tjUˋD@@jhaintQB5S_-6e7wwN8mV,(w'w+*wEm,:G 01r .l%1id2#3#pid4#'5# 7#8#79#:H#-<#:=#! % HH>`4  !# "# , , S   2=Z 3l#Z 4Z#|X 5Z# 6Z#X> 7=# HM :D@@tvhi:D@)@W bufb:i:n:fd:tpv:cp  S e  jP,@@#outO OnumObufQ\uuRLiS:nS:tP :@g@@outf numh:t|j:n ;6:"4145num5 tv<!`@~!A"ox#7:~@#K8~@#9:y@#:;~@#;Z~@ l Z6:$fd:  @@out numuu P% lG&`9'%'' '(9)1`*<Z*H+T#n A~@#E :~@:op:out numW$@@out# v@@;outu   SQ ,j Y:jnjˋ@8@9aintQ_wmVrЌ'3@8@Ruu&~cp(Ri)3Q ASEjˋ8@@waintQB5L_-6^7pwmVr2Z3e#Z4S#|X5S#6S#X>7# A  ݌'8@@A uu&A ptr&P tmp(e out)PGLU jˋ@@ aintQB5L_-6^7pwmVr2Z3e#Z4S#|X5S#6S#X>7# A  '@@< in&< uu&G ptr(M tmp)e BL  SA0jEˋ@@haintQB5S_-6e7wwmVr%2Z3l#Z4Z#|X5Z#6Z#X>7# H  4@_@ R uu3R5 out3H fmt3]f 5`XSc%VYJ`@r@uuIRoutI(Et@@uuDRoutD@@@uu?Rout? ;'|6@] *.6@]ja@@=haintQ_wmVr%8V%  :# V# # :@@: r4 ˍ: @ fF ;rnum::V cz:@a@h yr ˍy: y@% f{FQ ;|ronum}:?rcpr/wrcprO:d@u@ str% ! M 2:@cpr9bufrxrmneg:Vˍ:frc :@@9{R:x@@,]strQ%Q Q  E@"@X : VfF ]% @:\bufE@ [$@@zE Z: ZVf\F ]^%? @_:~buf]E@%Uxex܍Uz@x׍Ovy@9Kjv@8@yintwVha_ݎ%܎,Qm&,  %low`#^`#  s llv  M nL dL rpLnnNddOrrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkwwkm1km0k$v@8@u#vv#vc%Vuu&tXvv'vw(v&91LB89WbmxatPx@{@!$:Mkjv8@_@intwVha_ݎ%܎,Qm&,  low`#^`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0k;_8@_@n^d^ :`A7-8:LWbmxft`@@@_@,Ujv`@@intwVha_ݎ%܎,Qm&,  low`#^`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww km1km0kES`@@~uRvRZwTP:VA7-h:LWbtPmx7@@ 0@@*Hh_g @@K4AAc3Aint9Adc8AO AcA*Ac)AӏHAcGAMAcLAd @.@fv%A0@>@c$A@@o@; Ï/Ap@@ ec.A%@@L 7H@@x Z>A@@  c=A ۏCA@/@  cBA 0@D@: P@d@f 3RAp@@  cQA  {@@Sv 1 H@@S WWA@@  cVA ˏ\A@@(  c[AT aA@@s  c`A ;?@@j7@into@C@aintQ_7ZwmyZV,(ZIJ#xK#Lh#,&Mh#  Nh#)OM#"OMYM#xZM#^ [#!\Z# ,&]h#:^h#os3Xz3  s cO nz i3   ptr3 W 3^ ~ d s1 s2d nz1kCkpx7xjqhZ ΐ s c3 nz i3D@@ g @@ ptr minMc maj :-h SF@K@`@@m@@~@@ @8@fhh @@!(@h@ Z",&h #sth0  maj @P@$:d %m:~$: &>p@@ ':=z ?3 f@a/pABhmajC\minDM@<EM,&Fz`@@ZS@@P`@@`@@p:`Dhz`Q@V@LL@d@h&@@p',&zEptrminM   z2;.h[S@@0`@@m( (;qs.$$@;7BMyX`@@i`@@^& @C@'} z',& z 3p  ~&@=@&@=@)R*{bH@*cL@+eM,3*f3 {@*ސg:P@*h:@@*Hk:8@*l:(@*hm:0@-q.AP@0@_aintQ_wmV#]P@0@ str"L"h"35z$]%3&['3 h jY3eđg0@@aintQ_wmV,(Oˑ!0@@9h enum d,& d֑ ё%  tmp& i'3  3 A:@[@aaintQ_wmV,(O%3@[@Gs1#ss2#n$dh`@@aintQ_wmV,(O *`@@dst)*src)ln)dX;d,Qs-R h  .(@@aintQ_wmV7+@@p*ch*302,Dc-Wh Z]@@]aintQ_wmV,(OV#ArJ43@n@js12s22n3dp;us17<us28Z  h  o ?%3p@@s1$s2$us1'us2(%Jr@@intaQ_wmV,(OjA@@r|:: :ddstB+srcC_tDd8%}@   h   @@waintQ_wmV#@@Ds"pj"2$h _@@aintQ_wmV+@@p*ch*3c,Qh@>@aintQ_wmV*3@>@%s1)Qs2)h2@@m@4aintQ_wmV#@@m@to"?"2$h ƒp@@paintQ_wmV,(O w&p@@(str%Tlen'dD( h  =ϒ@@aintQ_wmV,(Oؒ$d@@str#s%R hߒ@y@intaQ_wmV,(OA@y@|: :<  :d\ dstB srcC tDd2!8%}@   h   R@N@aintQ_wmV,(OV#A%Orא<@N@!|:!c0:30" :dP" t=d{" c?z" dstA# o5LgP@@7aintQ_wmV,(O:#dP@@I#s"u#*"d#len$d#  h /@@#Cn.O#s.C$h.OI$ st0IKi1Ot$y;O$ ;t5O YY B] @@$str$3g]?% 3h% ;c\@@%str3@@%1s1s2-@@%Gɸ &end@&g˽]5̽_hͽ^neg3v&3&out2@  CU @@&G end &&@@&KGend EV@@ 'GD6'D'hD3'gFV*(negG3(out@a3@@)s1@@<)1Gh3rN-ݓ@ @laintQB5L_7ewmV,(e'e0Zzh r , n-# ].#  x/k@V @h)fjZ)jZ* j/*il3*kqZ*xrZupe` @z @+ؓdA3+]dAF4 @V @R+4ѓE~+]EʓGdiHZ+@HZ+ 9` @ @+^i:Zq6d@[4`@  1`@  2@uZݓ @/ @aintQ_7ZwmV,(Z'=(#,&)o#H*zh  R&M['#v(O#  a @ @,2 v`O2,b2ic3], bO @ @p,y vNO,P2iQ3,9,O @/ @, M[+(- +Oid-OT-R52g-<2i=3z-#l@q$Oh@ݓ @@MaintQ_7ZwmV,(Z'Z0|Ooz 3 pid4O# x5O# 6o# 7z# 8 '$ =(*# ,&)o# H$*Ah ”tpids|xsO@u3֕vr @ @-pidp|xpO֕q;b @ @-pida|xaO֕a3ؔS @1 @-gpidQ|xQO֕RO͕C@ @p @.pidA|xAOlenAo B; 8Ap @ @=. @@i.{pid|.;.o. ;.xO/ {֕K;g\;r` 4@d?39@ >)p@@,9ʗ(X9i.S@@w9$-S93@@9Q298S@@ :~7S9:@@X::<@j@:n;:i=3; -p@@/;-n[;x;i 3; BF3@)@;Z3<srcdst f30@H@?<eipe1P@X@k<n<i3<8<sɸP<n6<fѾ<9Ғ$p6 =h<s a@ @!ipZ@ |@  Z "#P`@@>=GZ3j=$srcG=$dst6=,&=Nres6.> M% T&p6@/@L>iporesr6x>!bufq@'xT0@@>$strS>(H@V@V)*}@@X)"+"6+ "65+,ۘ %{@,ӗ %{@, %{@"B{+,ok`{@,.%{@"+,Z0@{@-k&3 @. 8.j Y3fq@@aintQ_wmVrhq'3@@>Jt'k@9"@aintQB5L_7ewmV'er e#A 2   3 Z##ș3#0;m%h13@ @%?s;sQ?X3? 3@Y@?;s?X3@y&3`@@U@;%X%3@ &>3@@@^ =3@;=1AQ=sAi?3Aos@@Bns,BidpZ@O3@5@nB;s3@@e@B;sB3p@@Bi43 3@ @Bcsig3C cTColdrC i  @!@CX3C]9DH3 !@!@WDXG3D][Dg!@!@Dљ{!@!@E<Xz3FEk3!@9"@fEw pidjzXj3EG!+w@!,@!E-ă@"jY39@"@"*@Ds!0s:haintQB5h_7wmV,(jh"'+*Em,Or .v%1uid2# 3u#pid4# '5# 7# 8# 79# :]# -<# :={#! : ]H>`4  * ݚ m  u ' = (# ,& )# H  *͚'8 (8#fd)O# +O# ,O# dupO@"@T"@EkfdOO`"@t"@EfdOOhO"@"@FfdOAFiOF O#@ $@FfdOFcmdOkGGiOG#@#@sap%argOH#@#@ap%argO2HfPO$@$@EHO8qH\Hi]OH:$@%@H &~8 %@r%@H7fd}O%I!iOYI_%@,&@wIfdOIbufI"9I"nJ#8;J#YJretwJ $ǚ0&@&@JZfdOJbufJ"9 K"n,K#8dK#KretK+&@T'@Kfd~OK"n~L"]~ObL#8Lhf`'@'@L fdeOM*e,&e#g8$M[onH'@1(@BMfdGOnM"*GM",&GM#I8N#[Q4N8@(@L(@RN%fdO&  ':1oOP(@)@~NJtN˙OO(}l9OfdObO#%8O)<af 8O8)@P)@|f8O*<f8O+:,-{:O*@"*@:PJt9 9(10@ (93O@.68.V78.88.j YO=A0*@*@aintQB5L_7ewmV,(e'erh .Z%1?id2#3?#pid4#'5# 7#8z#79z#:A#-`4K  DIR&K J&30*@*@fP %P %3f)P<dir-P  V djY3L*s*@,@}haintQB5S_7lwmV,(l'lr .a%1?id2#3?#pid4#'5# 7#8#79#:H#-<#:=E#! % HH>`4K g % lC:*@,@Q _@:GQ |AQ ZBaQ oliE?CRTQD?{@  ?8 V;4?$@ 1:{@2:,@e0:{@Q3:(@ ,@,@aintQ_wmV'Orh1d,@,@lR'd,@,@Reb-@-@aintQB5L_7ewmV,(ejh"s'erh .Z%1Jid2#3J#pid4#'5# 7#8z#79z#:A#-`4V  +3-@-@R : * *  K -@-@RJSbufJJ .JzlenL`4|  43`.@g.@T Jt3 3  C3p.@w.@T B3 B ՛3.@.@TN Jt ޾ 3.@.@U Jt  S .@.@0U  3.@.@\U  ̾R3.@/@UDfQDUܛQJUposSsU   3/@/@V3/VܛJOVfDV y3/@0@V JtxVܛxJ4W#z3jW{DW@0@0@dir W | 30@I1@WJtXܛJ=Xg3sXfDX1@I1@buf}(@j Y3N@P1@g1@aintQ_wmVG 0]1|r  !f# "q#"3P1@g1@X tv! tz!d ;p1@1@ j0w*00/Mh"0 /7#J/7#/7#/7# 0#B a intQ_mV O,p1@w1@X9 fd+ Y+ +9 ?"0T r11@1@Y fd0 ,0 z6%1@1@3Y 59 E#1@1@_Y " " T1@2@raintQ_wmV,(O=-)Or#d1@1@Y)d1@1@Y/o2@2@Y5o2@2@Z 2@4@aintQ_7ZwmV,(Z'Z'=(#,&)o#H *h r Ĝ )  pid*|#+ ##,3# BCCpidA|iC3ĜDC nvpidm|io3ĜpC| 2@3@;Z&pid|gZ#&Z3[ĜC"[82@[2@#<.@[7I2@3@V<a^[j 3| 3@C3@|[X#&TP3@3@[pidS|[ĜVCoutf3@h3@3@V#=.[7Ϝ3@4@\qpid}|I\x}O}o\ ~z\ĜC\  =K#8=.\7!X=#p=.]7"94@4@%]#ޜ0@ $jY3?4@5@aintQ_wmVG 0]r)!""d#1#d#9*34@5@Q]Jt)*)  h  )v jY3G5@@5@}aintQ_wmVhrd*r5@@5@}]V)3Os+@d ?  @5@y6@aintQB5L_7ewN8wmV,(e'eG 0~r .ZZ/A%1Yid2#3Y#pid4#'5# 7#8#79#:A#-<#:=f#! _h AH> 5! "S#ot## _  DIR&l%"n&"#'#,&(l#%)#*# +# _2 -t@5@b5@]sdirssns~ ip5@5@]dirhsm]~5@5@^dir\sRC'5@G6@-^'dirBsY^{D-y^J^uP'^ w 2ĝ53P6@j6@^_dir4s*sp6@y6@_n) _[2ԝ6@'8@aintQ_wmV,(Or,6@7@A_+m_len/d_i03_numB3_͝.3@ hݝ^37@'8@`?]K`fd_3` len`dP bufa? N NjY3Vެ08@8@fa2>intQ_7ewmVhrpc"08@K8@`pid!Z` g#ZP 2>P8@8@`Dpid0Z"a k0ZMa x0Zmalen1Za 1za g33P :Th ZT D8@;<@aintQB5L_7ewmV,(eh'er .Z%1?id2#3?#pid4#'5# 7#8z#79z#:A#-`4K  Z[#h\#^z#n_#  a`dchd#fz#ng#  aTh y38@:@aobg3\bٞ?ul˞?b#e9@b=1zb,&zc*c  V  a   33:@;<@c:1@co1c2.dg43Nd5d6d˞G?JeٞH?se#:@:@F:@{;@;<@1mze,&nze*ocr  a jY3@<@L<@*aintQ_wmVh@<@L<@e(#P<@E@aaintQ_wmV,(Ohro'=(#,&)d#H*  & ϟ Q E / Ÿ1&֟2#3#h15&# o6wppcwd}4v]3ppcwd}4v](3i)3Fvh1DlenEd֟EE4Gv oNiP<@>@fhIfhpgf"h3fߟjugposkf]luh֟mul4nvg=<wd.g =!!!!="#=@=@(!!!!>"#=@(>@[!!!! >"$8>@>@!!!!8>"%}>@:?@g&g4v'ip h(>@$?@'g}*h' dHh@pi3("34v)@:d9p,&;di<34=v_]p*]}/^ib34cv%+}@?@C@[hZ&h4v*ipud]3',&dh'`}h+6?@?@r!CP>,Ni"Y"d-|p>!>,1i,Oi",mi,i->!>, i,)i,4j+@A@B@!!R ?"^,j1j"t.B@B@!!!P?,Zj,nj/}C@E@j&j'ޞ}j*pul',&dj'4vk-@?+!R?"^,j?k"t.C@D@-!!!?,sk,kE@E@0aintQ_7ZwmV'Z,(Zh'oE@E@k pid(okv8o E@3E@k pid7o g9olVo@E@aE@lm jTO uidTz ٢T j#Uo pidWoDl kpE@|E@WlzE@E@l g{lk٠E@E@aintQ_wmVhɠE@E@lE@E@aintQ_7ZwmVh!E@E@lؓ O@ 8E@sP@}s!0s:haintQB5h_-6z7wN8mV,('r .%1jid2# 3j#pid4# '5# 7# 8# 79# :]# -<# :=p#! : ]H>`4v%  O p&   :d'W@#posO#  :J=K=#posLO# ?Obuf=j,&=Oߡ=>2=>h>Oeof>9z@OiAOcBOUCO O?ptr?,&O.p .?1.E.K o   OE@E@m2=Fms ret OR "$OF@ F@em2=#s%~gOF@F@m 2=fsh  I F@KF@mS2=m c:ns!FOPF@N@Un"fmtn"ap%p#ߡq#q#:Gr#2=r$retOu%Ou&lenOt%,&Ou&cOt%jup'?u$bufP(С)a)LI@).I@)F@*?+h Ou,eofOv-X@ ,ptr9v.x@:///0N@N@10M@M@120M@M@12*N@2N@1%-@lpuendu3ǡOu@3COuDptrjuH435C@-////u/j/_/T*A6$w16cw7uL-PAC,ptrBw.pAC///0N@N@ 10FH@XH@120N@N@212N@N@1%-Amptrjju3MkOu*A,iKOwptrLju8:9:8:;<ppOO@;O@w =fo==fmto=apo%32=qp<O@O@cO@ xI=fmt=ap%<rOpO@O@Lx=fmt>ap%retOP<q|OO@O@xx=f{==fmt{>ap}%ret~OP<;-OO@O@x@ @,=fmt,=ap,%32=.p<<:OP@!P@x @9=fmt9>ap;%ret<OPx^0P@LP@x 2=] c]:(ys_ ,f`=GyPOPP@sP@Zy6 2=OysQ fR=,cSOy?6=]`P@bQ@ s!0s:haintQB5h_7wmV,('r .v%1Tid2# 3T#pid4# '5# 7# 8# 79# :]# -<# :=Z#! : ]H>`4`   O :  O  O  :   v# #arg#Ѣ##fp$## k4OP@P@yfp3#ԃ3ap3%٢5 t6h<OP@P@yfp;#ԃ;ap=%z>OPޢ/OP@:Q@z%arg.%Hz.hzn.Oz  (O@Q@bQ@zarg'%c':zcpQ@R@| aintQ_wmV,(Os!|sh 3 o 3 o 3   # # argo# J &W *'W# X(d# .)d# -3pQ@Q@ {arg,5{c,k{ @>3Q@R@{*={ԃ=|ap=q#|٢? `.@TzA3C|WAe3R@R@a|*dԃdapfqzg3PR@W@! aintQB5L_7ewmV,(e'er .Z%18id2#38#pid4#'5# 7#8z#79z#:A#-h AH>  _ >`4K g3 oR@R@|YoS@S@|3 S@)S@| d_30S@~S@},c3=}`S@vS@cs>u{x8S@T@s}28}pos3}c3}oA3T@^T@~c3=~@T@VT@cs>u{3`T@T@s~ ne~strY~3T@+U@#7strYOv/0U@W@~01~~,&2z>V>V) @$@V%@&@jY3 k`W@\h@aintQB5L_7ewmVh,(e'er .Z%1?id2#3?#pid4#'5# 7#8#79#:A#-<#:=E#! z AH>`4K3pid4Z#x5Z#6# 7# 8a 7id8#,9#~:#,;Z# <?Iid@#,A#~B#,CZ#  DI# AX EOyidP#QcUidV#W K  z}& zres {K#٤ |#% V2%,&1%3E%W@W@c8W@W@:+3W@W@f_3W@W@Jt^J3W@X@_*?N 3,& _ ?out8X@ R3X@ Y@QfM3Y@=Y@L*L?,&LŤG3@Y@nY@F*F?pY@kZ@@srcl,~ǂ2c=$Z@=Z@ B  A  XҤ3pZ@Z@U7,&3Z@Q[@Ճu kyp!:3`[@[@7"c#gZ`hs[@z\@g Qnpgos%=wE ۣN3\@\@cdMnMsŅ]M3$Y]@#]@R0]@^@I u,~O83^@^@:%str77%3_@E_@c$3$&ch&zu{3P_@_@c31g?E!_@b@ "2Ɉ", "~E"}# ^\'A =+,&>(B)' B =*u,&,`@a@*i3+?EAF3b@bb@ E,cGzw]?pb@5c@;u 2\?g \3\,i^3݋,c^3!̤K@c@ve@ "JtJE" Je-GL?up.msgR +PSE*iW3#=~Ō#/@B+_ z 0 e@e@-l3e@ig@Y : kk *m _ nңo,srcqۍ,dstx/XB & A 1!pg@\h@DM "p" "ˣ#=+V-ã- @- .Z$@-/(@282j Y3$w`h@i@6aintQB5L_wmV,(Zhr'=(#,&)o# H* ؜e`h@h@ gd30 msggd hzV#i,A, 36Eh@h@OpM3h@7i@{skLus ٜ1@i@i@ g03ӏ`i@zi@i43k5u ~(,@jY3 b Bi@@aintQ_wmVs!qs{h 3 d {3 d 3 {  # # argd#](ڦU' 0 i3֥:hOեV {   #? ]#%}'?|buf|1|O+2Vi@i@91V=1O{1̥3Vrem4OO2Lj@j@Ɛ.?KVbufK#KOOKOopMuXN.u`OVPOǑQOup 3j@j@ڑm٢mc{03j@k@f٢mn3ҒxBi3.32 ;3k@k@P!L|"@3#-k@p@!ԃ,$ap,ff%.ud"*}/3%@03ul"03"ʦ03m"13–"23&i33O#3p@@m !٢m!ԃї$apf&t".3"˙{"m O"1!O6" "O"s#O'$O"%3͠"& (?p@)B&ret23R)B &ret=3)B'"š)C &len3&pad3Ǣ)0Ce&ret3ף*u~@~@&ret37)HC&ret3*Vq@q@&ret3*}@}@+ret3P)`C&ret36,(@H@&ret3u,x@x@&ret3ե*q@/r@E&retX3)xC-bufl %?m])C&ret~3^.C}/01])D +buf "3G)`D &len3W*@(@+ret13P*w@ x@!&retH3*{@{@?&ret 3")DY&ret#3V*|@5|@w&ret?3*H|@m|@&retC3ԩ*m|@|@&retE3)D&ret-3)D&ret3p,H@u@&ret)3*u@v@ &ret^3)D: "?:-)ET "?Ve*x@y@r &retS3ͫ@E&retY3)XE &c{@xE&ret3^,}w@w@+retc3P2{ 3 45{6 B3 ]@@aintQ_wmVhW(J'On@@| OK@@Ԭ JJO nEL X23@@ rnd33,yA]@@?F 30@ @ @@aintQB5L_7ewmV,(e'eG 0srtm$".Ǩ#3#$3#ȧ%3#G&3# է'3#:(3#)3#i*3#+3# h .Z%1 id25#3# pid4#'55# 7#8z#79z#:A#-@`4 )  O d  ^  ¨  Ψ Y ç Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec  ߨ } T Ч i B Sun Mon Tue! Wed" Thu# Fri$ Sat% & ' 2( AM) PM* ܧ+ ,n| @@k{g{ ׭33c}&E@  q`@@<_g_bu|o@ @h n@+@6#0@:@b b htm%@@J@ԋ+P@W@݅z`@@Dstrpzwtmb<i.(c.Q,&zznz*i .3.. D@@7tCcgEutG   3& tm"@@Ө%LxE@&LtE@r,3D@b,i@i@s!0s:haintQ_wmVr O :O O :  # # arg#<O@@cԃ;ap;%¢=lCO@ @ԃBapD%zEOPߢ,O@P@=arg++in+Olen-O%OP@i@ճarg$c$:p@@Vs!0s:h LRggn:int {gng :  A# p# argn# K  *!# ." #:w!&gp@@ Karg%Kc%:-g@߇@L*,xԃ,ap,%ô٢.l/`z0gB<g@@*;ԃ;ap=%z>gP@O@haintQB5S_7lwmV,(l'lr .a%1?id2#3?#pid4#'5# 7#8#79#:H#-<#:=E#! % HH>`4K '@O@" %N %y Vw%: 4&:ϵ  % 8 VzrHP@H@aintQ_wmV,(Os!|sh 3 o 3 o 3   # # argo# , "W *#W# X$d# .%d#:)3P@@arg(c(Q "C3@@!*BW,&BdԃBapBq5٢D d/EXzF3U#U3 @H@h*TW,&TdԃTapVqzW3PcP@P@haintQB5S_7lwN8~mV,(l'lG 0r .aZ/H%1`id2#3`#pid4#'5# 7#8#79#:H#-<#:=f#! % HH>`4l %n&#'#,&(s#%)#*# +# %  -$!!ޞ#' l -%S*:P)!P@k@nCp@@ޞB'D  w2@@*DoP@@V?ޞO'dirQ!@ɉ@Q)e2ω@܉@S>:@@=!n=]=:|0@P@/!g5N ZP@e@%aintQ_7ZwmVh!P@e@lv O  ORp@@aintQB5L_7ewmV,(e'eh 3 pid4Z# x5Z# 6z# 7# 8r HJE nKE# L3#@ Mz#D NU#H U? Ad3p@@Atres3Ĺ֕׹@3Њ@@dev,&z@m@!S٢ؒMSmyzpos33p@݋@˺٢"y3uppos35@R@H٢y3tsupret3 %wC`@@QnBRl@@;cmdk߻k3!pidmM^pzuh&q;rulzz JEѩYdirۼEݩzjh J Y h w.X@@-gW3ȩYmsgZ1@^@Yn0ȩ2msg3 ˪N`@@pidM^@@aintQB5L_7ewN8wmV,(e'er .Z%1Cid2#3C#pid4#'5# 7#8#79#:A#-<#:=P#! Ih AH> HidI#nJl#]K3# DLd V  .@@ -ݽ n-l ]-3 /d@ْ@aintQB5L_7ewN8wmV -Q.Z#mac/l#h  r .Z@r@` ip- /lV1AA)zt@@ɾ{sZmacsl īuh *z{T _Y@@macXl gZuxmM@ْ@!ipLZ gNu|@3@naintQ_7ZwmV%zhO@@M,&O idOy˫z@@ idO o ޫ @3@˿ idO-@@\@aintQ_wmVhtd3@@\@nOsn 4`@l@5 aintQ_7ZwN8lmVhE!a`@l@#eax"OOedx"ORiap@7@ aintQ_7ZwmyZV$h%h&'# (z#) Ĭ! ,& O ˙ O ptr" p@@b.  hT1@ޓ@,&0O˙0O ptr2F2 Fpp7@@,&6O"6O˙6O ptr8G3@@3F,&FOgHOU @7@%T,&TOլ@@\@o!aintQ_wmVh@@L@Q P@\@}`@H@!aintQB5L_wmV,(Z)3'Zh E$ ٭   ) *# ?+z# len,o# ~/& num0o# P1&#5 T4z ppb5z# 6o# 7o# 78o# QoldP1Po:PonewRA`>b?5Y`@̔@Yppbzo"noBlenokoi3Qq3Д@&@ppbzoi3Ry3?0@@R+ppbz~o+y3 i3Qarg 3˭b3b``?alenao @co @d3newe!"""!#$$3bshm3 ,&opi3 i3 nz 3@@99bJshm3sp9%8F&PF#%1pF"a"V"K"B&F'l#w#(ٖ@;@k"""&F#)F"&F##'''$'D#?@H@d*Ţ9shm3retȇ+jY3MP@@#aintQ_wmV,(O'=(#,&)d#H(x##?$o# *q NP@h@ M  Vdp@@!7 UM @@  @3Rnn3D %o @;@m  @3X>ݿo@@@H@3N? oX>&GO( Yo@\@  9?oCvB`@@a A خ@@'  @3 ?oRϮ@@O bh @o@n g ?go 4m E6p@@@7 +d@D,3h@l-l@u@Z@$aintQ_wmV,(O&zr%d@Z@ls$$s1* bit+o tbl,Lidx-3  h oM9`@2@$aintQ_wmV2`@ @ s151K13tok3;c43osc43 @ h   %`@2@ s__Kap@ ,@@y@%aintQ_wmV,(O5)@@y@s&c'3%n(dg(Gp+R    A% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I$ > .? : ; ' I : ; I.? : ; ' I@ : ; I 4: ; I 4: ; I 1X Y  1 4: ; I  I&II!I/ 4: ; I % $ > $ > : ; I : ; (  : ;  : ; I8  I &  ' I I' .: ; ' @: ; I4: ; I 4: ; I: ; I.: ; ' I@.? : ;' @: ;I: ;I: ;I 4: ;I4: ;I.? : ;' I@4: ;I4: ;I4: ;I .: ;' @ .: ;' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I  : ;  I!I/ : ; I : ;  : ; : ;I8  : ; : ;I : ; : ;' II&< ' : ;I : ;I8 .? : ;' I : ;I .: ; ' @!: ; I".: ;' @#: ;I $: ;I %.? : ;' @&: ;I'.: ; ' I (4: ; I)4: ; I*4: ;I +4: ;I,1UX Y- U.41/41 0.? : ;' I@1: ;I24: ;I34: ;I 4.: ;' I 5: ;I64: ;I7.: ;' I@81941:!I/;.: ;' I <4: ;I= : ;> ?.: ;' @.: ; ' A: ; IB.? : ;' C : ;D1UX YE 1F1G1X YH UI J1X YK4: ; I L4: ; I? < M&IN4: ; I?  O4: ;I?  % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ;' I : ;I4: ;I.? : ; ' I@ : ; I!4: ; I"4: ; I#4: ; I$1X Y %1& '41(1X Y ): ;I*: ; I +4: ; I,1UX Y - U.41/.? : ; ' @041 14: ; I?  % $ > $ > : ; I  : ;  : ; I8 $ >  I I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ;' I : ;I: ;I.? : ;'  4: ;I!.? : ;' I@": ;I#4: ;I$4: ;I %4: ;I&.: ; ' @': ; I(: ; I)4: ; I *.: ; ' I@+: ; I ,4: ; I-4: ; I .4: ; I/ : ; 01X Y 112 34: ; I4 5.: ;' 64: ;I7 : ;8 941:.: ; ' I ;: ; I<4: ; I= >: ; I?.? : ;' @@4: ;I A1X YB1UX YC UD41 E41F 1G1H1X Y% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8  : ; I 8 .? : ;' I : ;I: ;I .? : ;' ! "4: ;I#.? : ; ' I@$: ; I %: ; I&4: ; I'.: ;' I@(: ;I)4: ;I*4: ;I+&I,: ;I-: ;I .4: ;I /.? : ;' @0.: ;' @11UX Y2131UX Y4: ;I 54: ;I61X Y71X Y8.: ; ' @9: ; I:4: ;I ; <41=4: ; I>4: ; I ? : ; @1UX Y A.: ;' B : ;C UD41 E1F.: ;' I G : ;H I : ;J41K 1L UM : ;N O.: ; ' P: ; IQ R 1% $ > $ > : ; I  I&I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II& : ; I8 < ' : ;I : ;  : ;I8  : ; ( .? : ;' I : ;I : ;I!4: ;I".? : ;' #.: ; ' I@$: ; I%: ; I &4: ; I'.: ;' I@(: ;I ): ;I*: ;I +4: ;I,1X Y-1..: ; ' /: ; I0: ; I14: ; I21X Y31UX Y41 516 U7418419: ;I:4: ;I;4: ;I <.: ;' @=4: ;I> ?.: ;' @ A.: ;' I B : ;C D.? : ; ' @E: ; IF4: ; IG4: ; I H1UX Y I41 J1UX Y K L1UX YM 1N.: ; ' @O: ; I P4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8  : ; ( .? : ;' I : ;I .? : ;' !: ;I"4: ;I#.: ;' I@$: ;I%4: ;I&&I': ;I (: ;I ): ;I*.: ;' + ,.? : ;' I@-4: ;I.4: ;I /4: ;I01UX Y1121UX Y3 U441541 61X Y7.: ;' @8.: ;' I 9.? : ; ' @:: ; I;4: ; I <4: ; I =4: ; I>4: ; I?4: ; I@4: ; IA1UX Y B41C1X Y D E1X YF G : ;H.: ;' I@I4: ;I J : ;K UL1M 1% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ;' I : ;I: ;I4: ;I .? : ;' !.? : ;' I@": ;I#: ;I$4: ;I%4: ;I&4: ;I '4: ;I (.: ;' I@): ;I *1X Y+1, -41.1UX Y/ U0.: ;' @11X Y2.: ; ' 3: ; I44: ; I54: ; I6 7 8 9.: ;' I :4: ;I;.? : ; ' @<: ; I=4: ; I>4: ; I?4: ; I @ : ; A1UX Y B41C41 D1X Y E1X Y F1G1UX Y H: ;I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ;' : ;I.? : ;' I : ;I .: ; ' I !: ; I": ; I#4: ; I$4: ; I% &4: ;I'.? : ; ' @(: ; I)4: ; I*4: ; I +4: ; I, : ; -1X Y .1/1UX Y 0 U141241 34141X Y 516 % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ;' I : ;I.? : ;' : ;I 4: ;I!.: ; ' @": ; I#: ; I$.: ; ' %: ; I&4: ; I'4: ; I( : ;) : ; * + , -41..: ;' /4: ;I0.? : ; ' @14: ; I 21UX Y 314 U541641 7 181X Y9 U:1X Y ;1< =1X Y>1UX Y % $ > $ > : ; I  : ;  : ; I8  I I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; : ; &I' II& : ; I8 < ' : ;I : ;I8 !I/ : ; .? : ;' : ;I .? : ;' I !4: ;I".? : ; ' @#: ; I$4: ; I%: ; I &.? : ; ' I@'.: ; ' @(: ; I): ; I *1X Y +1,.: ; ' I@-4: ; I.4: ; I /.? : ;' I@0: ;I14: ;I24: ;I 34: ;I44: ;I 51X Y6174: ; I8 941:.: ;' @;: ;I<.: ; ' =: ; I>1X Y?41@.: ;' I@A4: ;IB4: ; IC4: ; I D : ;E.: ;' I F : ;G H1UX YI UJ41 K 1L: ;IM.: ;' N : ;IO1UX YP.? : ;' @Q4: ; I? < % $ > $ > : ; I  I&I : ;  : ; I8 : ; I8  : ;  I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II&< ' : ;I : ;  : ;I8 .: ; ' I@: ; I: ; I : ; I !.: ; ' @": ; I #.? : ; ' @$4: ; I%4: ; I&4: ; I '4: ; I( : ; )!I/*4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  (  : ;  I!I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II&< ' : ;I : ;  : ;I8 .? : ;' I@ : ;I!: ;I "4: ;I #4: ;I$4: ;I%: ;I&4: ;I'4: ;I(.? : ;' I ): ;I*: ;I+ : ;,1X Y-1. /4101X Y1.? : ;' @24: ;I 3.? : ;' 4.: ; ' I 54: ; I64: ; I7.? : ; ' I@8: ; I9: ; I:4: ; I;4: ; I<4: ; I =4: ; I >1UX Y ? U@41A.? : ; ' I@B: ; I C.? : ; ' @D: ; I E.: ;' I F4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8  : ; ( .? : ;' I : ;I : ;I!4: ;I".? : ;' I@#: ;I$.: ; ' I@%: ; I&4: ; I'4: ; I(4: ; I) U*4: ; I +: ;I ,4: ;I-.: ;' @.4: ;I /4: ;I0: ;I14: ;I 2.? : ;' @3: ;I 41UX Y516 U7418.: ; ' 9: ; I:4: ; I;: ; I< =.? : ; ' @>: ; I?4: ; I @1X Y A41B1X Y C1D41 E1UX Y F G.? : ;' @H1X Y% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ; ' I@: ; I4: ; I4: ; I : ; I !: ; I".? : ;' I #: ;I$: ;I%4: ;I&.? : ; ' @': ; I (4: ; I)1X Y *1+ U,41-.? : ; ' @.4: ; I/1X Y 0 141 % $ > $ > : ; I $ >  I : ;  : ; I8 I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ; ' I@: ; I 4: ; I.? : ; ' @ : ; I !.: ; ' I@": ; I#4: ; I$4: ; I % $ > $ > : ; I $ >  I : ;  : ; I8 I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .? : ;' : ;I.: ;' I@: ;I 4: ;I!.? : ;' I@"4: ;I#: ;I $.: ;' @%: ;I&4: ;I '.: ;' I (: ;I)4: ;I*4: ;I +1UX Y,1- U.41/1X Y0 1.? : ;' @2: ;I 34: ; I 4!I/% $ > $ > : ; I $ >  : ;  : ; I8 : ; I8  I  : ;  I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II&< ' : ;I : ;  : ;I8 .? : ;' I : ;I4: ;I .: ; ' @!: ; I"4: ; I#4: ; I$1X Y %1& '41(.: ; ' ): ; I*: ; I+4: ; I,4: ; I- : ;..: ;' /4: ;I0.? : ;' @1: ;I2: ;I34: ;I 44: ;I51UX Y6 U7418 1941 :1UX Y;4: ; I <4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; : ; &I' II& : ; I8 < ' : ;I : ;I8 !I/ : ; ( .? : ; ' I  : ; I!.: ;' I ": ;I#4: ;I$.: ; ' I@%: ; I&: ; I'4: ; I(4: ; I)4: ; I *4: ; I+1UX Y ,1-: ;I.4: ;I/ 0.: ;' I@1: ;I24: ;I34: ;I4 : ;51UX Y6 U71X Y819 U:41;41<4I4  =.? : ;' I@>4: ;I ?.? : ; ' I@@4: ; I? < % $ > $ > $ > : ; I: ;I I : ; : ; I8 : ; I8  : ;  .? : ; ' I@ : ; I: ; I4: ; I4: ; I4: ; I.? : ; ' @.? : ; ' I@: ; I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; : ; &I' II& : ; I8 < ' : ;I : ;I8 !I/ : ; .: ; ' : ; I : ; I!.: ; ' I "4: ; I# $.: ; ' I@%: ; I&4: ; I '4: ; I(1X Y )1* +41,41-.: ;' I .: ;I/4: ;I0.? : ;' I@1: ;I24: ;I3.? : ;' @44: ;I51UX Y61X Y718.? : ; ' I@94: ; I:4I4  ;.? : ; ' <.? : ; ' @=1X Y >.? : ; ' I ? : ; @ A B1UX YC UD 1E4: ; I? < % $ > $ > : ; I $ >  I : ;  : ; I8 .? : ;' I  : ;I : ;I 4: ;I.: ; ' @: ; I4: ; I4: ; I.? : ;' I@: ;I.? : ;' @: ;I : ;I4: ;I.: ; ' I@: ; I4: ; I1X Y 1 U414: ; I : ; !4: ;I".? : ; ' I@#.? : ; ' @$1X Y % &41 '41(: ; I ) : ; *1UX Y +1UX Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I : ;  : ;I8 .: ; ' I@: ; I 4: ; I&I .: ;' @!: ;I"4: ;I#4: ;I$.: ; ' I %: ; I&4: ; I': ; I(4: ; I)1UX Y *1+ U,41-41.: ; I/4: ; I0.: ;' I@1: ;I24: ;I3.: ;' I 4: ;I54: ;I6: ;I7.: ; ' 8: ; I9.? : ;' I@:4: ;I ;4: ;I < : ;=1X Y>1UX Y?41 @1A1X YB C1UX YD.? : ;' @E.? : ;' I F: ;I G.: ; ' I@H: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I&I' I : ; I 8  : ; : ;I8  : ;I8 .? : ;' I@: ;I 4: ;I.: ;' I@: ;I.: ;' @4: ;I 4: ;I: ;I 4: ;I!.? : ;' @".: ; ' @#: ; I$4: ; I%.: ; ' I@&: ; I '&( )4: ;I*.: ;' +: ;I,.: ;' I -1X Y.1/4101UX Y112 U34: ;I 4!I/5 : ;6: ;I7418.: ; ' I 9: ; I:4: ; I; : ;<41 = 1>4: ; I ?4: ; I? < % $ > $ >  : ;  : ; I8  I&I&I .? : ; ' @ : ; I 4: ; I .? : ; ' @ I!I/ $ > 4: ; I 4: ; I? < 4: ; I?  % $ > $ >  : ;  : ; I8  I&I&I .? : ; ' @ : ; I 4: ; I .? : ; ' @ I!I/ $ > 4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' : ;I.? : ;' I .? : ;' @: ;I: ;I : ;I .? : ; ' I@!: ; I": ; I#: ; I $4: ; I%1X Y &1'.: ; ' I@(4: ; I)1X Y *4: ;I+ : ; ,1UX Y - U.41/ U04: ; I 1 2.: ; ' I 3: ; I4: ; I54: ; I6 7: ; I 84: ; I91:41% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I !1X Y "1#1X Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.? : ;' .? : ; ' @: ; I: ; I : ; I!4: ; I"1X Y #1$ U%1X Y &: ; I '.? : ; ' @% $ > $ >  : ; I$ >  I : ;  : ; I8 : ; I8 .? : ;' I  : ;I 4: ;I: ;I 41.? : ; ' I@: ; I4: ; I4: ; I: ; I .? : ; ' @.? : ;' I@: ;I: ;I 4: ;I: ;I : ;I.? : ;' @1X Y1 !4: ; I"1UX Y # U$41%.: ; ' I@&: ; I'4: ; I(1UX Y )1X Y *: ; I +.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.: ; ' I@: ; I: ; I : ; I!4: ; I"4: ; I#4: ; I$ : ; %1X Y &1'4: ; I(1UX Y ) U*41+ ,41-.? : ; ' I@.4: ; I /4: ; I 0 : ; 11UX Y 21UX Y31X Y 4 % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I : ; I .? : ; ' @: ; I4: ; I4: ; I 4: ; I!.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I.? : ;' I : ;I: ;I4: ;I 41 .: ;' I@!: ;I ": ;I #.: ; ' I@$: ; I%: ; I&4: ; I'4: ; I(.: ; ' I ): ; I*: ; I+4: ; I,4: ; I-.? : ;' I@.: ;I/: ;I04: ;I14: ;I 24: ;I34: ;I 4 : ;51X Y6171X Y8 9 U:1UX Y; U<41=.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I.? : ;' I : ;I: ;I4: ;I 41 .: ; ' I !: ; I": ; I#4: ; I$4: ; I%.? : ; ' I@&: ; I': ; I(4: ; I )4: ; I*4: ; I+ : ;, : ; -1X Y .1/1X Y0 1 U21UX Y314 U54161UX Y 71UX Y 81X Y91UX Y:.? : ;' I@;: ;I<: ;I=: ;I >4: ;I?4: ;I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I .? : ; ' I@: ; I4: ; I 4: ; I!4: ; I" : ; #1X Y $1%1UX Y &1X Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.: ; ' I@: ; I.? : ; ' I@: ; I 4: ; I !4: ; I"4: ; I#1X Y $1%.? : ; ' @&4: ; I '.: ; ' I (: ; I): ; I*4: ; I+ : ;, U-4: ;I.1X Y/ 04111UX Y2 U3414.? : ;' I@5: ;I% $ > $ > : ; I  : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; I&I' II& : ; I8 < ' .? : ;' I : ;I.: ; ' I@: ; I: ; I4: ; I4: ; I U!4: ; I".? : ; ' @#: ; I $.: ; ' I %: ; I&4: ; I' (.? : ;' ): ;I*.? : ; ' I@+4: ; I , U-1UX Y .1/104114121X Y 3.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I 41.? : ; ' I@ : ; I!: ; I "4: ; I#4: ; I$: ; I%: ; I &.: ; ' I@'4: ; I(&I).? : ;' I@*: ;I +: ;I,.? : ; ' @-4: ; I .1UX Y /10 U14124: ; I3 : ; 41UX Y 51X Y 61X Y7 81X Y 9.? : ; ' I@:4: ; I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I@: ; I4: ; I 4: ; I !1UX Y "1# U$41%1X Y & '.: ; ' I@(: ; I)4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I: ; I 4: ; I4: ; I 4: ; I 4: ; I!: ; I ".? : ; ' I@% $ > $ > : ; I$ > I!I/  I &I .: ; ' @ : ; I : ; I 4: ; I4: ; I.: ; ' I : ; I: ; I4: ; I.: ; ' .? : ; ' I@4: ; I4: ; I 1X Y 1 41411UX Y  U1X Y I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.: ; ' I@: ; I : ; I 4: ; I!.: ; ' I ": ; I#: ; I$4: ; I%.? : ; ' I@&: ; I': ; I(4: ; I)4: ; I *4: ; I + : ; , U-1UX Y .1/104111UX Y 24131X Y 4 5.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I4: ;I.? : ;' .? : ; ' I@: ; I4: ; I 4: ; I!4: ; I" #: ; I $: ; I %4: ; I &: ; I'4: ; I(1X Y )1*: ;I+ : ; ,1UX Y - U.41/1UX Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I.? : ; ' I@ : ; I!: ; I"4: ; I #4: ; I$4: ; I%.? : ;' I@&: ;I'4: ;I (.: ;' I@)4: ;I*: ;I +4: ;I,4: ;I- : ;.1UX Y/10 U1412 3: ;I4 : ;51X Y6 74181X Y9.? : ; ' @:4: ; I;1X Y <41 =1X Y >: ; I ?4: ; I@1UX Y % $ > $ > $ > : ; I.? : ; ' I@: ; I : ; I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I4: ;I.? : ; ' @: ; I1X Y 1 !41 "1X Y #41$: ; I%: ; I &.: ; ' ': ; I( ) *.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$.? : ; ' I@%: ; I &: ; I ': ; I(.? : ;' @): ;I*4: ;I+1X Y,1- .41/.? : ; ' 0: ;I112413.? : ;' I@4: ;I 5.? : ; ' @64: ; I71UX Y 8 U91X Y :1X Y ;41 <.? : ;' I@=1X Y% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.: ; ' I@: ; I: ; I 4: ; I !4: ; I"4: ; I# : ; $1X Y %1& '41(1UX Y ) U*41+1X Y ,.? : ; ' I@-: ; I .4: ; I/: ; I 04: ; I% $ > $ > : ; I : ;  : ; I8 $ >  I &I .: ; ' I@ : ; I : ; I 4: ; I .? : ; ' I@: ; I 4: ; I4: ; I4: ; I : ; U 4: ;I4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II&< ' : ;I.? : ;' I : ;I: ;I4: ;I  41!.? : ;' I@": ;I#.: ;' I@$: ;I%4: ;I&4: ;I'4: ;I(1X Y)1* U+41,4: ;I -: ;I ..? : ; ' @/: ; I01X Y 1 241 31X Y 4.: ; ' I@5: ; I64: ; I74: ; I8 : ; 91UX Y :.? : ; ' I@;: ; I <4: ; I= : ;>: ;I ?.: ; ' @: ; IA4: ; IB4: ; I C1UX Y D1X YE1UX YF4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I .? : ; ' I@4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I  41!.? : ; ' I@": ; I#4: ; I$.? : ; ' @%: ; I&: ; I '4: ; I(.: ; ' I@).? : ;' I@*: ;I +.: ;' I ,4: ;I-: ;I.: ;I /4: ;I0 : ;11UX Y213 U44151UX Y 61X Y 7 81X Y91X Y :1;: ;I<4: ;I =4: ;I>41 ?4: ; I% $ > $ > : ; I  I$ > &I  : ;  : ; I8 ' I I &I!I/ .? : ; ' I@: ; I.? : ; ' I@4: ; I4: ; I4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > &I .: ; ' I : ; I4: ; I4: ; II!I/.? : ;' I@: ;I: ;I 4: ;I4: ;I1UX Y1 U4141 41.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I .: ; ' I@ 4: ; I!4: ; I% $ > $ > : ; I$ > .? : ; ' I@: ; I : ; I : ; I 4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I .: ; ' I@: ; I : ; I !4: ; I% $ > $ > : ; I  I : ;  : ; I8 $ > I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; !I/.? : ;' I : ;I: ;I4: ;I.? : ;'  .? : ;' I@!: ;I".? : ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I (.: ; ' I@): ; I *4: ; I+1UX Y ,1- U.41/.: ; ' I 0: ; I1: ; I24: ; I3 : ; 4 5.: ;' I 64: ;I7 : ;8 9: ;I:4: ;I;4: ;I <4: ;I =4: ;I> : ;?1UX Y@41A41 B 1C1X YD1X YE1UX YF4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I@: ; I: ; I : ; I !4: ; I"4: ; I#4: ; I$4: ; I%1UX Y &1' U(41% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I 41 .? : ;' !.? : ;' I@": ;I#: ;I$.? : ; ' I@%: ; I&: ; I'4: ; I(4: ; I)4: ; I*1X Y +1,: ; I -4: ; I. : ;/1UX Y 0 U11X Y 2 34141UX Y5161X Y71X Y84: ;I9.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I .: ; ' I@ : ; I !4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II&< ' .: ; ' @: ; I : ; I : ; I4: ; I.? : ; ' I@ : ; I!4: ; I"4: ; I #.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I4: ;I 41.: ; ' I  : ; I!: ; I"4: ; I#4: ; I$.? : ; ' I@%: ; I&4: ; I'4: ; I (4: ; I )4: ; I* : ; +1UX Y ,1-1X Y. /1X Y 0 U1 U241% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I ( : ; )1X Y *1+ ,41-1UX Y . U/4101X Y 1.? : ;' I@2: ;I34: ;I4: ;I 5 : ;61UX Y71X Y8191X Y:.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8  : ;  (  : ;   : ;  : ; I8  : ;I8  : ;I8 ' II' &II!I/ $ > &&I : ;.? : ;' I@: ;I : ;I4: ;I.: ;' I@ : ;I !: ;I"4: ;I#4: ;I$.: ;' @% &4: ;I '4: ;I (.? : ;' @)4: ;I* + : ;, U-!I/..: ;' /: ;I0.: ;' I 1: ;I2 : ;31X Y415 U61X Y7184191UX Y:41 ; : ;< : ;= >1UX Y?41@ 1A4: ; I? < B4: ;I?  % $ > $ > : ; I  I : ;  : ; I8 $ > &I ' I I &I!I/  : ; I8  : ; I 8 .? : ;' I : ;I4: ;I: ;I.: ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I4: ;I 4: ;I: ; I : ; .: ;' @!: ;I": ;I #: ;I $ : ; %1X Y&1' (41 )1X Y*41+41,4: ;I-1UX Y. U/4: ; I 04: ; I? < 14: ; I?  % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I: ; I 4: ; I4: ; I .: ; ' I@ : ; I !4: ; I% $ > $ > : ; I$ >  : ; : ;I8  : ; : ;I  : ; I !I/  I.? : ; ' I@: ; I% $ > $ > $ > &I I.? : ; ' I@: ; I 4: ; I 4: ; I 4: ; I % $ > $ > $ > : ; I I&I.? : ; ' @ : ; I : ; I : ; I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I & &I I !I/ $ > 4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I : ;  : ; I8  I.? : ; ' @ : ; I 4: ; I 4: ; I 4: ; I 4: ; I.: ; ' I : ; I&I.? : ; ' I@: ; I 4: ; I1UX Y 1: ; I1UX Y  14: ; I?  % $ > $ > : ; I I : ;  : ; I8  : ; I8 .: ; '  : ; I .? : ; ' I@ : ; I &I.? : ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I1X Y 11X Y 11UX Y  .? : ; ' I@4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I.: ; ' @: ; I4: ; I4: ; I.? : ; ' I@: ; I&I: ; I 4: ; I.? : ; ' @: ; I 4: ; I 4: ; I4: ; I !I/ U% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > .: ; ' I@ : ; I4: ; I: ; I4: ; I.: ;' I : ;I: ;I4: ;I.: ; ' I : ; I: ; I4: ; I4: ;I.? : ;' @: ;I4: ;I4: ;I 4: ;I : ; U!1UX Y"1#1$41%41&1UX Y'1X Y (1X Y )I*!I/% $ > $ > : ; I I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I : ;  &I.? : ; ' I@4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  .: ; ' I  : ; I : ; I4: ; I .? : ; ' I@: ; I4: ; I4: ; I4: ; I  : ;  U1UX Y 1 U41 414: ; I&I4: ; I? < % $ > $ > : ; I I : ;  : ; I8  : ;I8 : ;I8 .: ; '  : ; I : ; I .? : ;' I@: ;I4: ;I&I.: ; ' I@: ; I4: ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ;I4: ;I : ;.? : ;' @.? : ; ' @1X Y  1!1X Y "1#: ;I$4: ;I%: ; I & : ;' : ; % $ > $ > : ; I I$ >  : ;  : ; I8 .: ; '  : ; I : ; I .: ;' I@ : ;I: ;I .? : ;' I@4: ;I .? : ; ' I@: ; I4: ; I4: ; I4: ; I U1X Y 11&II!I/ 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  < I !I/ $ > ' II&I : ;  : ;I8  : ; : ; : ;I8 !I/.: ; ' I@: ; I: ; I4: ; I.: ;' I@: ;I: ;I4: ;I : ;I !: ;I ".? : ;' I@#4: ;I$.: ;' I %: ;I&: ;I'4: ;I(4: ;I )&*4: ;I+1X Y,1-1. /410411.: ; ' @24: ; I 34: ; I44: ;I 54: ; I6 U74: ; I84: ; I 9.: ; ' I :: ; I;: ; I< : ;= : ;>1UX Y?41 @1X YA.: ;' B4: ; I? < % $ > $ > : ; I : ;  : ; I8 .: ; ' I@: ; I : ; I 4: ; I .? : ; ' I@ 4: ; I 4: ; I4: ; I U &I% $ > $ > : ; I.? : ; ' I@: ; I : ; I: ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > I !I/ .: ; ' I@4: ; I 4: ; I.: ; ' @: ; I: ; I4: ; I4: ; I.? : ;' @: ;I4: ;I 4: ;I: ;I .: ; ' I : ; I.: ;' I : ;I: ;I 4: ;I!4: ;I" : ;#4: ;I $: ; I%4: ;I&1UX Y'1( U)41 *41+ 1,4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I 4: ; I I&I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ >  I$ > : ; I&I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I.: ; ' I : ; I.? : ;' I@: ;I: ;I4: ;I4: ;I4: ;I1X Y11UX Y: ;I : ;I 4: ; I I!I/ 4: ; I % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I4: ;I 1UX Y1 U414141  % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41  % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' @: ; I: ; I4: ; I 4: ; I 4: ; I  ' I I I&I!I$ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I $ >  : ; (  : ;  : ; I8  I  : ;  : ; I8 .? : ; ' I : ; I4 &I.? : ; ' I@: ; I.1@1.? : ;' I@: ;I4: ;I: ; I 4: ; I: ; I 4: ; I U4: ; I U 4: ; I !4: ; I "I#!I$: ; I%&&&I'.? : ; ' @(1X Y )1*1X Y +!I/ ,4: ;I -4: ; I?  .4: ; I? < % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I$ > .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I &I: ; I: ; I 4: ; I4: ; I4: ; I? < % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ >  : ; I : ;  : ; I8 .? : ; ' I@ : ; I  I% : ; I$ >  : ;  : ; I8 I!I/ $ > $ >  .? : ; ' I@ : ; I : ; I  I&I% $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ > : ; I : ;  : ; I8 .? : ; ' I@: ; I  I &I &I 4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I 4: ; I 4: ; I I !I$ > 4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I '  : ; : ;I8  : ;I8 &I.: ; ' I : ; I: ; I4: ; I4: ; I.: ; '   .: ;' I@: ;I4: ;I4: ;I : ;I .: ;' @ : ;I!.: ; ' I@": ; I#: ; I$4: ; I %4: ; I &4: ; I'4: ; I( : ;) : ;* U+4: ;I,4: ;I- U.1UX Y/10 1412 34: ;I 44: ;I51UX Y641741 8I9!I/ :$ > ;!I<.? : ;' I@=: ;I >?4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > $ > .? : ; ' : ; I.1@1 .? : ; ' @ : ; I 1UX Y 1 .? : ; ' I@4: ; I.? : ; ' I@4: ; I % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I@ : ; I 4: ; I 4: ; II!I/ .? : ; ' @: ; I : ; I .? : ; ' I@% $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecrc32.cbitops.hstddef.hext2_types.hcrc32table.ht@)<bttP"[Yg̡"' dict.cdict.hL@[=Y>kN?/=x.4/=`[/Y>h\1==x.B==DLuKA}Az4#fuugGg.u/=tgguuuug/==uvJ5j/7K+fqy/;2nx@vu=fuuuv <Y.,tT=guuv<xJOuuK/rt.t^uu lg0N/bKRg0N/bK t xJ>>:zJf xJ>":zJ t= <guugugwm.=u ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidunix.cext2fs.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hdirent.hext2_types.hext2_fs.hcom_err.htime.hsetjmp.hext2_io.hblkid.hprofile.he2fsck.hproblem.hgetopt.herrno.hext2_err.hprof_err.h@g5l g~ȟiu![u(&XgKX xYhKvK$X_tg=<%.?%m󻻃rY_[.r>¦(mMlLuY/&"/gLvttqvt$Mf@w"w(  t }==MɄth\]!uhX[jhZhgّ5b:Jt حxK~! "=h>j==K=vfKe#֮=YL2Lʟ="}K%z PYhX>g>vu(yt f h%K ."ggx_g:  ײu~"fד<~gem~[+&X8̟"uf #|u ؇$i|fu)#>}KG "|J{#}(|tt[}t%<FYK><mJ0[AG y.ɻ~iwf"}f!zA =!C yJy(XOJ~h|Jj=ghf~J[~<.~fQt<#y.*}<L^fgػues<L'<<+Jgu04Z&u- =1 >fLDfv Zgj/1B,J>uZv1:''''''G9t)''' ,u~JvțlzRGV ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkide2fsck.cext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.h$/@y2YIɵ[~fuuuuu׭堭ɑʟuuuuwtwtwt̟2i~ tvt؟u@vwXpttguwtguxvn ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidsuper.cbitops.hext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hproblem.hl4@/ t=?$uu$.twXyGgvx膃hhi?/X~ t4 gGJbʯgKȻ> <&׭$$$vv(! J=u<} &I />uu<}uuWuu<}uDg== &>Lb4?K=hK=hK=hf{ )YZ{ X Y{'f z&0  M{Y{XZYz<ˑ{{/X{ #|9 X {Ȉ5xJi&|J# <|$hx. x >tu |&g|]<.yXyXyJ|X>Y|fn}6g!%/K$ztxfe/s<Jx/h|Y|f f||~ ":==uuuBBu%۠c׻ +fuڈvofxXJxX dh  ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidpass1.cbitops.hext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hext2_ext_attr.hblkid.hprofile.he2fsck.hproblem.hL@mS3.>Y=YL Buu=d?u!tytsZuK]yɑ=ح!s!<Y=xfw  uw v {Y/ZuqfoXxtv wvw yhuv,ug}\ twKt4Ni /X[Xwj`<kL XhuY tp( JG9H<=0 J/Y!u /~XppXu;t/.) wW!pvuKxx֭xKx[M^K Xv(2/uhL[Y ɻYuZ@A^8Rt yx֭x g_q*yx֭xVrr)f[ur<f[t{ ,t}<C&ggJ<g i5X|x Je|xx J!"}w .)K|fxx y0uw U8$Ʉ=uu>uuh q.K?6!0}W% +/5==t|=  <w<Jл"K''??UJ0Э*"Xm50#4!f+=gh>#*ghi{t"%P1 7^t"ȼ<JS6~\?=$u=fD%($KXzf{ <t~g<|| X"~.xx @|*|"$D'!2 fU'"t!'w$ 5"}'=}% <e"=0󓻻C0uS3zf af)#!L%7 !u=ȃu<{u=Ȅu+<{ʲʭ=ȃu~N+ =ȃu<{K?(%K/ J^"0yfYo ot YQqKt{} nvn<N0J==h|~ʑg6G#*'!!of~.(I;})=<{ 4{&{v 4?QMQ@&>V(\.? .uJJ}:<D{~}#٭=0x~|&. ~.9u.P8׳!" 2'@uw"J*&y -uɑ g"<t~~ |t=}}Xqt|~z3u }L!ؑ}<| ~'= }u|y ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidpass1b.cbitops.hext2fs.hstdint.hstddef.htypes.hcom_err.htime.hsetjmp.hext2_types.hext2_fs.hext2_io.hblkid.hprofile.he2fsck.hproblem.hdict.h@fCtt}a thxL}$~Z~uv }$w}[uu<q!=/X_=;XE=u>]zs#u"_\=Y Yg'  Kv= (KWW\yfnt!fK=K=?gv@ut Xt$x K= Xuufy<Yj!.0"N.uG==0guiV.(3K/啃#j=Wfz~f/xvgvyv/zyMfyL/uxLLK1W!~f<L= gLɮ1'ʼ=n=IYjYrfI&օWgh( fv!u< X!v!!s֟!g֟!#+ ~#Jtxɑʟ˻ɑ~"ux w{ |*fuuزA 8>Y guwMבK<>g<1.Y}u~t/}3w!.7|w[# <x=ؒKufp~"(.7<f|f$tB}~XZ lYY/gYg#A/{-}t {}t[ f z0~t{"!Kzf{jL4= <zʟ8{# 0=t0t}y~| J#YgKKJJ|" #|{֘0rے׭i^KY!&usgrؽ'<{g<!}9~-<!y'Jk{{+~~f   ~.tt{|YgK*#C.}+%}tJ9<}J/g]z)t~Jz)/ɻ=i~ |&$.|<#ug"w}"l{~!{n ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidpass3.cext2fs.hbitops.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hproblem.hT@3'`wgguuu>/0(hu=(tR vt U tx/  J|t|>e<|t|<~!fdY|lnn~ .ȼhu=0Q=,uۮgut~Zt!u=q=.ztɑH=X=uYuuu»// <!5> /& K=KA_!hK<iu=K(3==uB=Zg1v{{ X>^~~%ȭʑ̑u.t~~w#+~u/A7X )W <~x!uut"a=x/oE+twJ>u f/u.xtY!u.KJ*zf/g#!xxhyzf=zf=qn ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidpass4.cbitops.hext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hproblem.h@ .̑uw&gu)~ ~ ~/g'62 w=?x֑Q wX~g!=1P99uYuKkto~+Z tk0jsn ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidpass5.cbitops.hext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hproblem.h@lJqzz nz f}=<~f}ghv:}~ ~(>M"ZhZZ2f=uughg&~f.$_==Je%f\gLtv2Z~u~zJ>{2~Z}u}zJ>u=K{˭uuwɑaJ=<~f~gh+XU!l==Jrfigh=K} Ky+3tUP((#.#f=vx=K+=Kv tRfxKgyXb=> Z.j=u=ghgD<p!uk#9PN-%_-(vLyJ=~u/z~xxtzgגzJ=gבz<!hfz  ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkid../lib/uuidjournal.cext2fs.hjfs_user.hbitops.hstdint.hstddef.htypes.htypes.hstat.htime.hsetjmp.hext2_types.hext2_fs.hext3_extents.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hjfs_compat.hkernel-jbd.hproblem.huuid.h@ii*x0<=J蒜=Yt{htb%<d *gWjt tu4/=4<u$tKNX f /=uX/{kjOwX .v xguv==u+yz <.<~w~L3r/KggK"K#0$/,K &=C~3&d_ =K$7+iɑL<eJY;t@zwhfYf!w=||JzhuuZf@x` ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkiddirinfo.cext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.htdb.h&@=~.kwgZ崃u+<X/ < .n.nL t.KɄMf/"iLT2h.iLT2~. wgiYgZiLgS3f.iLgS3H. J/_wʃuu <vjfeuy<Jyhh~  gg>uq3Q/wYuK].gfgvw1Yg=Z&vhuvQ<>w<t=vwfK=vQ:' u!uvuf=xt Z ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkiddx_dirinfo.cext2fs.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.h.@gqAttLz.KɄz .xt%fK===gggh?q& e'ox׭Ku#tqf.HOuVXvZLztg ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidmessage.cext2fs.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.htime.hsetjmp.hext2_types.hext2_fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hproblem.h9@MHv u=Y=hurtwx}kuXK <冃~M ǡnlg}tw$yJvJr>w#yXy#cYBt t_#b .  +<LBX%z+ tq.g=gJgs~tit4tFHHHH J5 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/ext2fs../lib/et../lib/blkidrecovery.cjfs_user.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hext3_extents.hext2fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hjfs_compat.hkernel-jbd.h(B@f)!0===>Ah]u<_! Xwvtx t~ /gɯXu !>]ɔ J Y .~ .䭎k7f]@wfBt$<>7,="f{.ȭg&'~<t<~._f9bzh~6̑~ˮ Jvr fvDw<m JoKI ../lib/ext2fsregion.cext2_types.he2fsck.hJ@;2JZKZ t <XiJ$Y fZt./g=ufuv5ZggR=x=skXwus1Yhz4 ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/blkidrevoke.ckernel-list.hjfs_user.hstdint.hstddef.htypes.htime.hsetjmp.hext2_types.hext2_fs.hext3_extents.hext2fs.hcom_err.hext2_io.hblkid.hprofile.he2fsck.hjfs_compat.hkernel-jbd.h|L@Q</<&/i+K]zX4fwRh{.{XzX=.{.r`|;!v\L>0Gxj9Xp{]tfhJfuufXuf tq.w.$.M\|w=gjf<u.=/=f|=M!8] ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include../lib/etea_refcount.cext2fs.hstddef.hext2_types.hcom_err.he2fsck.hlP@=Y8 Xt tgM=?=Av=x< fzfuY~t/Z\/YuZg{(\[T5.[qIXw Jj""tuH)K_^,1!LZqfJɯLKLdZftLvKLyt_htNZ}k~fM tguvwwt<wtjwXw~~tg_=++; 5-}($o'.fu􄼒K"&gYM`K=Yf}"gjBrMt&J4 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/etprofile.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hdirent.hcom_err.hprofile.herrno.hi@?Y<=WYZ=oȄkJuYKZ,=Ivf%hKp|t[=guAYKj tK J!mJCuYuB=/ tgut .OzX֭uut/KvuuuK ֩[t~==gvuu]xKOuvv^rt OMY<g#zbuvtL&/MJiJnrtJ&/MJhJmqtlvf7JYH#ׁzYYYgCu tvet/`tto0p#둮hv>`vQgfKR5Xry.u~jTfY)" x KY Xu!~x!=sJ Zj|h x Xtxh f!wpzxXZȕcKNUI}~v!=X~vvl\d] ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc_sb.cbitops.hstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h,@-wkuL~yt~~< ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc_stats.cext2fs.hbitops.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@g*uX u}uNY>x fvJw}tg/? v J~Y fvJv ../../lib/ext2fs../../lib/etbadblocks.cext2fs.hext2_types.hcom_err.hext2fsP.h@  XjJy?OLz.K =M> tYxti=Wy>w /u<>]:[?(Axtg=uvuf XtxXx?~&\>4KU`>p^fgwttt Ww > wguf  vD/vwt"  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etbitmaps.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h@g[jJg[Og[jJg[sJgMtXgMuXg0vz>wgxq.hxg. vXvk(^t w.w?"kJ>z>y>z>! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etblock.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h<@-|XOY<֠C<Cu6<u\h t==tK0u>et. =w= fh!OY>C>Au8<"u\h t=K0u>ct.J?= ffJ~zx tggggw!yg Ȣȉ#~zz~g><ί` /uuu>gZp gvhX)/~XUJY qȏggZK~JC>u֭ux.<~"~u tKgp'<ZxMgsK"u>zigh  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etbmap.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@"{uh0wwGXK2 /<~Y'f.uu=~xXK /~fltJX =zwiS<;K֑~.J" t=iS<9Jf &![JI.J~ &[䤑Y~t<Y~JD<YY~.y<~t=uKiggK~g~<}9Sf&[iS< &![<}.g7gfxv̀Z ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etcheck_desc.cext2fs.hbitops.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@ @=E/ws   ug }~uJ~~uA~ ~{uL .v! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etclosefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.h@MZ4zX^[=]E7X vf 5> huuuYuap#u=hwuuiJ~hnY  hiZ0u+Xu gl~ "w7It-qliXJftww._!XyJ9 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etdblist.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.h @sY* X?ttgwX XuX1MFm.J> .g3#<Qg=g ../../lib/ext2fs../../lib/etdirhash.cext2_types.hext2fs.hcom_err.h@uk@xgwgvwvggZtXfgYYWhm&X uuuw`!XXty~.guGet=Mywf t~.Y==/KKKKKK"gfKF=K>"gNY~.Kg>bJN8S8ugw~?/Z8Ov ~Xiwggtvwuv=wLׯMȣaX 0h t~u!#"!  gutg tl)x!uv).~<8!=&@u!6Xp<g~+twAg它w guwȟuYuwuw֢\xȻxf=hwjYgigw#=-MfYvxfuu^uhxtu Q9 ../../lib/etflushb.ccom_err.h@4< /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etfreefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.h @ yftguwufwUdbtguwtwi>#_KK tguv tguv tguv tguvuuuvu fYuwtguwtw fwA ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etgen_bitmap.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@9=E..E .%l$'XwhtF  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/eti_block.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h@M x,ggڣM x,ggڡ!}={Z ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/eticount.cext2fs.hbitops.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hext2_types.hext2_fs.hcom_err.hext2_io.htdb.herrno.h8@g/I=}Xg?xwk$L/ ;J0Cȡ럑Ja<\> f+NM_f'trew $^z:Xtjg[Hv/s .} ugZyu <xKp.su <wVgK$|gtguwuuuuwfw!wl^p t[wXK6JȱM <x Y!vx<{KZ?^[='g/<Jx<xPfɑ=uuuB!gZɭ <xXzgדgl P}}}t.}y<{~ ؼY~u xt~tvhotټ.Z~y& ZZ~t~tuhNttu&~t~t!} ~tg}u}f~u Zrwt ht~9  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etind_block.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h@/ ;KW<<vf  " /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etinode.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.he2image.h@@;M˭vtg,ggN/T>C>=>0u=ghgXvuwuQvuYxJf=uug= 3$g=uftg=\=u~Jh <0v.urLJg0|<?wftuw f.w.uutvw<JwXfYc{J!uظ- X˭%L,1!Ԡ !qlo&@1=$&mJhilm"Dt[uguguh+`M$yXmfg0~< "gOky1st=oXmfp=Yz>Yxo=n5uKhaYKufL /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etmkjournal.cext2fs.hstddef.htypes.htypes.hstat.hext2_types.hext2_fs.hcom_err.hext2_io.hjfs_compat.hkernel-jbd.herrno.h@`[uXvuJ Xw< Xy<_)]~J\"DK{n.Xo.yuYu^[\"X1RY"t WZ>u0  J׼iJ2̑{fik~"w-uvhptwXye (-t~h|fxKki~wguguv x$guKK,ՇuLxw.Kxw<zgKufzt't|t֒zt ftz~j2(</&!tbtyJ Z%1ȫYV*Xi=. ,tyb V  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etnewdir.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h(@wvvg4YKKgk=KgKKltv#XtwX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etopenfs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.he2image.h(@hKz.^9hF\:hy._}<Zo" u  qJ* wiuf=w<岼=vˑ>K>lޱ+u <% tugG<w?Jw#><wJx0hu=gU</ufȑw7)<xgxtb>xXyXihhiv>r< gtXtYQivhr< gtXdxtxtxJ+gImfguzfgu  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systdb.cstddef.htypes.htypes.htime.hstat.htdb.herrno.h4A@X<_Ou[~nxX`t {[xuLthu+YL夔f t={ yfK~Ȼ $f~vu~>$i8~fɠJ=&0x'*f&Luh$~XZY1 $'~guk.'vu& .@0 /=r Yugfj u. Jv<<x/r@Mvw(<u!G#>"u2a=e< < f!bք<{=0<t  "5h2'u<Y$  f !uEf5CuivJ<{YeX_'yfK"yfJ"u Kx Zvju".֟y?,ufcf#@ ޮ = uKZP\f"<<y r=?=Mh~f-Bv>iot> <=gn (_$fN^> %kv@  y=/>Б <wx>Ⱥm}tz] Juf<@g=gu8/Ktt@w<xt tX  X*k=jft% th"g=gwZlz$ʻ <i Xf<#.DuAtmf$Zgl tJlX f ]֓w !O#s hOw.gY[hv|\ttJgn.P>S,<N2XqunfpttY~f8u.P/.j=gl"eAm3!!tbef$fb]_?nfuXch.YpY<>.uyX#%<;Z'e!iɟewv۳z@u<fs rX y .$ȭl?/g"r .~fyv+Kguggg̑.#iBY.~uY~gg>(Z  f!~+Y Au0Q~/fD fqEOfz .lX~Au~f   /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/et../../lib/ext2fsunix_io.cext2fs.hstddef.htypes.htypes.hstat.hcom_err.hext2_io.herrno.h@k=*ux.`.>rkvtu0q Xx Ȝ Mpu <JiKLiZttj=*2S X|<gggzg'b \svf gw<!Y=mfsgK{Xu%R!inFJQ4U=v<fzz"u/M$VLr"gKX=!w/g}vtXoKt=t$p t|uuvKfYuyyf f^tuuvJs?y. v X=tZ=uNpxt .pa=pl|"tguztguz~ zfzz<J=z<=uuuvg#g@6t XXzv[KtkzX@YX  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etunlink.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h@mfMi=YguuvwuFXmXW =>g/o1xjuws f{P ../../lib/ext2fsvalid_blk.cext2_types.hext2_fs.h @k4r /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.h@1=g.gZKk90=YG.uKhNK1=sxXu-[1'H}?h(ױ>Tf-fO= Y=1tKuhKKS<K+ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidresolve.ctypes.hblkid.hblkidP.hlist.h@>&~=  Jw[uuNrtJ$/] 1gFEDO&Kz0Nt J1  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidsave.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.herrno.h@9 P#Nt6.vt1خ,X|Ku僭 u0X</ɭuzH f(^. ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systag.clist.htypes.hblkid.hblkidP.h@ggQYxXNYY~M .sM"RJM6uM1* P[w.w*J'tyT{'?4gxf f=oJ{ycXfg,h}X7JsX= .sf=_.uu=Iug=itJYf?vYgΑwYv=> X~i#Yyf5fJ\wYlك] uKXsY g<c<=Y=.׼tc=g=t&sdOv<c<=Y=tur  ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysdevname.clist.htypes.hblkid.hblkidP.hd@<Xj[pJH|t$J.AMZ.g ȿ+"$$ijf vuu=c<=/=.6S /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkid../../lib/uuidprobe.cprobe.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid_types.hblkid.hblkidP.hlist.huuid.herrno.hd@'Yw1)L?X%<XKgwtTJ <X2o3}to<Yff<du" X\/KU_v=_=}kXyhLm0pkJ0pmJy=0z̩ZY~0[Y.guF@tz g//}#Y!ׁ2u@i3i=Y=h ."iz$KL=hu歠בh-z0>zxo -s|!Y!=!=!=gAr )qiEgk.iEg8.tYeJkl<tffYjJf7 hnJ gguu tuuK?S |<t|[u|<tw>K?S?"\{{<{< ufA{XNMvX X]"{tf[ /|) >Y24?{<t{tf~֭/Yx.<~Z!pX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidgetsize.ctypes.htypes.hblkid_types.hblkid.hstat.h@=wa3l .D .v$pJ ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cblkid_types.hblkid.herrno.h@vAyX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysgen_uuid.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.htime.huuid.huuidP.herrno.hD@ !W??K/xJKucJ/W ftx< v .gwJ~+'hlYhK!,<KK~Xv~ɻg/Juf<'f*X?9v=;: isnull.c@&<]s+1k /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includepack.cstdint.huuidP.h8@&/====>ZK>hK>hK>hm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.h@&=uuun /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.h@3B gzJgzg8A ../../lib/ext2fsfeature.cext2_types.h@u dtMYgt 億p ֱu dtMYgt 億p ֗uuPJ/m+.Lurt6 +RK J_#R_37]f.;X.u tuuRt;g=~.oXoX JfoXoX JA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@M#~K/giLNXtgfuw~K= Q<0ML A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h8@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h`@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM ctype.c @XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.hP@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDc4 ../includesort.cstddef.h0@ 8j*@ڻ+@8/Yy. Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.h`@)Xg[ye_< rindex.c@*xG=v,02K ../../includestrcasecmp.cstddef.hbsdtypes.h@3=L=]d$Z3zi=e"[91eu;K8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V 9 strcat.c@"?; index.c@*8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h @@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h @t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h @gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf  ../../../include/arch/i386../../../include../../include/sys../../include/netinet../../includenet.cstdint.hstddef.htypes.hsocket.hin.hnetdb.hio_struct.hstdio.herrno.hp@(<>ʯʯA7yy5ZV>1b v< .SA7k~Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h@"@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~ ../../../include/arch/i386../../../include../../includelink.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h-@*$T0i9i-/3;/[x.jgzP ../../../includemisc.cstddef.htypes.herrno.h-@&"V0",0#U/#U/gp ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h`.@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]D ../../include/systime.ctypes.htime.hP1@!<=gwe; ../../includetermios.ctermios.hp1@+",0",0<>hkG ../../../includemktemp.cstddef.herrno.h6@+?82Y t2,I,Ii.i. >绾;/w X hC ../../../include/arch/i386rpc.cstdint.h08@!X@Kxx< [T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h8@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ 3 sleep.c@<@=xM ../../includelost_path.ccollections.hstddef.hP<@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hE@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.cE@=gP ../../../include/arch/i386add_intr_handler.cstdint.hE@ = ../../../include../../../include/arch/i386../../includescanf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hE@$Tj=jr~JD<X~o~t~fJ~t }Y .%S\=;u=YtgfA\fA\&zX\>:v>YzfA\iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h`h@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hi@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io ../../../include/arch/i386../../../include../../include/sys../../includetime.cstdint.hstddef.htypes.htypes.htime.hio_struct.hstdio.h @Bz< \T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.hp@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.hP@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hP@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hP@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.hp@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'\ ../../include/arch/i386../includenetwork.cstdint.hnetwork.h@-==t{o>i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h@?Dx ?Dx =3 puts.c@@>(eN ../../../include/arch/i386get_tick_count.cstdint.h`@ >{ ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.hp@ ic?9 fi='=% wait_for_rpc.c@@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h`@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.hP@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x \ strtok.c`@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@@(JgKwp@| P@!AB F| 4t@AB F| hL@-AB h|@/AB  h@;AB Fd.h@OAB Ch8@@AB hx@%AB Dh@FAB  h@rAB F].$h\@/AB Fi..h@$AB h@%AB h@LAB h$@KAB hp@AB h@ AB h@AB h@AB h@AB h@"AB $h@IAB BI.P.M. h8@ AB hD@ AB hP@ AB A.h\@ AB A.hh@0AB E.h@AB H.| @@VAB Q. @ @1AB F.Y. J.@4 @EAB Da.4@| @#AB IX.e. X.r. .. `.(@ @AB FP.. n.$@@AB Iv.n. _.l@@D  F AB DV.?.c..k.. h.'. f.. z..`.. ^.. | $/@AB DG./@qAB Di.$3@AB DE.3@AB DO.| (Dl4@ AB FF.n. B. D|5@gAB FY. D5@AB FG.DD7@AB I.. U.9. Z.C. p.L. {.| L@4AB M@AB (M@JAB AtM@CAB k.M@LAB z.N@CAB HN@AB D\.N@?AB Ab. O@iAB FZ. tO@AB Fk. P@fAB F].P@PAB B_. P@yAB FR. LQ@AB FQ.(@R@AB FX.W. f. T@AB Ed. N. U@AB Ek. xW@AB F.(t[@AB FC.1. ].0 `@AB Ig..U.. l.Hf@AB I8.F. [.. H.x... X.. [.(y@1AB I_..y.z@KAB Dj.<{@AB I[.$ . m.. w..w.o.f. ].\.Y.2.H.o. Q.I. ]..X.q.. ]...@.w.i.^...|  @ AB  @mAB Bb. p@AB Fd. @AB Fz. @=AB Bi.( @SAB Fq..W.$ 8@AB Bb.i.X.h ܞ@ AB IL.. D.. Z...=. w. . h.~. .C. `.. _.d.f. @7AB BV.W. (@;AB BZ.W.|  d@XAB C @#AB 8 @AB IU.t. O.. .~. S. l@OAB Dg. @YAB IR. @7AB Dc.0 P@AB I[..t.. `.L H@ AB IU.& . D.=.f..{..s.]. @.| (( T@AB I`.Q. [. ( <@nAB FZ. ( @AB Io.<( @AB Ic.W. h.. e.z. U.{. b.,( @AB IL.x. e.. $( @AB F].Y. [.0( @=AB IL..Y..\. ( @AB Fl.| ,@AB IL.. u.b. I.| @AB B.D@AB IL.. ...[...2.k.| `@3AB [.`@AB `@AB `@AB `@AB `4@8AB A `l@AB Ib.`L@ AB A. `X@AB FK.`T@+AB ^.`@4AB Y.`@uAB DO.$`,@nAB FK.L.$`@AB Fd..`@>AB DT.(`@AB F`.u.d.H.0`@AB FT..V.~.G.`\@HAB d. (`@AB Ie.. .@`@AB FY.B.].T. h.M.m.Q.E.V..`@AB E.D`@`AB F\.[.V.[.Z..e.`.P. \.o.0`@AB IR.. [.. \.| @KAB Db.$@AB H.$4@hAB FP.U. h.| 4@lAB 4@AB  4@bAB FJ. 4t@ AB FS. 4@AB F.4@AB EW.4@[AB Ba. 4@AB FI. 4 @AB Di.^. 4t!@hAB FU.4!@AB DW.$4h"@ZAB FO.d. Y.$4"@^AB FR.e. Y.$4$#@^AB FR.e. Y.$4#@ZAB FO.d. Y. 4#@YAB FJ. 4<$@AB FW. 4$@YAB ID.$4$%@AB FL.q. | &@AB  &@,AB Fj. (@(AB H(@(AB $p(@~AB F{. ].(@0AB  )@0AB (P)@ AB FE.W.I. \*@)AB DN.O.*@UAB EQ.0*@AAB F.. d.. L.$.@AB DX.| .@AB C8/@AB H/@8AB B /@AB F. T1@AB Fl.| 41@AB 42@AB  42@AB FA. 42@AB FE.| 3@EAB A@4@1AB Bt4@#AB  4@QAB Fa. 44@XAB F~..s.y. b.6. s.D9@/AB D t9@IAB Ek.L. |  9@AB Fj. `:@AB DR.T.K.D:@AAB FQ.%. z..H.`.W.k.g. .|.|  h(B@AB FY. hB@AB FY.LhC@,AB FZ.z.l..\..b..S.b.Q.. P. hI@hAB EE.(hAB X.h@.AB X.@7AB DS. X.й@rAB FE.X.D@AB D@.$X.@WAB Fo..X.<@@AB ES.X.|@CAB DP.| /@AB Dv./@KAB Dc. |  00н@AB FS.00`@AB N.00x@"AB ].00@AB N.| 0@AB F 0@{AB F.| 1@-AB Bf.(1,@AB Fm.. .(1@AB Ec.]. M.O. 1@.AB d. | 1@UAB B1<@AB U.1\@,AB DR. 1@AB Fk.| P2T@?AB P2@AB FP2\@lAB Ba.P2@AB B,P2@AB F#.Z.. P2@TAB E. P2@uAB FU.P2L@AB R.(P2h@MAB FI..m.8P2@BAB In._...x.*.c.$P2@%AB Bb..4P2$@AB I.u.~.,.k.. P2@AB F_.(P2@KAB F}..l.| 4@AB | 4 @vAB Df.4@WAB Db.4@ AB A.4@AB Ep.| D5@ AB D5@ AB D5@ AB D5@9AB D5,@MAB F D5|@rAB Fd. D5@nAB F`. D5`@WAB DA.D5@WAB DA.D5@3AB D_. D5D@(AB Fe.D5l@lAB EE.D5@'AB ]. D5@%AB [. D5(@HAB b. Y.D5p@AAB Z. D5@uAB Fm.D5,@BAB Z.D5p@BAB Z.D5@zAB De. D50@AB Fv.| (7@AB FO.. h.7@AB BQ. 7|@AB Fl.| \8,@?AB DG.,\8l@jAB FE.t.|.d.| 8@AB F8d@AB F8@FAB C| 498@AB  49X@AB FC.49t@AB F$498@AB Ft. [.$49@AB Fa.s.n.$49@AB Fq.V. 49T@AB Db. 49@AB FP. 49@DAB Fw.49@AB Q. ,49$@AB Fu..@R.d. [.$49@AB BZ.y. 49@AB Eo.H.,49H@&AB Eo.U.f.Y.j.,49p@YAB Es.s.D..N.| |;@+AB `.|;@GAB `.| ;@@>AB A;@"AB ;@+AB ;@AB F;T@ AB (;t@AB Fs.i.X.;@AB Q.(;8@AB FQ..g.$;L@AB I|.~. ;, @vAB Fa.; @AB Q.(; @AB F$.H.;@AB Q.;@AB Ea. ;@AB Ie.;$@^AB D_. ;@mAB Fb.|  >@IAB Cn.$ >@@AB Fr.^.$ >@AB Fr.^. >x@ AB FJ.|  >@@AB IG.>@AB M.|  ?@AB Hf. {. ?@9AB F.| h?@GAB y.| ?D@`AB C. ?@JAB Bc.| ?@vAB  ?h@AB Fd.(?@eAB Fn.. K. ?@}AB FX.(?h @AB IV.. . ?&@AB IJ.| @(@AB BU.|  A(@2AB  A )@,AB  A8)@/AB  Ah)@AB FR. A*@AB FW. A/@!AB W. |  A/@AB H. a.A0@JAB n.|  B1@AB AK. B1@AB Iz. B2@%AB [. |  B02@AB IP.|  B7@AB FG.B|:@LAB B:@AB B:@AB  B:@AB FU.B@@/AB B A@AB B A@AB | C4A@ AB C@A@+AB ClA@AB Dg. CA@qAB Dp. c.ChB@IAB Di. CB@+AB `. CB@RAB D@. C4C@IAB CCC@AB CC@AB CC@&AB BX. CC@AB F$CdD@TAB Fc.T.J.$CD@AB F[. k.b. $C@E@YAB Fs.T.CE@AAB BCE@ AB CF@AB CF@AB CF@>AB A(CPF@AB F[. i.v. C. C(G@nAB FH.CG@$AB DCG@DAB E CH@UAB D_. P.R. CXH@ AB CdH@ AB CpH@AB CH@"AB CH@ AB CH@ AB CH@AB CH@AB CH@AB FCI@AB CI@AB CI@AB CI@AB  CI@AB Bj. k.CJ@AB CJ@AB CJ@AB $CJ@AB Fs. y.CK@AB CK@AB CK@AB CK@AB CK@AB $CL@AB E^.X.W. 8CL@AB FF.W. m.o. J.U.R. ].(CN@AB F.l. . C(P@'AB DG.O. CPP@*AB DG.R. C|P@*AB DG.R. CP@AB BQ..,CQ@AB Ef.B.f.N. W.CtS@NAB Bh.$CS@AB I}.d. ,CT@AB Fq.r.G. .$C V@AB FJ.m. (CV@AB FV.z._.D. $CW@-AB FR..<CX@AB FM. o.l. w.q.K.M..h. k.pC[@|AB FM.v.R.l. v..d. f..f. S.r. Z.e. t.S. S..m. S.}.Z.P. _.S. Clb@ AB V. ,Cb@AB FS._. n.Q. [.(C0c@AB F|. I.Q. Cc@AB F.(Cd@+AB F.\. F.8Cg@AB B\..]. _.t. V.a. J.U.Cj@"AB N.(Cj@AB FN. h.. CTl@AB Q.Cpl@*AB DG.$Cl@VAB FI.t. $Cl@tAB Fj.f. Chm@;AB DM.X.Cm@)AB DG. Cm@AB EG.f.$CXn@AB FJ.N.<Cn@AB F.U.V. `.u. \.h.d. W.(Cq@$AB FQ. V.Z. ^.Cr@AB F0CPs@AB F.].g.a.n.f.Ct@)AB DG.(Cu@AB Fn.p.o. Cw@AB F.0Cw@AB F. R.P.W.G.P.$Cy@aAB Fz.L.(Cy@AB Fj.\.].J.hCdz@AB Ft.U.n...K.T.W.X.x..Z..a.D.~..O.a.`.`.a.4C@@BAB FS.Y.\.a. ].I.o.[.C@8AB Dg. ,C@ AB F]. ^.t.Q.W. Cȃ@'AB DG.O. C@*AB DG.R. C@*AB DG.R.CH@"AB B8Cl@AB Fn.a..y.w.i.U.^.Q.4CD@_AB FH.~. A.y.Q.].Q.,C@CAB Ff.l. d.0X.]. C@EAB Bf.U.C0@rAB FY.C.`. S.. P.a.r. N.r.|. `.K.j. L.G.C.|. I.X.R.G.x.V.S.V.S.}.P.T.R.W.s.| S@<AB S@AB F(S@ AB Fn.w. D. S@yAB FI.S@/AB  S8@eAB FR.,S@@AB F{.s.\.U.^.S@AB S. (S@AB Fe.S. q.0S@AB Fc.t.h.._.S@AB S. S<@AB Fy. Sę@AB BH.SL@dAB Et. S@eAB Fn.S@qAB F(S@AB FX.N.O.,S`@~AB FP..o.G.I.| U@AB Dk. U@~AB Fn.| V @[AB | @Vh@PAB B@V@4AB a.| V@?AB [. W.| V,@4AB B| V`@AB Vh@AB (Vp@AB DY.\.j.W.X. Vl@AB BV. VD@AB DB.N.u.Vܢ@AB J. V@AB F.| W@9AB A|  X@ AB G. X@$AB  X,@AB ( X@@AB F].].O. X@8AB ].|  X,@\AB Fg.(X@AB BJ.e.\.p.X.$X0@AB FO..| TYԧ@ AB TY@ AB X. TY@\AB FA.TY\@=AB DE. TY@AB FE. TY@[AB B_.k.TY@2AB G.|  DZ,@@AB FS. DZl@hAB FU.DZԪ@AB H. DZ@LAB FF.(DZ4@XAB IC..T.$DZ@AB FS.}.| 4[<@LAB Bn.4[@5AB D[.4[@OAB Bu.<4[@AB IR..E.U.C.L.T.a.b.|  [@5AB Ft.[H@AB EX.|  @\@AB Fx.| x\@PAB B x\@OAB Fp. x\X@MAB Fp.x\@ZAB _.,x\@eAB Fm.X.@.{.e.x\l@ AB X. x\@]AB Dg.b.x\@0AB DE. x\@AB FZ.x\Ⱥ@2AB G.,x\@fAB Fg..U.u..| ^d@AB ^l@AB  ^|@&AB DE.P.(^@AB Fx.).Z.| ^d@)AB ^@AB ^@`AB C^@AB ^@HAB Be. ^H@6AB F.^@#AB W.^@2AB D_.^@3AB DO.^ @0AB ].^<@0AB ].^l@5AB DO. ^@ZAB FH. ^@:AB BW.P. ^<@AB BW.S.^@@AB Bg. ^@AB DI.f. ^@@AB BZ.M.(^@AB FZ.M.G.q.^p@*AB ^@:AB ^@CAB $^@AB HS..^. ^0@AB Fe.$^4@AB Fk.. (^H@AB FJ..b. ^@AB F_. ^@(AB If.4^@dAB FI.. U..H.U. ^8@AB F. ^@fAB FM.^D@`AB E.o.^@`AB E.o.^@aAB D^h@PAB D$^@AB IP.q.^X@AB DA.^@AB DA. ^X@nAB Ik.| c@?AB DG.$c@AB FH.Y.| (d@GAB y.| (XdD@dAB EF.E.\.a.$Xd@AB Fs.^. Xd,@AB Fx.Xd@AB Q.4Xd@AB F}.!. N..h..X.Xd@AB H.Xd@+AB DR.| te@ AB | e8@VAB | e@nAB A|  e@_AB EI..@e`@AB et@AB e@AB | |f@AB Ec.|f@AB Ec. |fd@AB F~.|fx@AB R. |f@AB De.|f$@AB De.| Pg@AB E| g8@'AB E| g`@_AB E| g @AD g0@AD g@@/AB gp@AB g@AB g@AB g@.AG g@/AB g0@AB gP@AB gp@4AB g@AD g@AB g@AB | Pi@AB Pi @AB FIPi@AE EPip@?AB FPi@VAB FPi@3AB D| jP@AB F| Lj0@AB F| j@KAB DD| j`@QAB B| j@)AB D| k@~AB Fkp@tAB F| lk@AB F| k@<AB AD| k@.AB | l@>AB A| 0l@@-AB A| `lp@JAB FI| l@AD | l@AB F| l@AB F| (mP@9AB (m@AG F(m @hAB B(m@AB (m@ AB (m@AB F(m@ AB (m@ AB (m@oAB F(m@#AB (m@!AB |  dn@vAB FIFdn` @AB  dn @AB AFFdn` @>AB | n @dAB Fn @oAB Fn @AB E| do @:AB Ddo @1AB do @1AB do@ @0AB dop @AB do @IAB Fdo@AB Ado@AB ONdo@YAB Xdo@YAB X doP@AB IFF| p@ AB p@AB | p @&AB pP@'AB p@AB Fp@gAB AGpp@AB p@AB MFp @_AB Lp@GAB FFp@AB Lpp@AB p@AB Fp@AB F| lrp@&AB lr@ AB lr@&AB lr@ AB lr@AD lr@ZAB Flrp@qAB Flr@9AB lr0@AB lrP@AB F lr`@AB IFFlr@?AB Dlr0@vAB | s@ AB |  t@IAB D t@IAB D t`@IAB D t@AB E t@_AB D t@%AB  t@@%AB  tp@aAB  t@AB MFF t @WAB D t !@qAB D t!@AB  t!@"AB  t!@IAG | u@"@AG u`"@AG u"@yAB Cu#@ AB Cu$@AB Fu$@KAB u %@RAB AFu%@AB Ou0&@AB Ou&@tAB LFu`'@IAB u'@AB Lu@(@ AB uP(@AB Eu*@"AB | `w0*@]AB D| w*@;AB D| w,@AB w,@ AB | x-@AG x -@qAB Lx-@"AB | hx-@ AG hx-@AD hx-@AG hx.@AG hx0.@$AB | x`.@AD xp.@AD x.@ AG x.@ AG x.@ AG x.@AB  x.@AB FHEx/@EAB Dx/@AB FI x0@AB IFF| zP1@AB | Hzp1@AD Hz1@AD Hz1@AB Hz1@1AB D| z1@AD z1@AD z2@AD z2@AD | 4{ 2@AB C4{ 3@#AB 4{P3@AB E4{3@AB F4{4@&AB | {4@AG | |5@0AB | 0|@5@"AB 0|p5@#AB 0|5@AB 0|5@AB IH0|P6@AB 0|p6@ AB | |6@AB F|7@AB F| 0}08@AD 0}P8@DAB E| |}8@dAB F|}:@+AB JI| }@<@ AB | }P<@7AB C}>@AB F}@?@AB F}C@AB F| ~E@ AB ~ E@AB ~@E@!AB D~pE@ AB ~E@ AB |  E@AB | LE@AB | xE@'AG DxF@ AB xF@ AB x F@+AB AxPF@AB FxO@;AG x@O@#AB xpO@AB xO@!AB xO@;AG xP@!AB x0P@AB xPP@#AB D| ؀P@;AB ؀P@!AB ؀P@JAB IF؀@Q@"AB | TpQ@iAB FFTQ@AB FITR@!AB | R@$AB S@AB  S@ AB 0S@NAB DS@AB BFT@NAB D`T@\AB DT@kAB D0U@jAB H| ̂W@AD ̂W@AB ̂W@AB ̂W@ AB ̂W@AB D̂X@+AB ̂Y@-AB ̂@Y@.AB ̂pY@AB FK̂pZ@xAB D̂Z@aAB D̂`[@AB FF̂[@AB D̂\@zAB D̂]@#AB  ̂0]@fAB IFF̂^@RAB FF̂_@EAB D̂P_@UAB FF̂_@UAB F̂b@RAB D̂pb@AB IÎ@c@6AB Ĉe@AB ̂e@AB Îpg@AB F| `h@bAB Eh@AB h@GAB @i@HAB B|  Di@dAB FLGDj@AB FDj@'AB Dj@AB FDk@EAB ADk@0AB FDp@uAB C| 0@ AB 0@ AB 0@RAB I0@ AB |  @AB F@'AB @AB @AB 0@ AG @@ AG P@AD `@AB AG@AB E| @6AB @AB @@AB FFP@AB | ,p@ AB D,@OAB G,@!AB | @?AB |  P@dAB FGG@[AB H @(AB | ,P@AB ,p@0AB ,@ AB ,@0AB ,@ AB ,@`AB FF| ؊P@AB | p@QAB AЊ@*AB @mAB Fp@mAB BC@rAB FI`@7AB D@DAB F@AB D@AB PF`@+AB | <@fAB D| l@rAB El@AB Dl@uAB Dl@IAB | @AB @AB  @AB | L@@AB | x`@ AB | p@AAB LF@AB @AB @AB  @AB | 8@@ AB 8P@ AB | |`@lAB C|Д@VAB C|0@jAB F|@`AB F|@HAB L| 0P@AG 0p@!AB 0@yAB HF0 @AB  0@@AB FFF0@lAB FF0`@)AB D0@AB MF0 @OAB D0p@!AB | `@AD F| `@AB BD@"AB | @@9AB AGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tstdout__u8crc32.cGNU C 4.2.2save_lencrc32table_be/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/e2fsckcrc32_beext2fs_swab32__u32dict_initdnode_color_tdict_leftdict_parentlowleftdict_datadict_set_allocatorcompdnode_destroydnode_allocdict_nilnodedict_freenodednode_reddict_allocnodedict_dupesdict_nodecountdict_alloc_insertgrandpadict.cwheredict_maxcountdict_firstdict_containsdict_isemptydict_insertdict_allow_dupesdict_tdict_contextrotate_rightdict_colorrotate_leftverify_dict_has_nodeupparentdnode_free_tdnode_getdnode_createdict_prevdnode_blackdict_nextcurrdnode_alloc_tdict_keylowrightsaveddict_free_nodesdict_countdnode_getkeydnode_initunclednodedict_lookupdict_isfulldict_comparedict_lastdict_rightdictcount_tdict_comp_tdnode_ts_mmp_intervalsuseconds_th_i_fsizes_journal_inuminode_link_infoi_gidjournal_ioi_mtimeblk2_profile_text2fs_struct_generic_bitmapi_file_aclhurd1hurd2__s32bytes_writtenblkcounti_sizeblocks_useds_jnl_blocksfs_dind_countdx_blocklinux1linux2fs_ind_countjournal_namestruct_ext2_filsysbg_inode_bitmaps_mmp_blocks_free_blocks_countext2_ino_text2_group_descinode_reg_maps_mnt_counts_algorithm_usage_bitmapkeep_bad_blocksinode_used_mapbad_lost_and_foundl_i_reserved2orig_retvali_links_countstruct_io_channelprint_unsupp_featuresl_i_gid_highext2_image_hdrext2_u32_listabort_codehashversiondpynumfs_directory_counts_lastcheckdefer_check_on_batteryprogram_namebg_flagsi_dir_acle2fsck_clear_progbarh_i_fragprogress_fdimage_iofs_regular_countfs_fragmenteds_checkintervalpctxfs_links_countblkid_caches_prealloc_dir_blocksfilesystem_nameprocess_inode_sizeblock_ea_maps_feature_incompatext2_dir_entrybg_checksumtime_starth_i_gid_highrun_results_reserved_padnext_checkext2fs_block_bitmapmount_flagsnewpathext2fs_test_valids_free_inodes_countunix.cacflagreasonl_i_blocks_hicheck_mountd_reclenfs_ext_attr_inodesextent_depth_countcheck_if_skipext2_dblists_min_extra_isizepriv_datanum_fieldss_rev_levelmax_passget_newerfs_badblocks_counts_blocks_count_hidx_dir_info_sizetimevals_prealloc_blocksbg_block_bitmapparse_extended_optsinode_bb_mapreason_argsys_page_sizeio_ptr__u16i_faddrh_i_mode_highs_first_data_blockblock_dup_mapfs_fast_symlinks_countblk64_terrcode_treserve_stdio_fdsbg_inode_tabletv_usecconti_generationfragsizeh_i_uid_highlib_ver_dates_raid_stridedpywidthis_on_batts_def_resuids_frags_per_groupoldpathstart_metablock_bufs_wtimeshow_version_onlymy_ver_dates_first_inoe2_blkcnt_text2fs_test_changedstop_metaextended_usagelib_vers_creator_osfs_total_counte2fsck_simple_progressbytes_readmy_ver_strings_log_groups_per_flexfs_chardev_countblock_maptime_tl_i_file_acl_highinvalid_bitmapsfixed_percentprogress_posinodes_usedphysext_attr_verdirs_to_hashimage_headere2fsck_structi_modeoptindnum_linksshow_statsbg_itable_unused__s16dir_info_dbconflict_optbg_free_blocks_countret_ctxno_journali_dtimeinvalid_inode_table_flage2fsck_ti_uidbadblocksrefcount_extrasysvalext2fs_inode_bitmapbrk_startstruct_io_manageri_atimeblock_found_mapfs_blockdev_countdx_dir_info_counts_feature_ro_compatext2_super_blocksyntax_err_reports_hash_seedfs_symlinks_counts_free_blocks_his_log_frag_sizenum_blocksinode_dir_maps_inodes_countdir_linksfs_ext_attr_blocksglobal_rtracke2fsck_update_progressticklarge_filesi_blocksuser_start__u64inode_imagic_mapblocks_per_pagemy_veroptargi_flagsfrag_percente2fsck_tblext2_badblocks_lists_jnl_backup_types_first_meta_bgbg_free_inodes_countext2fs_mark_valids_last_orphanio_optionsdgrp_text2_inode_cacheext2_inodestruct_io_statsexit_valuetmp2s_inodes_per_groupfs_fifo_countuse_superblocks_mkfs_timeapp_dataconfig_fnext2_icountext2_refcount_ts_minor_rev_levels_default_mount_optsuintptr_tgroup_desc_counttv_secprogress_last_timetime_fudgeinteractiveh_i_authorl_i_uid_highinode_bad_mapspacess_max_mnt_counts_r_blocks_count_his_blocks_per_groups_want_extra_isizen_msgsnode_max_hashs_reserved_char_padnum_filesfs_tind_countext2_struct_u32_listosd1s_volume_names_def_resgidinode_maps_desc_sizefs_sockets_countinode_buffer_blocksblkid_struct_cachepercent_tbls_def_hash_versionl_i_versionreplace_bad_blocks__s64bg_used_dirs_counts_last_mountednode_min_hashinode_blocks_per_groupinvalid_block_bitmap_flagline_numallow_cancellatione2fsck_global_ctxerrcodeblk_tstderrea_veri_ctimes_reserved_gdt_blockss_block_group_nrinvalid_inode_bitmap_flagverboseosd2s_journal_uuidext2_dirhash_tet_ext2_error_tablebg_reservedunix_io_managers_r_blocks_countspinnerprogress_last_percentabort_locs_mtimeino2sscanf_erret_prof_error_tableext2_icount_ts_errorss_log_block_sizeorig_supers_raid_stripe_widthext2fs_mark_super_dirtyjmp_bufnumblockssystem_startcalc_percentext2_struct_dblists_feature_compath_i_translatordx_dirblock_infoneed_restarttime_enve2fsck_rune2fsck.ce2fsck_passese2fsck_free_contextext2fs_get_meme2fsck_reset_contextpass_te2fsck_allocate_contexte2fsck_passext2fs_free_memexpectrelease_inode_blockstruncated_blocksref_offsetext2fs_group_first_blockrelease_inode_blockmax_valcheck_super_blockcsum_flagreturn_abortext2fs_test_block_bitmapcheck_resize_inodeind_offext2fs_unmark_validresize_inode_invalidcheck_backup_super_blockfree_inodesinodes_per_blockipg_maxmin_valdind_bufbpg_maxe2fsck_fix_dirhash_hintgdt_offnext_inoblock_nrclear_test_fs_flagref_blkshould_betruncatingrelease_orphan_inodesprocess_block_structbuggy_init_scriptsext2fs_group_last_blocktruncate_blockcheck_super_valueblockcntsuper.ctruncate_offsetunused_flagspass1_read_inodeext2_ext_attr_headeri_crtime_extraext2fs_mark_block_bitmapmax_lblki_ctime_extraret_codethresholdclear_extattreamagice2fsck_pass1_check_device_inodecheck_blocksalloc_imagic_mapold_blockmark_inode_badblkpgcompressede2fsck_clear_inodehandle_htreeimagic_fsis_dirmark_block_usedhandle_fs_bad_blockse_name_indexext2_ext_attr_entrycheck_is_really_dire2fsck_block_alloc_statsstorage_sizee2fsck_get_alloc_blockmax_uninit_lenh_reservedehandlecheck_sizeh_blocksold_operationprevious_blockcheck_immutableib_aenableis_leafrestart_flagib_bsave_bmapmark_dirold_stashed_inodefs_meta_blocksext2_inode_scane_value_sizeclearremainprocess_inode_countinodes_to_processe2fsck_pass1e2fsck_use_inode_shortcutse2fsck_setup_tdb_icountregion_tnum_illegal_blocksh_hashreserved_zeroe2fsck_pass1_check_symlinki_extra_isizeextent_fsi_atime_extraext2_inode_largeext2fs_inode_data_blocksmax_blocksref_blockgoalmax_entriesinfo_lengthpass1.cbusted_fs_timecheck_ea_in_inodeext2fs_mark_inode_bitmapmax_depthsuppressmax_lenext2_struct_inode_scanext2_extent_infoi_crtimeexit_extentalloc_bb_mapindirect_levelsbbcheckscan_structskip_supertdb_dirext2_extent_handle_te_name_lenstart_blocki_pad1curr_entrycheck_blocks_extentsext2_dx_root_infoscan_callback_structprocess_bad_blockext2fs_fast_mark_block_bitmapnot_devicepass1_write_inodemax_pblkis_rege_value_offsext2fs_extentsourceext2_db_entryprocess_blockext2fs_unmark_block_bitmapdirty_inodeold_opprocess_inodesscan_extent_nodeext2fs_fast_test_block_bitmapi_mtime_extraold_stashed_inoscan_callbackprocess_inode_cmpe_value_blocke_lblkext2_extent_handlecheck_inode_extra_spacemark_table_blocksenditbytes_availprocess_inode_blockcheck_ext_attrh_refcountpass1_get_blocksunwind_pass1bad_sizeext2_max_sizescurr_leveladjust_signi_version_hiadjust_extattr_refcountpass1_check_directorynew_table_blockregion_structext2fs_unmark_inode_bitmappass1b.cpass1ddecrement_badcountblock_elnum_dupblocksprocess_pass1b_blockclone_fileblock_dnode_freefile_okblock_listinode_dnode_freedup_blocksext2fs_test_inode_bitmapblk_elfirst_inodemeta_datanum_badadd_dupedict_int_cmpblk_dictcheck_if_fs_blocktest_blocke2fsck_pass1_dupblocksmax_inodedelete_filedup_inode_countshared_lenclone_structsearch_dirent_procinode_elinode_listdup_inodeclone_file_blockino_elpass1bpass1csharedext2fs_mark_bb_dirtyinode_dup_mapsearch_dir_structino_dictdelete_file_blockdup_inode_founddirdup_blockdx_dbe2fsck_process_bad_inodecheck_dotde_bcheck_dotdotext2fs_group_of_inodeallocate_inode_blockdir_inob_lencreatedabort_free_dictclear_htreedot_statede_dictout_htreeinode_modifiedrestart_fsckparse_int_nodecheck_namefixupdx_parentnot_fixeddb_bhtree_depthupdate_dir_blockcheck_filetypeext2_dx_countlimitsalvage_directorycheck_dir_blockde_asubdir_parente2fsck_pass2expect_limitspecial_dir_block_cmpstatusclear_and_exitallocate_dir_blockprev_hashext2fs_mark_changedbad_dirnew_lendb_acheck_dir_structdict_de_cmppass2.cfirst_unused_inodedups_founddeallocate_inodeproblem_tnextdirdir_modifiedext2_dx_entrye2fsck_expand_directoryparent_countfix_dotdot_structinode_loop_detectexpand_dir_procpass3.cmaxdirscheck_rootnew_blkinode_done_mape2fsck_pass3expand_dir_structfix_dotdot_procdoneext2fs_mark_ib_dirtye2fsck_adjust_inode_counte2fsck_reconnect_filenewblocksguaranteed_sizelast_blkfix_dotdotabort_exite2fsck_get_lost_and_foundloop_passdisconnect_inodee2fsck_pass4link_countmaxgrouppass4.clink_countedextra_sizeold_desc_blockssave_problemskip_groupfree_arraypass5.csave_inodes_countcheck_inode_bitmapscheck_block_bitmapse2fsck_pass5print_bitmap_problemcheck_inode_endactualgroup_freeext2fs_get_inode_bitmap_startext2fs_fast_test_inode_bitmapext2fs_get_inode_bitmap_enddir_arrayext2fs_get_block_bitmap_endfixithad_problemredo_countscheck_block_endpctx2ext2fs_get_block_bitmap_startsave_blocks_counts_firstj_headst_blksizest_blocksmark_buffer_uptodatekdev_skdev_te2fsck_journal_loadj_inodejournal_namesnlink_ttry_backup_journals_userss_dynsuperj_flagse2fsck_journal_reset_superjournal_superblock_si_ctxrecover_retvale2fsck_get_journali_inoe2fsck_journal_fix_bad_inodej_format_versionj_transaction_sequencenew_seqmark_buffer_cleans_nr_usersb_ctxbuffer_headj_failed_commitb_ioj_blk_offsetst_uidj_uuidst_rdevb_datae2fsck_move_ext3_journalj_firstdrops_sequencetid_tk_devs_headerdo_cache_createi_ext2e2fsck_journal_fix_corrupt_superb_uptodatest_ctimejournal_header_text_journale2fsck_clear_recoverjournal_header_sjournal_bmaplkmem_cache_tjournal_tag_bytesst_gidj_revokejournal_sdo_cache_destroye2fsck_run_ext3_journalj_sb_bufferwait_on_buffererr_outj_maxlenprocess_journal_blockj_fs_devb_errj_tailmark_buffer_dirtys_errnoll_rw_blocke2fsck_journal_releasetried_backup_jnlh_sequencejournal_superblock_tj_superblockrecover_ext3_journale2fsck_fix_ext3_journal_hintobject_lengthnew_cachest_nlinkmode_ts_max_transactionforce_fsckst_atimeno_has_journalj_devst_devsync_blockdevgetblkj_errnodev_fsjournal_tst_mtimek_ctxs_maxlenb_blocknrbrelsee2fsck_check_ext3_journalj_lastjsuperj_freej_blocksizejbd_revoke_table_sst_modeblksize_tuuid_ts_max_trans_datas_paddingh_blocktypes_startj_tail_sequencegid_tret_journaldev_journalclear_v2_journal_fieldscheck_bb_inode_blocksinvalid_blockbb_listbadblocks.cread_bad_blocks_filefatale2fsck_read_inode_fulle2fsck_write_inodefs_proc_checktime_endfs_nameVSUSPprint_resource_trackVERASEVEOL2e2fsck_write_bitmapsnext_update_incrVKILLe2fsck_read_bitmapsVLNEXTVQUITVSTARTpreenhaltutil.cext2_file_typeinit_resource_trackVSTOPe2fsck_zero_blocksstring_copybufsizeVTIMEcheck_for_modulesret_sbVMINread_a_charret_blkNCCSVINTRget_backup_sbask_yndeltac_oflagdefstrtimeval_subtracte2fsck_allocate_memoryc_lflagfatal_errorVWERASEc_iflagcc_tshort_yesnext_updateVEOFVEOLshort_noc_cflagret_countio_startfaile2fsck_read_inodee2fsck_write_inode_fullc_cctermiostcflag_te2fsck_free_dir_infodir_info_entext2fs_resize_memtdb_itere2fsck_dir_info_iter_ende2fsck_dir_info_get_parentlast_lookupsetup_dbdsizeTDB_ERR_OOMTDB_ERR_CORRUPTTDB_ERR_NOLOCKTDB_ERRORsetup_tdbTDB_DATAe2fsck_dir_info_iter_begine2fsck_dir_info_set_dotdotTDB_ERR_RDONLYe2fsck_dir_info_itertdb_contexte2fsck_add_dir_infoTDB_CONTEXTold_sizee2fsck_dir_info_get_dotdote2fsck_put_dir_infoTDB_ERR_EXISTSTDB_ERR_EINVALTDB_ERR_IOe2fsck_get_num_dirinfoTDB_ERR_NOEXISTTDB_ERR_LOCK_TIMEOUTe2fsck_get_dir_infoTDB_SUCCESSTDB_ERR_LOCKtdb_fnret_dir_infoe2fsck_dir_info_set_parente2fsck_dx_dir_info_itercontroldx_dirinfo.ce2fsck_get_dx_dir_infoe2fsck_add_dx_dire2fsck_get_num_dx_dirinfoe2fsck_free_dx_dir_infoe2fsck_handle_write_errore2fsck_handle_read_errorehandler.cehandler_initehandler_operationnew_descsecond_codeset_latch_flagse2p_descriptionpromptpreen_msgproblem_tablefind_problemfind_latchdef_yne2p_codeclear_problem_contextlatch_descrclearflagslatch_codeldescreconfigure_boolproblem.ce2fsck_problemfix_problemend_problem_latchsetflagspr_latch_infoquestionprint_answerget_latch_flagstime_strexpand_inode_expressionexpand_dirent_expressionno_inodeabbrevslarge_inodeno_contextexpand_percent_expressionspecial_inode_namerecurseexpand_at_expressionprint_e2fsck_messageprint_pathnamesafe_printno_direntt_blocknrt_blocknr_highnum_blks__FUNCTION__start_transactionchksum_seenfound_chksumpasstypefailednr_replaysscan_revoke_recordsh_commit_secjournal_skip_recoveryh_chksum_sizerecovery.cjreadPASS_REPLAYnr_revokesMAX_BLOCKS_PER_DESCh_paddingend_transactiontid_geqnr_revoke_hitsnext_log_blockcalc_chksumsPASS_REVOKEh_commit_nsecdo_one_passh_chksum_typefirst_commit_IDnext_commit_IDcrc32_sumskip_writetagpio_blocksuccesscount_tagsjournal_recoverjournal_block_tag_sjournal_block_tag_trecovery_infochksum_errPASS_SCANdifferencecommit_headerjournal_revoke_header_sjournal_revoke_header_th_chksumregion_createregion_freenew_regionregion_elregion.cregion_addr_tregion_allocatehash_listinsert_revoke_hashjournal_test_revoke__list_deljournal_init_revoke_cachesjournal_init_revokejournal_set_revokejournal_destroy_revoke_cacheshash_shiftjournal_destroy_revoketid_gtjbd_revoke_record_shash_tablejournal_clear_revokefind_revoke_recordlist_emptyrevoke.clist_head__list_addrevoke_record_cacherevoke_table_cacheea_countea_blkretryea_refcount_intr_beginget_refcount_elea_refcount_createext2fs_get_refcount_sizeea_refcount_intr_nextcursorhighvallowvalea_refcount_fetchea_refcount_storeea_refcount_elea_refcount_incrementinsert_refcount_elea_refcount_freenew_sizeea_refcount.cea_refcount_decrementrefcount_collapserehash.ccopy_dir_entriesmutate_nameall_dirsharraynblksroot_offsethash_algdir_indexnew_memhash_cmpname_cmpwrite_directoryresortino_cmpdx_entdir_offsetget_next_blocke2fsck_rehash_directoriesmax_arraye2fsck_rehash_dirfree_out_dirext2_u32_iteratedirinfo_itermin_lencompresswrite_dir_structoutdirset_int_nodeduplicate_search_and_fixlimitsnum_arrayfill_dir_structroot_limitclearednew_arrayset_root_nodealloc_size_dirfill_dir_blockcalculate_treenew_namelimit_offsethasheshe_aext2_struct_u32_iteratehe_bprofile_get_valueparse_stateprofile_iterator_freefile_serialfinaldo_subsectionfirst_fileprofile_update_filetimestampend_or_commentprofile_get_uintconf_nofirst_childskip_numret_valueret_longfilespecget_new_fileret_profline_sizeret_nameprofile_get_integerprofile_get_stringgroup_levelprofile_add_nodedone_idxprofile_set_syntax_err_cbret_profilecurrent_sectionget_dirlistret_iterdeletedprofile_iterator_createprofile_create_nodehome_envprofile_set_defaultprofile_initfromskip_over_blanksparse_quoted_stringconf_yes_prf_file_tret_nodeupd_serialdefault_filenameret_arraycompstrsubsubnameprofile_parse_booleansection_flagend_valueprofile_iteratorprf_magic_tdef_valret_intiter_pret_stringprofile_syntax_err_cb_tprofile_find_nodeprofile.cprofile_releaseprofile_get_booleanprofile_open_fileroot_sectionfree_listprofile_node_iteratorstrip_lineprofile_free_nodeprofile_free_fileret_booleanexpanded_filenameskip_over_nonblanksprofile_nodedef_stringinitialize_prof_error_table_r_et_listinitialize_prof_error_tableprof_err.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/ext2fsinitialize_ext2_error_tableinitialize_ext2_error_table_rext2_err.cext2fs_new_blockext2fs_get_free_blocksext2fs_fast_unmark_inode_bitmapext2fs_alloc_blockstart_inodeext2fs_fast_test_block_bitmap_rangeext2fs_set_alloc_block_callbackext2fs_fast_unmark_block_bitmapdir_groupcheck_block_uninitext2fs_new_inodecheck_inode_uninitalloc_sb.cext2fs_reserve_super_and_bgdext2fs_inode_alloc_stats2ext2fs_group_of_blkisdirext2fs_block_alloc_statsext2fs_inode_alloc_statsalloc_stats.cext2fs_set_block_alloc_stats_callbackext2_badblocks_iterateext2fs_u32_list_delext2fs_badblocks_list_iterate_beginbadblocks_flagsext2fs_badblocks_list_delext2fs_badblocks_list_addremlocext2fs_u32_list_findext2fs_badblocks_list_createext2fs_u32_list_equalext2fs_badblocks_list_iterate_endext2fs_badblocks_copyext2fs_u32_list_iterateext2fs_u32_copymake_u32_listext2fs_badblocks_list_iterateext2fs_u32_list_countext2fs_badblocks_equalext2fs_u32_list_addext2fs_u32_list_testext2fs_get_arrayext2fs_u32_list_iterate_beginext2fs_badblocks_list_testext2fs_u32_list_createext2fs_u32_list_iterate_endbad_block_countset_badblock_recordext2fs_update_bb_inodeclear_bad_block_procind_blocks_sizeset_bad_block_procbb_inode.cbb_itermax_ind_blocksind_blocks_ptrext2fs_resize_block_bitmapnew_real_endext2fs_allocate_inode_bitmapext2fs_set_block_bitmap_rangeext2fs_free_inode_bitmapext2fs_set_inode_bitmap_rangeext2fs_set_bitmap_paddingext2fs_resize_inode_bitmapext2fs_generic_bitmapext2fs_copy_bitmapext2fs_clear_inode_bitmapext2fs_get_inode_bitmap_rangeext2fs_compare_block_bitmapext2fs_fudge_block_bitmap_endnew_endext2fs_allocate_block_bitmapext2fs_compare_inode_bitmapext2fs_clear_block_bitmapext2fs_free_block_bitmapext2fs_fudge_inode_bitmap_endoendext2fs_get_block_bitmap_rangedind_blockbcounttind_bufblock_contextxlate_funcblock_iterate_indblock_iterate_tindxlateext2fs_block_iterate2block_iterate_dindtind_blockextent_erroutreal_privateext2fs_block_iteratebmap_flagsgot_blockblock_tind_bmapbmap.cblock_dind_bmapinode_dirtyext2fs_bmap2addr_per_blockblock_ind_bmapret_flagsphys_blkblocks_allocinode_bufext2fs_bmapblk32check_desc.cext2fs_check_descgroup_shadowret_old_desc_blkgroup_blockfs_stateret_super_blkext2fs_flushwrite_backup_superbuffer_blkwrite_idxwrite_primary_superblockcheck_idxret_new_desc_blkret_meta_bgtest_rootsuper_shadowsgrpclosefs.cgroup_ptrcache_sizeext2_inode_cache_entext2fs_super_and_bgd_locwrite_primary_superblock_onlynew_supermeta_bg_sizeext2fs_closeext2fs_bg_has_supersortedcache_lastext2fs_update_dynamic_revold_superinodes_per_grpext2fs_set_gdt_csumold_unusedcsum.cend_inofind_last_inode_ingrpold_flagsstart_inoold_csumgrp_noext2fs_group_desc_csumext2fs_group_desc_csum_setext2fs_group_desc_csum_verifyext2fs_init_dblistext2fs_get_num_dirsext2fs_add_dir_blockext2fs_copy_dblistret_dblistmake_dblistext2fs_dblist_sortmax_dirsret_num_dirsext2fs_dblist_drop_lastext2fs_dblist_iterateext2fs_set_dir_blockdblist.cext2fs_dblist_get_lastsortfuncext2fs_dblist_countnew_entryext2fs_dblist_dir_iteratedb_dir_procdb_infodir_contextdblist_dir.cext2fs_read_dir_block2ext2fs_write_dir_blockinbufdirblock.cext2fs_read_dir_blockext2fs_write_dir_block2dx_hack_hashhalfMD4Transformunsigned_flagret_minor_hashTEA_transformdirhash.cext2fs_dirhashstr2hashbufret_hashhash0hash1ext2fs_process_dir_blockext2fs_dir_iterate2next_real_entrydir_iterate.cext2fs_dir_iteratedo_abortext2fs_validate_entryfinal_offsetext2fs_ext_attr_hash_entryext_attr.cext2fs_write_ext_attrnewcountext2fs_adjust_ea_refcountext2fs_read_ext_attrwrite_bufadjustext2fs_extent_insertextent_pathext2fs_extent_header_verifyoffset_superimage_inodeextent_node_splitei_leafoffset_inodenew_uniniteh_entriesext2fs_extent_deleteimage_reservedext2fs_extent_freeupdate_patheh_depthfs_device_nameeh_generationext3_extentorig_heightnewextentorig_opext2fs_extent_replacefs_netaddrorig_lengthext2fs_extent_get_infomagic_numberend_blkei_unusedeh_magicorig_lblknew_node_pblkmappedimage_deviceee_start_hifs_blocksizefs_reservedext2fs_extent_gotooffset_blockmapext2fs_extent_openleaf_levelext3_extent_headernew_node_lengthlog_flexfs_devicenew_node_startfs_netaddr_typego_downtocopyextent.cext2fs_extent_getee_blockgoal_blkmagic_descriptorentry_sizefs_hostnameext2fs_extent_fix_parentsret_handleext3_extent_idxee_lenfs_uuidnew_rootext2fs_extent_set_bmaplogicalei_leaf_hieh_maxoffset_inodemapnewehee_startimage_timevisit_numei_blockextent_uninitoffset_reservedflushb.cext2fs_sync_deviceflushbext2fs_badblocks_list_freeext2fs_u32_list_freeext2fs_freefreefs.cext2fs_free_inode_cacheext2fs_free_dblistgen_bitmap.cext2fs_compare_generic_bitmapext2fs_fudge_generic_bitmap_endext2fs_fast_clear_bitext2fs_free_generic_bitmapext2fs_allocate_generic_bitmapext2fs_mark_block_bitmap_rangeext2fs_set_bitext2fs_get_generic_bitmap_startext2fs_mark_generic_bitmapext2fs_get_generic_bitmap_endcheck_magicext2fs_unmark_block_bitmap_rangeext2fs_fast_set_bitext2fs_warn_bitmap2ext2fs_resize_generic_bitmapext2fs_set_generic_bitmap_rangeinit_mapADDR__dummy_hext2fs_set_generic_bitmap_paddingoldbitext2fs_test_bitext2fs_test_generic_bitmapbitnoext2fs_test_block_bitmap_rangeext2fs_clear_bitext2fs_make_generic_bitmapext2fs_clear_generic_bitmapbase_error_codeext2fs_copy_generic_bitmapext2fs_unmark_generic_bitmapext2fs_get_generic_bitmap_rangeget_pathname.cext2fs_get_pathname_intmaxdepthparent_nameget_pathname_structsearch_inoget_pathname_procext2fs_get_pathnameext2fs_get_device_sizeext2_loff_tvalid_blkgetsize64getsize.cvalid_offsetretblocksext2fs_iblk_sub_blocksext2fs_iblk_seti_block.cext2fs_iblk_add_blockstime_hi_and_versionext2fs_get_icount_sizecurr_valueext2_icount_elset_inode_countsinglemultipleext2fs_create_icountext2fs_create_icount_tdbnum_inodesext2fs_create_icount2get_icount_elext2fs_icount_incrementuuid_unparseinsert_icount_elalloc_icountunpack_uuidicount.cext2fs_icount_fetchext2fs_icount_validateext2fs_icount_decrementext2fs_free_icountext2fs_icount_storeget_inode_counttime_midtime_lowext2fs_write_ind_blockind_block.cext2fs_read_ind_blockext2fs_inode_scan_flagsext2fs_write_inodeext2fs_get_next_inode_fulltemp_buffercheck_for_inode_bad_blocksext2fs_read_inode_fullinode_bufferdone_groupcurrent_inodeget_next_blocksforce_new_groupext2fs_open_inode_scanext2fs_set_inode_callbacksave_get_blocksext2fs_write_inode_fullret_scanext2fs_write_new_inodeextra_bytescurrent_groupext2fs_get_next_inodeext2fs_read_inodebytes_leftgroups_leftcurrent_blockblocks_leftext2fs_check_directoryget_next_blockgroupext2fs_inode_scan_goto_blockgroupclear_flagsdone_group_dataext2fs_get_blockstemp_inodeinodes_leftbad_block_ptrext2fs_close_inode_scancreate_icacheset_flagsext2fs_flush_icacheio_channel_read_blk64io_channel_set_optionsio_channel_write_byteio_channel_write_blk64io_manager.cext2fs_check_if_mountedext2fs_check_mount_pointst_bufmtlenis_swap_devicemtptfile_devismounted.clink_structnamelenmin_rec_lenext2fs_linkcurr_rec_lenoriginllseek.cext2fs_llseeklookup_structext2fs_lookuplookup_proclookup.cext2fs_zero_blockswrite_journal_inodeext2fs_default_journal_sizejfilemkjournal_proczero_countret_jsbext2fs_add_journal_inoderet_sizeblk_to_zeromkjournal.cwrite_journal_fileext2fs_add_journal_deviceext2fs_create_journal_superblockjournal_inomkjournal_structparent_inoext2fs_new_dir_blocknewdir.cio_flagsgroups_per_blockold_ioext2fs_open2ext2fs_get_data_ioopenfs.cret_fsext2fs_openext2fs_rewrite_to_ioext2fs_descriptor_block_locext2fs_set_data_ioext2fs_div_ceilnew_ioread_bb.cmark_bad_blockread_bb_recordext2fs_read_bb_inodeext2fs_read_bb_FILE2blocknocall_compat_invalidbadstrcompat_structread_bb_file.cext2fs_read_bb_FILEgdt_bufres_gdt.cmultdindir_bufdindir_dirtyout_inodersv_offout_dindirthreelist_backupsretval2dindir_blkext2fs_create_resize_inodesevengdt_dirtygdt_blkfiveout_freeskip_this_inode_bitmapext2fs_read_block_bitmapext2fs_read_inode_bitmapsuccess_cleanupino_itrext2fs_test_bb_dirtyext2fs_write_inode_bitmapino_cntskip_block_bitmapext2fs_write_bitmapsblk_itrblock_nbytesrw_bitmaps.cnbitsblk_cntdo_inodeext2fs_test_ib_dirtyext2fs_write_block_bitmapdo_imageskip_this_block_bitmapinode_nbytesdo_blockext2fs_read_bitmapspartialtdb_log_funchave_transaction_locknew_dbuflist_structTDB_DEBUG_FATALtdb_ofs_readtransaction_expand_filetdb_unlock_recordTDB_DEBUG_TRACEext2fs_tdb_map_sizeF_UNLCKmax_dead_recordsparsertravlockstdb_find_lock_hashext2fs_tdb_reopen_allTDB_DEBUG_WARNINGtdb_rec_writel_starttransaction_brlockhash_headsext2fs_tdb_lockall_unmarktdb.celements_lasttdb_unlockl_typetransaction_syncext2fs_tdb_traverseext2fs_tdb_transaction_committdb_dump_recordtdb_count_deadext2fs_tdb_errornum_locksmem_tdbtdb_headertdb_mmaptdb_transactiontdb_parse_datanew_lcktdb_write_lock_recordlastrectdbsext2fs_tdb_firstkeysequence_numberrecovery_eofext2fs_tdb_set_max_deadtdb_update_hashext2fs_tdb_validate_freelistext2fs_tdb_existsnull_log_fntdb_delete_hashext2fs_tdb_traverse_readrecovery_offsettdb_next_hash_chaintdb_methodsremove_from_freelistTDB_DEBUG_ERRORtdb_transaction_unlockF_SETLKext2fs_tdb_fetchtdb_recovery_sizeF_RDLCKext2fs_tdb_errorstrparent_longlivedvertestflockdefault_tdb_hashext2fs_tdb_lockall_read_nonblocktlocktdb_exists_hashext2fs_tdb_deleteext2fs_tdb_chainlock_unmarkext2fs_tdb_hash_sizeleftsizetdb_freetdb_munmapext2fs_tdb_transaction_cancelrw_typetdb_findext2fs_tdb_chainunlock_readfull_hashwant_nextrecovery_headtdb_dump_chainext2fs_tdb_storenewrectdb_len_ttransaction_writetdb_next_locknestingssize_text2fs_tdb_transaction_recovertdb_allocate_ofsext2fs_tdb_closelock_rwtdb_new_databasetdb_writeext2fs_tdb_log_fntdb_brlocktdb_debug_levelext2fs_tdb_chainunlockext2fs_tdb_printfreelist_tdb_locktdb_ofs_writetotalsizetdb_lock_recordnew_dptrtransaction_methodspnum_entriesext2fs_tdb_chainlock_markl_pidkey_lenext2fs_tdb_get_seqnumtdb_allocateext2fs_tdb_lockall_readbestfitecodeext2fs_tdb_lockallext2fs_tdb_fdtdb_transaction_elext2fs_tdb_dump_alltdb_rec_free_readhash_fnnewrec_ptrtdb_purge_deadext2fs_tdb_enable_seqnumoldhashext2fs_tdb_nextkeyext2fs_tdb_lockall_nonblockupdate_tailerext2fs_tdb_appendsave_errnoext2fs_tdb_set_logging_functiontdb_already_opentdb_traverse_funcext2fs_tdb_transaction_startlog_privateext2fs_tdb_chainlockdata_lentdb_nullF_WRLCKtdb_do_deletetdb_increment_seqnumF_SETLKWext2fs_tdb_get_flagsglobal_locktdb_logging_contextltypeext2fs_tdb_lockall_markmark_lockext2fs_tdb_open_exlockedio_methodsrecovery_max_sizetransaction_next_hash_chaintdb_oobnum_lockrecsnewdbbest_elext2fs_tdb_increment_seqnum_nonblocklog_ctxtransaction_readestringtdb_find_deadtdb_traverse_internaltdb_brlock_upgradeext2fs_tdb_chainlock_nonblocktdb_transaction_locktdb_off_ttdb_expandnew_map_ptrold_map_sizeread_onlytransaction_setup_recoveryadditionl_whencetdb_errnametdb_converttdb_lock_typeext2fs_tdb_lock_nonblocklast_ptrtotal_freeext2fs_tdb_chainlock_readtdb_readext2fs_tdb_parse_recordtdb_alloc_readtdb_rec_readtransaction_oobtdb_key_compareoldkeytdb_write_unlock_recordlck_typetdb_recovery_allocatemagic_foodmagic_offsettdb_flagscurrentrwlockstdb_io_initext2fs_tdb_nameext2fs_tdb_unlockall_readtdb_expand_fileext2fs_tdb_openext2fs_tdb_get_logging_privatetransaction_errorrecovery_starttdb_hash_funcext2fs_tdb_unlockallseen_insertext2fs_tdb_reopentailer_ofstdb_traverse_lockfind_cached_blockaccess_timeerror_outunix_private_dataflush_cached_blocksunix_set_optionunix_write_blkfree_cachewritethroughraw_read_blkalloc_cacheinvalidateunix_io.celdestreuseunix_read_blk64unused_cacheunix_closeraw_write_blkunix_read_blkunix_get_statsunix_write_byteoldest_cacheunix_cachereuse_cacheunix_openunix_write_blk64unix_set_blksizeunix_flushstruct_unix_managerunlink.cunlink_procext2fs_unlinkvalid_blk.cext2fs_inode_has_valid_blocksext2fs_parse_version_stringlib_versionext2fs_get_library_versiondot_countlib_datedate_stringversion.cbitops.cext2fs_warn_bitmapext2fs_crc16crc16_tcrc16.ccrc16_table_et_dynamic_listtable_numadd_error_tableremove_error_tablesafe_getenv/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etdebug_fet_list_lockstartedet_list_unlockerror_message.cadd_to_error_tableinit_debugerror_messageoopsnew_tablechar_setet_name.cerror_table_namecom_errnew_procreset_com_err_hookcom_err.cpvardefault_com_err_procerrfwhoamicom_err_va__builtin_va_listbit_namesbid_priblkid_tagblkid_gc_cacheblkid_struct_devbic_devsbic_filenameblkid_struct_tagbit_namebid_namebid_tagsbid_devsbic_flagsret_cachebic_timeblkid_debug_maskbid_labelblkid_get_cachebit_val/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/blkidbit_devbit_tagsbid_uuidcache.cbid_devnoblkid_put_cachebic_tagsbid_typeblkid_devbid_timebid_flagsbid_cachebic_ftimepnextblkid_dev_devnameblkid_dev_iterateblkid_dev_iterate_beginblkid_dev_nextnew_typedev.cret_devblkid_dev_iterate_endblkid_new_devblkid_dev_set_searchblkid_free_devnew_valueblkid_struct_dev_iteratesearch_typesearch_valuedevdirsadd_to_dirlistdir_listblkid__scan_dirnew_listfree_dirlistblkid_devno_to_devnameblkid_strndupdevno.cdirlenblkid_strdupparse_devblkid_read_cacheskip_over_wordparse_tokenblkid_parse_lineskip_over_blankdev_pparse_tagparse_endparse_startread.clinenotagnameblkid_get_devnameblkid_get_tag_valueresolve.csave.copenedblkid_flush_cachesave_devblkid_find_dev_with_tagtag.cret_typevlengthblkid_tag_iterate_beginblkid_tag_iterate_endblkid_dev_has_tagtry_againprobe_newblkid_tag_iterateblkid_find_head_cacheblkid_tag_nextblkid_struct_tag_iterateblkid_set_tagdev_varblkid_new_tagblkid_free_tagret_valblkid_parse_tag_stringlist_add_tailblkid_find_tag_devblkid_probe_allonly_if_newdev2blkid_probe_all_newblkid_get_devdevname.cs_dummy5modify_datereserved1nr_disksxs_dummy2rs4_dummy2blkid_loff_t__pad1embed_first_blocksystem_supports_ext4patch_versionoem_idprobe_cramfsleaf_offsb_validprobe_gfsvd_typeprobe_romfsms_sysidvs_hiddenoffset_xlvol_bkupocfs_volume_headerbytes_allocatedbuf_mftvolume_idext_block_startmd_magicswap_id_blockos9_folderrs_orig_journal_sizedl_idvd_idnext_cnidbim_lensws_volumexs_dblockssb_bsize_shiftsect_countprobe_ext4devreiser4_super_blocklvm2_pv_label_headerfat_entry_offatrbtime_creatxs_dummy1probe_hfsplusms_headsxs_dummy3blkid_known_fstypevd_versionms_ignoredsystem_supports_ext4devprobe_swap1sectors_per_clusterminor_versionlast_checkjumpret_uuidlast_mount_versvs_cluster_sizes_reserved_word_padjs_sizers_journal_blockset_uuid0probe_reiserfs4no_addrcluster_per_mft_recordmsdos_super_blockxs_ifreecat_fileromfs_super_blockfile_attributedir_countbuf_sizesb_multihost_formatrs4_dummynext_sect_offlabel_strvs_sysidprobe_jfsusa_ofsprobe_swap0vol_idleaf_blockudf_magicusa_counttotal_blockswr_cntvs_flagsbios_parameter_blocksws_badpgjs_versionvs_pmagiclvm2_calc_crcno_formal_inoxs_fnamentfs_super_blockattr_filesignaturers_dummy2rs_dummy3rs_dummy4no_namevs_ignoredcrctabprobe_ocfs2vfat_super_blockjs_loguuidblkid_verifyjs_l2bsizers4_uuidembed_blockcountprobe_luksrs_magichfsplus_catalog_keyvs_total_sectget_bufferunicode_16be_to_utf8unicode_lensb_master_dirsb_bsizehfsplus_extentnot_persistentvs_magicmount_lenparent_idattr_lenvbm_stvol_seq_numvs_versionsws_padblkid_magicgfs2_meta_headernon_residentreiserfs_super_blockinstanceext_block_countisosbfuturemdp_superblock_sfound_typebytes_per_sectorsws_versionms_fat_lengthprobe_lvm2checked_datevalue_lenleaf_node_sizeprobe_fat_nomagicrs_labelalloc_first_blockleaf_node_headout_lenprobe_hfsnum_root_dirsstart_fileosx_foldervalue_offsetvs_dummy2ms_cluster_sizecluster_countprobe_ext2xs_fdblocksmaster_file_table_recordclp_sizexs_magicname_offsetms_sernocreate_datealloc_block_sizecramfs_super_blocksb_lockprotoros_magicms_hiddenhfs_mdbleaf_node_countrs_uuidcrc_xlvs_insfo_sectormaxloophfs_finder_infoattr_offmh_magicdate_creatfigure_label_lennext_allocms_secs_trackcheck_mdraidunicodeprobe_iso9660blkid_probe_tset_uuid2nm_flsls_Modprobe_udfroot_startjs_labelopen_errmh_typevs_fat32_lengthset_uuidms_unknownms_magicjs_bsizerecord_countjs_magicct_clump_sizeuuid_strmft_mirror_cluster_locationret_readdisk_lockprobe_zfsgfs2_inumcramfs_infovs_headsprobe_ocfsros_volumemh_formatstart_apppv_uuid__pad0__pad2space_sizers_free_blockssb_fs_formatvs_backup_bootjs_dummy2jfs_super_blocknumber_of_sectorsbim_kboffsws_nrbadescape_sequencessearch_fat_labeliso_volume_descriptornext_offvs_sernojs_l2bfactorms_labelms_mediavs_reservedprobe_oracleasmmft_record_size__s8editionhfsplus_bnode_descriptorsystem_idms_pmagicvs_unknownleaf_countvol_sernotype_arraysb_headerprobe_gfs2rs_blocks_countdiffocfs2_super_blockdl_tagval_lenvs_root_clustergvalid_wordsrs_root_blockprobe_ntfsocfs_volume_labelstart_data_sectal_blk_sizersrc_clump_szcat_blockdate_accxs_icountros_dummy1js_padvs_secs_trackcluster_lowleaf_tailxfs_super_blockrs_blocksizemft_cluster_locationtime_accprobe_reiserfsxt_clump_sizeencodings_bmphfsplus_vol_headergfs2_sbprobe_ext3ms_fatsbim_sboffvs_reserved2vs_labelvs_dir_entriesopen_foldervs_mediatotal_sizeembed_startblockbim_probecluster_highvolume_serialhfsplus_forkalloc_filebim_typefat_sizeblkid_probeset_uuid1set_uuid3sws_lastpagevs_sectorscluster_per_index_recordvs_fat_lengthrs4_magicvol_labelms_dummy2probe_fatattributesboot_folderjs_l2pbsizexs_uuidxs_blocksizeblkid_swab16vs_sector_sizeget_ext2_infofree_bksal_bl_stmd_minorvs_fatsnr_clustersattrs_offsetext_filexs_rblocksroot_dir_entriessector_xlms_reservedwrite_countembed_sigvol_id_lensb_root_dirms_sectorsoracle_asm_disk_labelms_total_sectleaf_headbuf_maxbim_magicfolder_countdata_clump_szbytes_in_usefile_countms_dir_entriesprobe_jbdsws_uuiddate_writesb_locktablealloc_ptrbnodeprobe.cjs_pbsizesbbufhfsplus_bheader_recordblkid_swab32cr_datenewbufjs_uuidtime_writenum_recsval_offattr_typeprobe_xfsvfat_dir_entryraid_disksmajor_versionbackup_datenm_al_blksnxt_cnidprobe_ext4rs_journal_devms_sector_sizers4_labelblkid_get_dev_sizeblkid_llseekclock_lowget_clockhas_inituint64_tuuid_generate_timeuuid__generate_randomuuid__generate_timetmp_seedget_random_bytesstate_fsave_umaskclock_mid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/uuiduuid_generateclock_highuint16_tftruncateuuid_generate_randomgen_uuid.cclock_regget_node_idlose_counterget_random_fdget_uuid_via_daemonret_clock_seqstate_fdadjustmentisnull.cuuid_is_nulluuid_packunpack.cuuid_unpackfmt_upperuuid_unparse_loweruuid_unparse_xuuid_unparse_upperfmt_lowerunparse.ce2p_edit_feature2/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/e2pclear_ok_arraymask_errfeature.ccompat_typejrnl_feature_liste2p_feature2stringe2p_jrnl_string2featuree2p_edit_featurecompat_arraytype_erreptrfnume2p_jrnl_feature2stringfchare2p_string2feature/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstructword_type../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4__divdi3DWunioncomplex long doubleUDItypecomplex floatcomplex double__udivdi3__umoddi3isprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_managerliballoc_unlockl_possibleOverrunsl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockpagesl_pageCountmajSizeendptroverflowstrtol.cstrtolsort.cqsort_tmpcomparatorstrncmp.c/home/tyndur/tyndur/src/lib/stringstrncmpstrncpy.cstrncpystrrchr.csavestrrchrstrcasecmpstrncasecmpu_charstrcasecmp.cmemmovememmove.cdst0src0strcat.cstrcatstrchrstrchr.cstrcmp.cstrcmpstrcpystrcpy.cstrdup.cstrlen.cstrlenmemcpy.cmemset.cu_intpositivedecimalitoastrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpc_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeouttimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizeinit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsunsetenvenvvar_tgetcwdgetenv_name_by_indexntohlnet.cntohsp_aliasesgetprotobynameip_strs_protoh_addrtypehtonlNO_RECOVERYinet_ntopfamilyhostenthtonsservicesprotocolnetshortproto_aliases_tcpNO_DATAserventTRY_AGAINhostshortinet_ntoahostlongservice_aliases_imaph_aliasesip_stringp_protosocklen_ts_addrnetlongservice_aliases_ircgethostbynamep_nameinet_ptonin_addr_tprotocolsh_nameh_errnoip_qherrorin_addrAF_INETinet_atonHOST_NOT_FOUND/home/tyndur/tyndur/src/modules/lib/posixprotoentservice_aliases_https_aliaseshstrerrorh_addr_lists_portgetservbynameSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flagsold_posio_resposix_files.cF_GETFLflags_sizefd_to_filefd_listnext_fdaccess.caccessoptresetostrnargcopterrgetoptgetopt.cnargvoptoptgetpidgetpid.cgetppidreadlinkmisc.cgetpagesizeisattygethostnamepipemkfifostat_buffchmodinode_numlost_statmknodfstatstat.clstatmkdirgettimeofdayqueue_selectortermios.ctcgetattrtcsetattroptional_actionsspeed_ttcflushcfgetospeedtiosuser.cgeteuidgetuidgetegidgetgidrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidactimeutimbufmodtimeutimeutime.cstrerror.creaddirio_direntry_type_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirfileidmktemp.cmkstempmktemptemplatesend_messagemetadataio_create_linklink_dirend_free_pathlink_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlinkyieldsleep.cresolve_relative_serv_pathpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlerfscanf_getcvscanfsscanf_tellinput_errorjtellinputjscanfmatchedfirst_digitconvert_numbervfscanffscanf_ungetcassign_number/home/tyndur/tyndur/src/modules/lib/stdlibcassignnegationmatching_errorjgetcsscanf_getcscanf.cparse_percentjscanf_getcjungetcjscanf_read_numbertptrscansetvsscanfmatchsscanf_ungetcsscanf_statejscanf_telljscanf_ungetcfscanf_tellfscanf_statevfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_argsfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcasprintf.casprintf_putcasnprintf_handlervasprintfasprintf_argsbuflenputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathfseekio_writefreopenget_shmrenametmp_filesrc_pathio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcio_write_request_tfputssetbuffopenfflushfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftellsetbufferatexitexit.catexit_listptr_typedivisorremainderulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexrnd_seedsrandomsrandrand.caFebaFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_handlervsprintfassert.c_assertassertionvsnprintfsnprintf_argssnprintf_putcsnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namerpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_tcur_bytemac_to_stringip_to_stringregister_netcarddevice_numbernet_devicenetwork.cip_bytesstring_to_ipdriveropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cget_tick_count.cget_tick_countmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlast_nodelist_destroylist_sizelist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrtok.cspanpdelim__strtok_rstrtokmemchr.cmemchrtt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuutiQiPQt 1W13t3ZWZdtpdStpW]R`tlRuu-t P -R P01u13u3_t0:P:_R:BP`auacuct`sPsWP`uRuVR`zQzSQuutPWWPWRSRSRQVQVQVVQuu,t,Q P t 'P',t ,R,-u-/u/Qt8AQTUuUWuWtuutWtWt t t SVSVPPPPuu?t++Wt?W++Vt ?V++?t!3S39R9NSN_R_{S{}RSRRS_}P}RPRPPRPRPP(R-2P4;P=?RQQ(Q6;QxSS?S0EPJ_PP@AuACuCdt@LLdQLPPRbPdeuegugtdppQptPvPuutQtRPRQPQPQPPuu#tQ#tRP#RQPQPQ#PP$%u%'u'3t45u57u7?t@AuACuCStTUuUWuWhthiuikukyt|}u}utuutVtVtSPSPSuutuutuu tuutuuLtLMuMOuO\tuuVtPXYuY[u[tuutStuutPt}SSCGSqvSSSWWEGW]WWW,R/?RkRRR?FSxSS!CSrtptp)tpVV)VVV V PVVPkVknPnV)VFLPLxSxSSSPSS!S)CSGqSvS@SkSS1tltl)tl!R#.R.3P3IRPuutStSt t t t BBtt t t t tRgPPPQQ6VVuut**dSdhthStS**JPJht hPt Pt P t uQuuz&tBqB# V# 3q3;V;q+V+qVqV+q+MVMq.V.z&qBqBg Wg 3q3;W;q+W+qWqW+q+MWMqWq.W.z&qSvPAVVPVYV;fVjVV+VJ}VVVV:VPV6VVV +VMbVV?_VV"P.CPPVP0V0=PPu P8t~Y3t~;ft~jt~t~+t~J}t~t~t~t~6t~t~ +t~Mbt~t~?_t~t~.e"t~""t~"z&t~ t~5t~5@P@O t~Y e"t~""t~"z&t~tlQtlQ_tl_bQbJtlJyQytlQtlQtlP<%tl<%%Q%z&tlAt~Y3t~;ft~jt~t~+t~J}t~t~t~t~6t~t~ +t~Mbt~t~?_t~t~.e"t~""t~"z&t~At~Y3t~;ft~jt~t~+t~J}t~t~t~t~6t~t~ +t~Mbt~t~?_t~t~.e"t~""t~"z&t~0Yth*SS.S<HPPbt~t~.z&t~VS;fS+TSAV;^V+LV:V.V0I VO { V !V""V*pSZSS0H SO S 6!S""P""S$ t~t~.z&t~. K SK N PN S S S& < SE S ! Sb e S~ S PP36SK Z P0SSPS6S,SwzPzSe""S\t`P t` . P. t` S < t`< E SE / t`/ b Sb t` S t`+S+t`t`S+t`+MSMt`St`.z&t`%R%.PPR. t~t~.z&t~ P Pr r P  P 3t~;t~+t~t~+t~Mt~t~.z&t~ t S ( S( 9 t~9 _ S_ w t~w S S t~ 3t;jtuSt~t+tS}tt+tMtt.z&t t\ P 3t\;t\+t\t\+t\Mt\,t\?t\.z&t\ 3t~;t~+t~t~+t~Mt~,t~?t~.z&t~ 3t~;t~+t~t~+t~Mt~,t~?t~.z&t~^yt~~3t~;jt~t~+t~}t~t~t~6+t~Mbt~t~?wt~t~.e"t~"z&t~WWWW;;WfjWW+W}WWWW6W+WMbWW?_WW.W WO !W""WPS P VS0SflSJSSS S""SP2P +PfP""PAVS2StSYSSJ}SS*SS6HSqSSW_SSSS0SAt~Y3t~;ft~jt~t~+t~J}t~t~t~t~6t~t~ +t~Mbt~t~?_t~t~.e"t~""t~"z&t~AWWY3W;;WjWW+WJ}WWWW6WWW +WMbWW?_WW.W WO !W""WAVVY3V;^VV+LVJ}VVV:VVW_VV0VAVS2StSY3SSJ}SS*SSW_SSSS0SPP~O tdf td""td Wf W!m!Wm!~!WR~!!W""W#%%W&&W&z&WI Vf { V!]!V]!m!VRm!!V""V#%%V&z&VO tf t !e"t""t""#t"#5#PR5#z&tO tf t!e"t""t"#t#"#PR"#z&tH Sf S6!*"S""S"C$S#%%S%z&S*"e"S"C$S%&S!"P" #P &&Puutt6S+IPjsPuutStStxtxtxuutttPPWdPPuuFtDSDFtuu tStS tVVVCTPPPAWWVV  Vuuwt&P&`W`bPbuWuwP&R&wt&Q&+V+7Q7_V_bQbtVtwQ&++bt bwoowtxyuy{u{ttxtttxtt xVtVWtVWtWt<VW<@Vt@ptpVWttVWxtt SS0SpSNSVdSioSSSZpSSPI^PR:<R0tRtuuuwuwgttgtWw W*0WfWW&.t{ t{# |t{gt{*S.SSSW S5 = S*<SSfS+S!S&.t{|t{gt{WhWWVV.hVV VWeVVQt{Qht{{t{Qt{gt{WW.hWWW$)WWoWVV V$TVWeVV&.tpj*tptpetp&.t{0 t{# |t{gt{&.t{RRPVV? t{# |t{|Vgt{&.t{& t{ |t{gt{&.t|: t|# |t|gt|&.t||t|gt|&.tl *tl<tlgtl&.t| *t|KtPt|P+t|Pt|Igt|&.t| *t|t|+t|t|Igt|&.t| *t|t|+t|t|Igt| W@WW+WBWIyWW9WIyW&.t| *t|t|+t|t|Igt|&.t| *t|t|+t|t|Igt| P<KPPP$-PPP= S<S+SeSSIS&.t| *t|t|et|ygt|&.t| *t|t|et|yt| t| Lt|Lt|t|at|at| t| gt|&.t|.*t|t|et|gt|PL~PPP )P1GPLbP&.th.*ththethgth&*S*S&.P!*Puu4t4R+P-2P45u57u7St4EESQ4EESRKQPTUuUWuWtTootToo|P|t Pt TooStStdRRRuuttPt RRuu0t0tt P0t 0t&R01u13u3st0GGst0GGMPMst tuuuwuwttPttt SSuu3t3t St'S'-t-1S13t45u57u7t4PPzWz|t|W4PaiPttPPPf|tpuuDt<S<Dt=V=Dt >W>Dt DtpDtlDEuEGuGtDWPW|W~WDoRo{V{~R~VTzS~SuutPVVRSRSuuutP#S'4P4uS R $V'uVxyuy{u{ktxPktxRktxQiWxNtNkVPhVhkPSNgSlmumouotl~P~tlRV!uVVlQS!SSltlt t ltPPuut~~Stt ~~Vt|PPuu t  % t% < < t  tS S t . . t * S* 3 t3 u Su t S t S t  . t.  % , P P# . P% * P* 0 Su S S P S 3 Q Q Q* 3 tt] tt. tt u u t  C tC F F t  t  t tt t  C t C F F t J SN x S| w S 8SQSM N t Z t tQtZ K V Z V V,V8QV L WN z W| Wuu7tkktt007t7t t tt7t7t W W7WS SSSS/7SSk SSS SISSSS89u9;u;>t8UPU>t~8XRXWW>W8pQp>t~8XX^t^d t~t d>t~8yy>ty}SSnSS,S.Syt~>t~yt~>t~yt~>t~@AuACuC,t@`P`,t}@iRi,t}@uQu,t}!!W!"WI"\"W^""Wv#{#W %%W& 'Wi'n'W''W((W)*.*WYt~#t~#,t~{t~ "t~"#t~#'t~'c(t~((t~))t~))t~!*.*t~++t~),r,t~!"t~"{#t~-$%t~& 't~A''t~'(t~))t~))t~))t~0S \ S S!6!S!!S!Z"S^""S"#S{##S$$S$%S& 'S''S'(S.(c(S))S))S),r,Se0S \ S S!6!S!!S!Z"S^""S"#S{##S$$S$%S& 'S''S'(S.(c(S))S))S++S$9P++Ptd "td"#td-$%td&'td'(td.(c(td((td))td))td!*.*td++td),r,tdjt~#t~#,t~jt~#t~#,t~jt~#t~#,t~jt~m"t~"#t~#'t~'c(t~(.*t~+,t~US()S()R)S))S)!*S++S++S++S ,),S,,Sjt~)"t~"#t~#'t~'c(t~(.*t~*!+t~[+,t~jrV VI"R"V""V''Vc((V()V))V)!*V.*l+Vx++V+),Vr,,VjWWWIW W- W !WI"\"W^""W""W{##W##W#$W$$W%^&Wb&o&W((W++W!"t~:#{#t~-$%t~& 't~A'n't~''t~'(t~))t~))t~))t~WW- W !WI"\"W^""W""W{##W##W#$W$$W%%W%^&Wb&o&W(.(Wth "th"#th#%thh%'th'(th.(c(th((th))th))th!*.*th++th),r,th+V:cV@ k V VI"R"VV"["V""V{##V#$V$-$V#%&V(c(VSI"Z"S^""S&%%S( (Sr%w%P%%PMtl "tl"#tl-$%tl%'tl'(tl.(c(tl((tl))tl))tl!*.*tl++tl),r,tl,,u,,u,.t,-P- -S --P-.S,-R-.t~l-.W..u..u.g.t.@.@.g.t.V.V.`.t`.g..@. @.g.t(.^.S`.e.Sh.i.ui.k.uk.Mth...FtFFPG0Gt0G5GPNGMt.I/Wb//W/L0WN00W1U1WW11WDDW//tl40N0tl00tl)66tl66R66tl6>7R>7F8tlF8T8RT8 9tl 99R9;>tl;>q>Rq>?tl??R?N@tlN@c@Rc@AAtllA|AR|ACtlCDtlDFtlFFRFMtl//th40N0th00th5AAthlADthDMth99P>%>P)@1@P//S)686S99S::S<[=S=;>S>>S,@7@SzBBStC~CSCDSDDSWDDS1ESESyEESLF^FSzFFSlJJS//S00S33S55S)6#7S>7Z7Sc77S78S88S 9D9SV9w9SC>I>S|>>S>.?S@ @SN@T@SlAAS4BzBSEFSFFSIIS/0t}1Mt}//t}40N0t}00t}6AAt}lACt}CDt}DMt}//t}40N0t}00t}5AAt}lACt}CDt}DMt}//t}40N0t}00t}1-4t}?4l5t}v5Dt}DMt}//SHHSIqISpKKSKLS(LzLS//W40L0W00WN24W?4l5W5 9WV99W;>>W>1@WN@@WAAAWlAAWAAW4BzBWCCWDDWD1EWSEyEWELFWFGWGGWH?IWIIW@KNKWpKKWKLW(LLWLMW//t}40N0t}00t}u2-4t}?4l5t}5AAt}lADt}DMt}22V2 4V?4F4V44V5I5V55V23S?4v4S44SI5U5S//W40L0W00W)6 9WV99W ::W<H=W=>W;>@WAAAWlAAWAAW4BCWCDWWDDWDFWFGWGGWH?IWIIWlJJWJNKWVKKWKLW(LLWLMWD:x:Q:;Q<<Q<=Q1@N@QzBBQ~CCQCCQWDhDQ1EBEQEEQEEQLF]FQzFFQ//S)686S::S<[=S=>S>>S1@7@SBlCSCDSWDDS1ESESyEESLF^FSzFFSlJJSVKpKSKKSLLS//t}40N0t}00t})6AAt}lACt}CDt}DMt}BBQBCVCACQACACVACRCQyEEVVKpKVKKQLLVBBPLLP<d<P<<PMMP//S)686S;;S<[=S=>S>>S1@7@SCDSWDDS1ESESEESLF^FSzFFSlJJSNKVKS//S)686S:;S<[=S=>S>>S1@7@SCDSWDDS1ESESEESLF^FSzFFSI JSlJJS;<R7<d<R<=R1@N@R~CCRCCRWDhDR1EBEREEREERLF]FRzFFRQKVKRMMR//W40L0W00W)6 9WV99W:H=W=>W;>@WAAAWlAAWAAW4BzBW~CCWCDWWDDWDyEWEFWFGWGGWH?IWI JWlJJWJVKWpKKWKLW(LLWLMW MMW:%;R4;q;R<=R1@N@R~CCRCCRWDhDR1EBEREEREERLF]FRzFFRI JR40L0WG?IWpKKWKLW(LzLW//t}40N0t}|GIt}pKKt}KLt}(LzLt}aGHSuu t  P u uyt ))?t ?IIyt GVGItIyV FSFIt IySbtP?BP]bP|}u}ut|Vt Vt |St St St W{W}WzV}VPFYP}PP5SSKySSPSSuut,P6R6VVR)SS/WWuutPVVRSRSQQuuCtpptCtCt StSVtVt{SV{|tV|tCSVWt }W}t CWtpptpCtpnwPPPPPMRPPDEuEGuGtD[[bVbdt dVt Vt VD[[t PPQaSdSSSuut%%t t  t 4t 4t BSFFSkSSOS3tl3SPS]tl]sPsLtlLWPWOtltlOtptpkS S S SOS> _ Rn$ Wu W , W{ W WWn S s S S SSnW O RO W R , W{ W WWn t{ t{t{t{n t{ t{t{t{Y t{ t{t{t{PO U P$ 4 P9 A Pp { Pn t{ t{t{t{ U P P t{ t{4t{t{nS SS { S S S SSnWO $ Wu W , W{ W WWWWPHQPctPPPPnS S SSZSn t{ t{t{t{RfRRnS Ss S S{ S S SS7SnS S S Sn tl tltltluu3t-V-3t P3P,S45u57u7ot4IIiViotEXPZoPOhSuuXt)S)-t-6S6:t:XS*V*-t -7V7:t :XVXYuY[u[{tXfXff{Q|}u}ut|Vt[V[^t^VtV|Pt |t| t SSZS^SSS\t|t|t|W\W^\WWWSSstp\tp~tptp u  u Wt''MtMWUSUWt XYuY[u[tX{P{SX{R{WuutStStQt PPRuu t66 t4 t~  t~L $ t~o t~ P P  P4  V V  VL V ! V V4  S+ L P S P  SL S4 tp  tpL $ tpo tp : Rg R R/ A RO j R  R4 t~  t~L $ t~o t~ u u &t ^^t"" t ee0t0s ts  "t"7#7#%t%%%&t ((&t ((&tt|"t| t|et|40t|s t| "t|7#%t|%%t|&&t|t|,t| t|et|t|40t|s t| "t|7#%t|%%t|&&t|t|Ht| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|tlktltlP tletltl tl4tl0tls tl t!tl!"tl7#%tl%%tl&&tlVt|\t|GVht|PRt|R t| &R&t|VXt|XcRct|Rt|R,VC[V[rRrt| Ret|Vt| V4JVJt|V0t|V t| s V t!V!"V""t|""R7#c#V#%V%%V&&Vt|Rt| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|t|" t|e0t|s t| "t|7#%t|%&t|2PQiPx|Pt|,,Pkt| t|et|Pt| t|4t|P0t|s t| t!t|!"t|7#%t|%%t|&&t|thkth thethth th4th0ths th t!th!"th7#%th%%th&&thtrktr tretrtr tr4tr0trs tr t!tr!"tr7#%tr%%tr&&trt|kt| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|S,SSt!!St|t|" t|e0t|s t| "t|7#%t|%&t|WW<WkW XWNW<JWW&WW  W+iQ&9Q  QL!Q!Q$$QW2HWWDW##W $9$W<%i%W%%W&8&Wn&s&W&&WR8R##R% %RWHWWDW!!W!!W##W#9$W%i%W%%W&8&W&&Wt|kt| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|kV[ZVVVruVeV""Vt|kt| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|Pt|kt| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|t|kt| t|et|t| t|4t|0t|s t| t!t|!"t|7#%t|%%t|&&t|WL W<WkW XWW7JWWW >!WSSS.S SS&S N St""S$$SkQ)QQ QQQ&Q rQQQQQ4JQQQg!t!Qtd" tdD0td6&tdt`" t`D0t`s t`w t` &t`SSS eS0Ss S"7#S%%St}t} t}et}t}Jt}^t}0t} t}PRsPPRRwRR Pt}t}S t}et}JSSS[t}[iSit}^t}0t} S S ^SS SeqSS7wSS St}t}Vet}s}t}}t}RRVRoRoVRV^t}t}0t}uut$W$&t&WEEt t t#V&V"S>ESEHPHSPSuuVtWWZtZooVt.t .88Zt ZooVt St&SV&.t.cSVcdtVdgtgSVtVtVSV,W,.t .eWegt gVW&.tpWgtptpJVtp&.tlWgtltl*VtlU_Po}PPPPXYuY[u[9tXvvWtWt9WXvvVt Vt 9VX9tx~SSPSPSPSP9S<=u=?u?t<WW^V^ataV<t 66t M_WaWWWWatptptpWatltltltlWat~PPPPt~PPP.5PIIP\t~t~WaththMththuutStStStSWt Wt Wt WVVVVanPPP>CP`pP<t}t}t}uuJ tP S J SR W J WQJ t V J VP $ P9 H PL M uM O uO tL  t] S w S , SxSSoS t}U t}8 xt}ot} t} Sb S P S*P*MS S t} t}8 xt}ot} t} t}_ t}8 xt}ot} t} tl tl8 xtltltl tp tp8 xtptptptp V V, VV tlb tl8 xtlotl tl t}b t}8 xt}ot} t}  t} W t}b t} W  t} W8 W ^t}^xWMt}MoW t}  t} V t}b t} V 6 S6 l Vl S8 S V ^t}^xVMt}MoV t} t}b t}8 xt}ot} t}uuetSt"S"&t&eSetPP.1PHKPuut55/V/2t2V0W2W.S;aSSS2tr;trtr2tp;tpPtp/R/tptpRtpRtp2t~;t~t~t~2t~;t~t~YpPPOTP2t~;t~t~2t~;t~t~uutP{V}V4R6CR}RRRRRQ/S/6Q6zS}SQSQSuutWWt 3SsSft}t} t}ft}t} t}ft}t} t}ft}t} t}rVVQ~Vy V - V~ V  VfWW A Wy Wv WsWWHuW^Wft}rt}rVt}Vt} t} V t} V t}u P} P Ps|PPft}t} t}fzS_S S P S(P(HSft}t} t}ft}t} t}fzS_S~Sy Sl SSftptp tpftltl tlfthth th.R - R  Rt}t}WXWuWt}Xt}A y t} l t}pst}t}Wt}t}Xt}A y t} l t}pst}t}Wt}t}Xt}A y t} l t}pst}t}Wt}t}Xt}A y t} l t}pst}t}Wt}t}Xt}A y t} l t}pst}t}Wt}ScSS#SSS4SSt}Xt}A y t} l t}pst}t}Wt}pSS)4S4?P?sSWwSS^gSPt}Xt}A y t} l t}pt}!S!Dt}DcSct}St}Sst}t}Wt}PhkPPt}Xt}A y t} l t}pst}t}Wt}t}Xt}A y t} l t}]st}t}Wt}t}Xt}A y t} l t}gst}t}Wt}WXWSWWauW^WWVEVXV A V3sVVWVWVA y V  VZ c VththA y th" l thSS5SorSA m S" = SZ c SSSorSA m S" = SWWA y W " WZ c WW!WoW" Z Wc l Wththc l thPSorSS!PSorSc l SVcV" N Vc l Vuu3t  P t "P"3t R'3R45u57u7FtHIuIKuKVtXYuY[u[itlmumouotlqPuuttt QtQSQtQSQtuuttVVW$W$*P*WPuutuuttItIQQtNVNQt QVOWOQtQWMSQSuuttuutt u  u }t,,aSactc{S{}t.<Q<SRScQcsRv}QuutPVVWWuutPVV R SS Q WW  tt`t`^tptpuu2tP2t45u57u7t4APAVVV4bRRRRDSSSJWWW u  u tPmVpV!V$VVhnWsW"W$WWuutPtPtRRt|uut P tv. R. tv _ tl tl tll  tl tl tltl _ tv tv ( tv # tv tv tv5tvtv} tv tvv R R P R _ tv tv tv6 # tv tv _ tvK ( tv # tv tv5tvtvuut@@\S\`t`S$^W`WPPX]VVPVVPV@RVX`tptptpwtpwQtpQtpX]VVV@VRYVYdPdVuutuuPt  Pt[SeSSS S FS9qSvSS3StpRtpRPtpPQQ+3QXRR[aSSS SSqvSSS'P9>P tUt3Pt VD9V3PVPPP"3PPQuQSuS,tP,tjSStp atp,tpPP8@PIVP PENPauPPPt~ at~,t~QuuKtAtAK?S?At AISIKt LMuMOuO\t\]u]_u_t\t\W7t 7PWPft f~W~t W\&t&77ftf~~tm4V7VVPPW#P#5WJaPfyP~WPWSPS&3S~SPSuultltlmumouosttuuuwuwttnntVVVuutt\W\^t ^Wt Wt ^t^Q QVtV EEVtV[VZS(P<VP|PPuuftV"t"GVGJtJVtfVR"t "uRut Rft aatfth ht ft WWWPfW8S=YS^aS"t\t\ft\S6FSSS8=SY^SafShiuikuk th S  th V  t  u ugt  S #t#gS!V#gVhiuikukCthttCthCt V.V$VPPPtstsCts.VtVV3VDEuEGuGtD[[tD[[yRyt Rt Rt Rt D[[StSSStuu@tVt ,V3=V=@t Wt*W*1t1>W>@tSPS6<S@AuACuCt@QQS@QQcPct uu& tWt W & tSt  S & t & t Vt V & t( ) u) + u+ t( O O U WU W tW W t( O O S SS W t W ~ S~ t ( O O t( O  O t( O O T VT W tW  V t u u t  W t W t  S t S t  t  t  V t V t u u B t   W  t < W< B t   S  t  : S: B t  B t   V  t ; V; B tD E uE G uG tD w w W tR h Sh S S^ V u u ) t   W  t ) W V ) V V  V  S, - u- / u/ t, J J \ W\ ^ t ^ WC [ V^ u Pu V u u B t  v Sv + t+ > S> B t   B t  d Vd + t+ @ V@ B tg VW + VWv QS + QSuuttuu@tCPPPP.R.@tl&VVVV @VVV V QRR RELQS@AuACuCht@UUht@UUht SXPafPhiuikukth}}th}}t {PPuutPRRRWQSuu@t%%@t%%@t #0P05R9>P@AuACuCpt@UUpt@UUpt S`P`eRinPpquqsusytptPytpyt VW0VWWyVWS/S3yS|}u}ut|St uuttVPVSuuAtJVJMtMXVX t >V>`t`oVortr2V2At;; t >>`t `22At ;; t >>`t`22At RE`R tJ`t2AtXVV V>]V2AV% t`"rt`2At`rtAtrtpAtpPSS*SrtAtrtlVAtlrth5rthAthS*Srtd*Atdrt`At`DEuEGuGtDXXStuutPt  2t 299t 27WIWW29R?UR]RuutuutStStVt Vt uutt66t t t t\t\>S SSVV V_VVtp"btptpuu>t<W<>t;VuutPuu*t,-u-/u/t,NNt,NNWt Wt W,TTtt,[ [t ,[[t t t YVWSDWSSSSuu t&& t33ht ht t  ,,t t3 3^t^  &&3W3;P;fWfht hW W1eV/dS/S^dShS SuuEtPSP1S3<S>CPCES0P3;PHIuIKuKytH__ytH__mVowVwyt H__lSovSvyt]kPouP|}u}ut|tPPuutPRWWQVtVt uuLtMWMOtOWtLWBSBOt OlSlt !S!/t /9S9Lt tCCLt2LVYV/V4LVEOtXtXtX#/tX9LtXEOt\t\t\#t\/t\9Ct\EKSwVSVSSS#S"S'/S9LSBKSA|SS#ISS S"'SPCFPAaP#0PPP PEOt`t`t`#t`t`/t`9Ct`@QEQQtQ|QQ Q'Q>QITQcuQQ Q'/Q9CQEOtpltpH/tp9LtpLMuMOuO{t|}u}ut|t VVPuutPSWSWPS8R?[RfxRR2S28PA^S^Suu!tPSSSRRQQPPtx$%u%'u'et$LLet$LLSt St St DSDpt pSt SBt B&S&9t 9St DSDXt XmSmt eS$$$DtDttBBet$L LWtWt W DtD|W|tWtWtWet$UUtetNVt\Vt\Vt\ V t\MVMpt\pvVvt\Vt\VBt\BVt\rVrt\2V2Xt\XeVRRRRVMpVBVRRuutP.:PRXWWW=VIWDtluu}tPt`P}t`RSRSQVQ}VWPWWP}Wtp }tpSS'P'SSSZPZ}SuutPtRtQt+t?tWt`Wt`)W?`W`}t`}Wt`7W7t`WSWSW2S2Wt`Wt`W,S,3P3ASSqzPzSPS`SPSPS2SS+t@?t@$SSVVoVV V?)VV2VmVV+tp?tp+tD?tDtHJltHNtHtH2tHtH+tL?tL+tl?9tl9VtlVtl$SS`S&S&/P/9S9WSWPS+tT?tT?VVoVV+tX?tXP$SSJSSS$SSmS?VV"VmV+tP?tPP!P+th?th$SS S5SS2mSuutStStWPWPWuut77QSQUtUStSHSWeWPWPW0BPU^PuutW t WS t S t --tV7TVT]P]VPV tlFtltl RRRR tp(tpuuXt++GVGRW'8P:DPDPS/PSXYuY[u[touRuWRRuuStPRIVLPV6GPLNP!RTUuUWuWwtTjjwtTjjwt TjjuSuwthoPttPxyuy{u{txtVSWRPuutWtWtWVt Vt VKdRRA^PzQP u  u >t@AuACuCtuuYtYtYt StSRtRYSRPRPRFRR<RR7JP1R\]u]_u_t\ooWtkVwSuujt3P3>tl>FPFStlS]P]jtlSQStpZjtpPVSgVlmumouo{tlvvyPy{t|}u}utuutStStt uutP$S(bSfSRt`Q V (Q(cVcfQfnVnnQ P^^P&W+dWfWPV^PfrP(tp1tpuuOtPVPVPOVROtdQ(t`(>Q>Ot`th(th>OthWWOWP(P`|PPPP.mQQQ1jSSSPQuQSuStPpptPppt PppwSwytyStnuPyPuuttt StStPPuu t t t StS tPP  u u@t ''@t ''@t ''0S02t2>S>@t%*P2<P@AuACuCt@NNStuu3tt3tPP++Ptp3tpuutuu7t%P%W7WZRZ7th:\S\rRrvSSRS7S2trQQtrQ7tr89u9;u;t8MMRRRZtZfRfmtmwRwt8MMRQRZt ZfQfmt mQt RRPfmPPPwRuuGtPPRS SGSQV VGVPP PHIuIKuKtHZPZVHhRhSH^Q^WjnPPuum tm tm t SS27SSPS/P/tStPSS S S 5 Sc S P S P : S S PS X S^ m Stz% tz m tztz% tz m tztz%tztztz8tz8>tz>tz*tz*utzutztz tz m tztz% tz m tztr%trRtrR tr m trtz% tz m tzRRRR ' RV s RK g RN \ R RRRRRg R 6 RN X R u SK p S6 S SX ^ SQQQQV s Qi Q X QZ ^ QtlV : tlr X tl^ m tlV' s Rn X VW WK ^ Wp S F SN S Stz : tzK m tztz : tzK m tztz2 m tz5 S: K Sz R Stl tl m tltzK tz m tztz# tz m tztzA tz m tztzKtz tz m tz,_R tz { R{ tz tz  RVFV V  VKlSS S 5 Sc u Sp q uq s us tp  kSkotoSmuPP tp t~t~ tlPP t~ t~t~ mWoW OVSzVlVoVuut]]jtj  t  St fSVfgtVgjtjSVtVtSVtVtSV//t t Suuyt  tyt66t yt StSVtVt tV yt  t yt RR)hRRR1IRSSS#S1IShySth%ythCQISQtlItlhytlQQQQtpjItphytpuutPuu3t$P)1P45u57u7t4QP`}PPHSSuu9tStSt9S9t "VV")V79V<=u=?u?wt<JJ[S[]t]uSuwtxyuy{u{txPVPPSSuutPS !u!#u#_t ,,6V68t8YVY_t;HPJ_PCXS`auacuct`mPmVPuutuuAtP V>VRAtpQAtlWP?WDEuEGuG0tD`P`fSjmPmS0SD[R[hWhjRj0WD[Q[gVjVV'0VD  t0`jQvxQQPQ'Q`jt`~t`Pt`P0t``jt\'t\.0t\`bPbjtptpP'P01u13u3dt09P9bVdeuegugtdoPoSuuXtPSSS!SSRVRVRXVWtX:W:>S>xWxPWPSWPW!P!3W3MSMWPWPW P#tXPPPXtXSSP:S>xSSPS$3S;CPSSSSSt\>Et\t\Pt\!t\t\t\SMSSSW>EPPSPS;;P_nPPP3;W;>P>XWRCER`eRjoRRPR!RRRRRRRPR RPtptpPt`ut`Xt`SSXSXYuY[u[} tXiPi}S} SwWWP W  V ! P! J VJ \ Wa } Wwto} to u u N t P th P N th R N td Q N t`   t $ $ ; t; N - X Rm p R R S S  S@ S R S / S4 6 S tl tl tl N tl S  P " P) , Pf i Si w P S P S  S  P C Sm ~ S S S/ 4 S6 ; S; F PF N S tp tp tp tp N tpP Q uQ S uS O tP z z O tP z z V  t   V  t  0 V0 3 t 3 O VP   t   D tD O  D tlo z Sz P S  S / S3 D SD O PP Q uQ S uS tP { PP a RP { QP  t} S P S P S P S S u u yt  WMtMXWXdtdlWlyt   t ddlt ly   t ddltly   t d dltly 55FtFXXdtdy MtxVdtxjytx )RCMR]yR|}u}uZt|StSStSZS|t Zt |tZt| t Zt|tZttpZtpWWZWVZV\]u]_u_t\ttSt\t t \tt\ t t\ttWtWtWtWt\ttVtVtVtptpSSStltltlRRRPRuut00ISItWW[t [eet WW[t[eetW W[t[e et00[W[etetWtvtv~W~tWt00bVbetesVsvtvV[etpytpIaSerSvS[etl~tltl[eR~RRuuttVt VAt AOVOt t@t@SSPSPASCHSHOPOkSkmPmStD7tDOtDtHAtHOtHtLAtLOtLtPAtPOtPVAVOVuutPtltlRthWPPP\cPcjVVPVVVmtptpWtptpcVmVVuuDtPSPtStS8t8DSZtp8tpMt8tZVVVP'V'7P7VVVV V5VP PPZztztt't'ttt8t?DtZt8tPPPPVVVZt8tZt8tuuctP,t,.P.ct 8R?SPacP*S.QSScSdeuegugytuuctP,t,.P.ct 8R?SPacP*S.QSScSdeuegugytuu1t  1R1t45u57u7t4NNt4rrt 4tt4N NYWY[t[WtWtWtWtW4NNXVX[t[VtVtV{SSSuu;t#P#/V2*V-;VR;tXQtTRQR;tT+W)S-tp-tl-thq-t`6;t`<=u=?u?t<VVt<VVaWact cWt  W  t W<VV`V`ctcVt V  t VS Suu,t//WtWt,WllqPRqt t ,//VtVt,VsSPSPSPSPS*S*,PztltlHt\,t\,-u-/u/t,@@t,fft ,[ [twVVvtltlQxWWJSOvSSuut77WtW77jSjt Sddtt@tptpKtltlthjS=VVVuu1t  1R1t45u57u7t4YYVtV4YYt 4YYtt4 t uutuut99StS99t PRt 99WtWuuztt&P&zt**zt VPV79P;=PMzVQ-9Q=zQPPCZP_zP|}u}utuutuutStSt QQQQQuutuuNtNRP*P@CPPQuQSuSYt\]u]_u_gthiuikukth~~PtPtPth~~RuutuutPtuutuuVt=S=?t?HSHJtJTSTVt::PEEPQQPXYuY[u[atdeuegugotdxxWtWt6W68t8oWdt 88[t [ffot }}PPP00P:?P}SQSRSRS4S8?S?BRBHSH[Q[oS}t`t`B[t`mot`}tptpotppquqsusyt|}u}u\t|PV V04V9FV|R\t`|Q!t\!-V-\t\P((PAAPtp0tpI\tp\]u]_u_t\St\Vt {QPQuutuutuutuutGGLtLttJSJLt LQSQSt SS))PPPP)LtxStxuutt**tWt Wt (W(*t *W55t tptp5KtpWtpuutQSQUtUcScgtgS\\%t %uut ?JWJMPMuWuPWPW %W-SW]eWlnWsWuut !u!#u#>t@AuACuC^t`auacuc~tuutuutuutuutuutuu tuu0t01u13u3PtPQuQSuStPbbjSjltlStyQuutQtuutuut u  u tuutuutuukt3P3kt\<R<ktX<Q<ktT<<\S\`t`{S{tStkS>^W`}WWkWL`t`ut`t`]t`dkt`L`tputp KtdKtp]tp)PDQPPP 1PL]VcoVo|PRVkVL`thuthKth]thL`tlutlktllmumouotlPtXlRtTlQtPlVtVtVtVWWWWt\t\\t\%t\t\tltlct`tl,tlPx~PSSSS"SStdtdtd3tdththBthuu t t t t/t1 * t t t ? t 1 t1 @  @  t1 t1 @ @  t1 t1 @ @  tVjVLV  V VPPP P  P P!t}/<t}JLt}[8t}Ct} t}@ o t}t t}  t}* Y t}^ t}  t}?  t}t} & t}& 1 P1  t}VjVPRVRVV/V  V@ t V* > VR> ^ V V  Vtl /tltlt  tl tl tl ? tl  SVySVt SV  SV SV SV ? SVth /ththPRtht  th th th ? thtd /tdtdt  td  PR  td td td ? tdW /W~Wt W W W ? WV/V  V^ V V  V?  Vt~/t~ 1 t~ t~ t~0 t~  t~t~/t~ 1 t~ t~ t~ W2 W W t~ W  t~ P PS S 1 Sa S S?  St~/t~ 1 t~ t~ t~< t~  t~t~/t~ 1 t~ t~l > t~> D PU ^ t~^ z P  t~  u  u F tuu teet tt //Lt L t  t RR tp pwtw /t/L Lt  t J tJ  t''tNtettctttJ  t ; t t'Vt 'VWSVSVVV;VW;wVt wVW;Vt ;>t>LtWLtVWtVVSVSVVWtWtSV VW ASVSVVt @SV|SV@Vt @SV tW VW tW  SV SV>> t$ t(C Cwt(w >t(>t tt( t(  t( J t(J  t(QQ\wQtzQQQQtlHwtlLtlTtltltl tl}tl}PtlPRJ tl  tl  P tl P tlt~\wt~>t~tt~t~ t~t~@t~ t~wt~>t~Lt~t~t~ t~ t~Rt~t~ P J t~J P PP f t~f i Pi t~t~rwt~ t~ t~R>t~JLt~tt~t~2t~ t~t~w|t~t~;@t~t~E J t~  t~  t~ t~ t~ShwS:SjSSS1@SSQP P Q>t~tt~t~t~8|t~  t~ t~ t~;VtVVVV V V VSS@|S  S  S;VtVVVO|V [ V<WtWWW  W$ W W>t~tt~t~t~m|t~  t~$ t~ t~W\wW<WtWWWW|W  W $ W>thtth;thth  th$ th th>t~tt~Ht~t~t~[|t~  t~ m t~ t~ t~>thtththth  th` th th>thtththth th) th th;VtVVV"VV $ V<WtWWWW  W WS 7SSS  S $ S S>t~tt~t~t~t~t~  t~ t~W\wW<WtWWWW|W  W $ W>t~tt~t~(xt~t~t~t~  t~ $ t~ t~>thtththkthth  th th>thtthth<thth th thSPS SW\wW<WtWW W@}W}P W  P P>thtthth[th th u u 2 t   2 t   2 t   2 t    2 t   2 t  PR 2 t P P% - Puut  0W02t2WtW'2tTEtTYSt`R<S<ZRr~RRSRSSSVSSVXVVuu@tP@QR3S6=S@AuACuCt@OOt@iit uuAtAtAt jjtAy ytA tAtAththAth[t`t`<At`]Q Q4AQSAStlAtltpAtpDEuEGuGjtDTTjtlmumouotlWtWtWV,VVV P .VFVS S  P7kSkrPSSP  PSPS&S&)P).ShS.tLFtLtP.tPFtPtp.tpFtptl.tlFtlth.thFthx|td|Rt\ -t\-Vt\uutStStSPPPPPuutP"S&SSRtp_VVP.WWuutQtuuOtOt6W8@WBMW%Btd,BtheRRR R,#V,4S8>S,BtlPQuQSuStPccQtuutP!t!:P:}t}P6fR8nWnuPu{WW*zV}VuutVtVtVSt St S WtWtWRRuutQSt SuutuuZt--;R;JtJZR--ZQ\]u]_u_t\jjRuutStSPt Puu6tVt#V#&t&6Vt 6t6$W89u9;u;t8JJRSRTtTStStSROOPPPttxuu/tPt` P t`P/t`RVRFVFqQQVQV*VQ/t\tVtt/  /t VFkVVVVV V*/Vttptp01u13u3pt0YYnVnpt\gttgpRRYQY_P_pQpquqsustptpSt St PPuutStqSqtStSt44t 44t} }t }}tSqSSSuuttt St S tuut((-W-t((t ((1V1t!(S(5P5`SdS5?RQpRsRuutuutuutuutPtp%R%)tl)7R7tl)Q)SS))tRPt==bt bppt PVV9JPMzP}PP;QGORwRuuGtLRLt R RtRuRutR,t,BRBGtLLt   Rt Rjjt $t $GFFt  RtRddt,t,99Gt *V*-t-LVLtVRtRVtV,t,GVtGtGRR $R',RP"$P*,PLtjt$,t;t@RtYtt@tt$t$,t@9GtVLtQtt$,tLkSktSSt$,SLtt$,tLtt$,tLtt$,tLWW$,W S .Q.8P8RQSP$QRVV$VRWW$W RR RR$R2RRNRVR QuQQ9QAQQSZShS$S,xSSV?VMVVcVkVuu-t01u13u3t0||t0||t 0??GPtGIPRIWtRWt0||t t`V+t`Vt`WV W VTt`TtVtt`Vt`PSSW RWtWWW6tl6SVStlPP%PCLPPSStSSQTtQSSTtSRR!RTtRuutVtVt t teeutueeutuSSPSuutuuUtOVOQtQUV@@Kt KUQQSUQ@RIKPKQR@QRXYuY[u[utxyuy{u{txStxt xtPuuotot?W?At AQWQSt SaWact coW=S=AtAOSOStS_S_ctcoS  "t"o  "t"oVP V>VIPVY`VAtpjotpuu?t  !P!?t44?t @AuACuCt@TT]S]ataStS@t  u  u tt3P=XPUrVtuuuwuw8ttVt8VtSt8S89u9;u;)t8PP)t8vvt t t )t 8qqtmmt)vWWW)WSPST,SmS}SSS)SV VVVvVVV VVV)VPPPPPPPP PPP$)PQ}Qgpt`ptXt`tXt`tXt`tXt`tXt`tXt`&tX&4t`4,tX,Ft`FKtXKht`htXt`tX/t`/tXt`tXt`)tXvtp)tp,-u-/u/t,CCVtV,Nt dSSSSPPSSS SS&S&2P2JSbzSuu tP tLR tHVt VWtWt VW tW t VW tW t VW tW t VW tP - P- tP P tP u u  t    Rt  u  u a t 2 P2 S tHS X PX a tH| - VW0 C VWS S , S0 B SF O Sd e ue g ug td P S S S P S V P VR V V V V V PVP2V?GVGMPMVPVPVP&V-2V7<V{VPVPVPV**VQ\V\PVPV tlY tl&tltl t~Y t~]&t~*t~ t~ t~ t~ t~ t~ <t~glt~t~ t t t tY t &t2<tt t t <ttVt tB t t  W &t2<tt"W"t t t t V <tt WY W WW*=W t4 t &t2<tt t; t &t2<tt WY WC WI R WY W&W=WuutVtV t V0EtSS-SS?hRmRRS S PS #P#-SSPSPSSSuuttt  t~tt~ t t~tt~``tptptPPPPPPPkSPSPS,SSPSpSuzPPPS*5S5;P;`S|SPSPSSSQvSvyPyS1t~pt~t~R;t~pt~t~Ept~t~Rpt~t~'tpttuubtbt`WdeuegugtdtdEVEat avVvst sVt Vt Vat\mst\zt\t\t\t\ SE]ShmSsSSS SPmuP ]SmsSatlmstltlVatlstluutuuvtStkSkmtmvSxyuy{u{txStStuutuutVtVtuu t PP !u!#u#+t,-u-/u/7t89u9;u;qt8EEqR8EEEPEGt GKPKgt ggPiot ooP8P Pqt8WWitiqtuuuwuwttQtSVPPuu6tVt/V/6tWt 0W06t 6tpSQ89u9;u;t8RRVtVt8RRWt Wt 8MMtpdSkQuutQtPt Pt PR tuuWtMQMWt$P$.t ..P.Ot ORPMR3 3WtXYuY[u[tXmmStuutPtP(t((P0KPKtPPtPt 0t0vvtt tV-VVS,SSt`t`V0t`9<t`<>VBvVvt`Vt`tp0tptpPd|Puu t W MtMZWZtW tt  t t t t  tt ttFMtM^^t t t CFPPP PFKWsW W*Mttgtt ttFMtttt tttt !u!#u#GtHIuIKuKmtpquqsustpQtQtpRRuutQtQtPt Pt PPPuuqtEVEHtHaVadtdnVnqtFWFHt HbWbdt doWoqt HtHddqt"DSdmStuuuwuwttQtQtPt PRRRuutQtQPt PRRRuuvttStvtxyuy{u{ txPtPtPtPt Px tx StSt SVV VuutPPVScVfVVVmV VRQWSdWfoWotRtWRQWWQOSSbSfoSo~Q~SQCStt 11HtHffotoHStp tp6@tpQ]tptptp tpHOS S}SS SSHStP[ftPtPtP'Stlfotltl !u!#u#t 00bVbvtvVtVt LLt  LLtbtVVVuuStStStSS,t,Stp,tpuu?tP5S7=SRQ@AuACuCt@``t@t R.t .t U`W`fPf,W.WPWW*SSStttt`gRQuutPRPt5S59t 9St Vt6VW67tW79t9VWtWtuutRtSt St VtVWtWtVWtWtuu^t33^R33IWIKt K\W\^t **3St3GSVGHtVHKtKZSVuut  PtPt !u!#u#:t 3P3S6S 7R7:tL 7Q7WQ8W3OPPPP.2POZPZVV.7VRR.:R`tl.:tl<=u=?u?t<QPQ]td]cPctd<QRQZV]NVNURUV<QQQrt`rxQxt`Qt`Q]th-th4BthBUQUthQ[WOWUWQSRR(R4FR`eRR QU`QeQSU`Se|Suut"P"MWOWWW&R&tl&Q&th7?R?BPBORPR|SVSVuuttPW*P*BWDfWhtWRttlQtt\,1PhkPSVDdSVtuuuwuwttStStSVVVVVWWuut..StuutPBSFxS|SRtpatpQtlVPCVFHPH_V_oPoyVVuuttt tt StS"t"pSptStpV"tp"Vtptpt`t` W t`WPWuR"tl6tluutuu t   t$M t R t    t M tpR tp V  P VPJ VM g Vj V M tR t u u d t  S t S t  S  t d S  V t V t  V  t  d V  P t P Q P t  P < t< H PH d td e ue g ug  td ~ ~ V t V t  V  t  Vd ~ ~ S t S t  S  t   S tt P  tt  u  u 6 t * * < S< ? t? n Sn q tq S t 6 S * * = V= ? t ? o Vo q t q V t 6 V  t  t ' ' 6 t8 ? tte q tt{ tt P tt tt8 9 u9 ; u; t8 N N d Sd k tk S  t U SU _ t_ i Si p tp S8 N N i Vi k t k V VV X t X V8   t : : I tI X X _ t_ i i p tp d k tt  tt P  ttI X ttX _ P_ p tt} ttuu+tPtP+t,-u-/u/st,;;TPT[t[bPbstVYPuu>tP>t<S@AuACuCbt@JJbPdeuegugtdqqQdqqR{{PPuutPVW Wuu4t45u57u7t4HHSSSWtWStS4 t MWR_rRtRRPRPRRR RxRRMWtptpMUWP W PWMOPPP3zQ*QQMWtd? tdtduutuu tP}VPVV VuxPPPP'tptp tpFtptp tpVtpYtp tpYtptp tpY|S SYtp tp  u ut ##t t t t  WWiV]  ]t/ /StS] qttt -;t~t~t~t~-7SSR1ShS-;t~\t~t~-;t~8t~8vWt~NSt~t~t~-;t~t~t~t~-8VVVV-;QQQ'QQ-9W PW<BPjtPtWPPWuub t  b t  t b   S t = S= G tG Z SZ b t V V D VG b V S= C SZ b S tp b tpd e ue g ug  t u u t  t P t  t  t  t Z Z t  t   M tM Z  Z t    t tdM tdZ tdH e td td S> V SZ q S VK e V th thZ th P P P P  PM R P P P P P P V VZ ] V  Q/ M Q Q & Qe g Q Wc m Pm WZ W P tlV tlZ tlZ e tl u u t u u Et  S t *S*-t-;S;>t>ES  V t +V+-t -<V<>t >EV R P R R P-R5>RCERHIuIKuKtHbbStStStSHllt t HbbVtVtVtVRQPQQQQuuBtSt@S@BtDEuEGuGtD\\tDrt rt zzt jtPorPPP*/PMUPozPPjvS2zSLztptpztprztptpztptpuuIt6R66t6IR3W36t 6@W@Bt BIW2V26t6?V?BtBIV 1S16t6>S>BtBISLMuMOuOtLrr|V|tVtVtVtL^^rQtr{QS{QtQSQtQSt St QSQtt Ld dtlLjjthuutVtAVADtDaVaeteVtQtQSQt@QS@DQtD\QS\`t S`et e~QS~Qtt  tlthuuttt qt {t VPnVv{V}VVV'W'+P+oWmSmoW;?R?CPCPRuu@t@tBMVM`P`V5V.W6W;@W@AuACuCWtuutStStS}}t t 6R;vRvtRtR} }t t }}tt{PPPPPuutt(P( t P// t / / t  WtWtW2EPfPPSSSRRVV VVB_QQQ QuuGt  Pt"PR"'t R')t )4PR4APtAGt uu`tRtKRK`tRR`t RR`tR R`tRR`tRR`tPP^P`auacuct`tt{V{}t}Vt`ttzSz}t}Stuuvt  Pt PRtRTPRTVtRV]PR]_tR_ePRegtRgmPRmotRotPRtvtRxyuy{u{txtxRVRUt U_V_bt bVt VxUtUxH HMtM x<<MtMSWQSP5MPZZPPPuuttt StSVSttSVSttSVStSVStt t tptptptptpWWPWPWuuut++tntnuVt VVVnt nuVt1YnuPQQPsuPxyuy{u{# tx# txPPbt b# t xPPbtb# ttvVEtvEbVbitvinVntvPVPVVPZVVTVTfPhVP1V1QSQrVrS1 V1 < P< P VP c P V PRR # RW#*W*4P4bWnPWtltltl tl $ P$ # tltu"?W?CPC|W|RWPStuStutuWtuSP W  tu S< K WK P PP # tu5qRR'R R< P Rtl1btltltuPbtutuSPbSS1SQS$ % u% ' u' # t$  t   t # $ J J # t Q P Q Q Q Q P Q # Q S,  SuutUVUWtWVtVtIIt ILPPPPPPP{Ruu2t2R2Q45u57u7`t4CC`R4CCLPLNt NUPUWt W`P`auacuct`ooR`oo{P{t Pt uu%tVtVt%Vt t %%tP P()u)+u+t(ttt(ct ciit t t (ttt(Q Qctc ^t^ t t(\\ctctttt(@@MVMtVtVtV^t^VtVtWPWPWWWW1W14P4WPIWILPLWPWitTtT'[tTtTRtTiyPP0R0hPhjRjpPpzRRPRctXtX ^tXtXtX>BPi~VV [VVtptptp3tptptpctptp^tptpQtptp^tpptpPxyPctptp[tptpPuutuutS"t"]S]`t`S--t PTYPu}PPzQPQPuu"tt"tt "t "t uut  PtPuut++tjjt PPtt;;PPcPPPPPPuu)tuutt!/t~Srt~t~SaPPPmrPSrt~t~Srt~t~KSPRXcPRSrtltlSrt~F~t~t~Srt~%yPyPRyt~y~Pt~Srt~P~t~t~Srt~~t~t~Srt~~t~t~SrthP~ththSrtdP[td[cPc7td7@P@~tdtdSrt`P~t`t`SaRPyR6RfhRhQR07QE~R-RCVRr|RSrt~P~t~t~SoV V^VV07V;_V_VrVcxPx{P07P@EP,IPPPuutPSSSWSRtP&Q&tLtTJtTWltTvtTxQ2JQfJtXWltXvtXtXVVWlVvVVP!.PinPPPPPOOPglPqvPPhWJWWlWvWWt\Jt\Wlt\vt\Q!dQQQQWlQvQQtdJtdWltdvtdx{P@JPuutPtPtPRRRQQQuutuu't()u)+u+ t(<P<QSx~SoSs~S S(?R? t(]Q] ttAetdt t ttetdttt ttettdtt ttWtWtdtt tWWWPWPWPWWW\P\eWeqPqW P dWiqWxWWPWPW W P )WQWPWzWz}P}WP Wtetdttt ttettdtt tdt@ t@<VxVV#VVP VZqP V<V<xtXxt\eVeVdVtXQt\Qt\ tXHQQQtXQtX t\<VxVVVR V VtHHetHdtH t`Ot` t`<VVV V4eVeqRqVtptpPP{PP9tptp  u  u C t ! ! * P* , t, C PC C tD E uE G uG W tX Y uY [ u[ k tuu t u u7t 7t,P.5P89u9;u;t8KKYSY[t[ySy{t{S8QQTtT[[t8 t 8tRRPuu1tPSS1SR45u57u7}t4CPCLSN{SIIPlxPuutPQRuutPSSRPPQuuItPFVRBIRESLMuMOuOctLaPdeuegugyt|}u}ut|P|R|Quu-tVt-V-t SQSQSQ-Stp-tp01u13u3t0?P?bSfS0TRTdWfW0^QfuQuu tPS SRW WQV V  u uet PNSReS >R>etP (Q(5Vhiuikukth||Pth||Vt uxRxSRSRuutRPt Pt uutuutPuutPSSuut1P1wS{SS7R7YWsyW{WWBQBxV{VVuubt P 9V<_V R :W<`W Q bt`  S R S 4R48S<^SdeuegugtdPdpRpSdyQuutVtuu!tPSPS$%u%'u'.t01u13u3;t<=u=?u?JtLMuMOuOntpquqsus{t|}u}utuutuutuuatSat_W^Vdeuegugitlmumouo}tuutuutuu` tPVV` V R% 7 R` a ua c uc n tp q uq s us t u u t u u j t P V V / V2 j V R S R S R S  R . S. 2 R2 D S Q W Q W Q 0 W0 2 Q2 j Wl m um o uo  t u u t u u t u u t u u t u u t  7 S7 : t: Q SQ T tT S  8 V8 : t : R VR T t T V A A T tT [ [ t  u u K t  W t  W  t K W V2  VL M uM O uO tL f Pf S P S SSL d Rd tlL d Qd k tdk  P ?td?RPRtd tp tptp:?tpMRtptptp R$R W W?WRWuutuuFtHIuIKuKrttuuuwuwbtt@S@CtCbS2RXbRAVQbVdeuegug?tdxxVtVt?V@AuACuCt@RRVtVtNSSuuYtYtWt MWMOt OWWWYt StStSOtOUSUYt\]u]_u_t\kkth\VWVWt VW)V)*W,;W;[V[]W]VWVWV\tttd\z zt`tp,t`,9tp9t`tpt`\t\SS,;S]SS,tl2]tl]WtlWtluutV!t!+V+.t.VIIt t W!t!,W,.t.WuutWt/W/1t1WVt .V.1t 1V$t$KKt St-S-1t1S   t $t$$tpDtpuutPtlRVUVVVSWPPW?RVVVVVuutWtW\PchP|tttp tpt@Gt@t@ Et@Kt@SSSSSththth EthKhthththtdtdtd EtdKhtdtdtduu8!t#t#ssststi ti   t  8!txx#t #t Qt Qssst st i t i   t  8!t ##t#tststApti   t# #t#t sti ti    8!t#t#ssststi ti   t  8!tVtVtQVQatasVsstsVtVtpVptVi ti  V t V 8!tSt St QSQat asSsst sSi t i  S t S 8!t tPWtW\Payty~Pt t  Pz tttQatssttpti t t t 8!tttQatsstt0Atpi t t 8!tQ Q*SQaSSaQQaRR[PP8!9!u9!;!u;!X!tX!Y!uY![!u[!!tX!l!Pl!!S!!S!!SX!l!Rl!!tlX!y!Qy!!V!!V!!V{!!W!!P!!W!!P!!W!!W!!u!!u!"t!"P"/"SR"X"S\""S""S! "RQ!3"3"\"t\"w"w""t!""-"Q-"\"t \"p"Qp""t !R"R"\"t\""!R" R"\"t\"" ;"D"PW""VWF"Y"V}""V""V""u""u"_#t""P"K#VN#\#V""RQ"""L#WL#N#tN#]#W]#_#t"""J#SJ#N#t N#[#S[#_#t `#a#ua#c#uc#&t`###$t$$$&t`#w#w#2$V2$e$t e$j$Vj$m$t m$$V$$t $%V%&t &&V`#:$:$e$te$$$$t$%%k%tk%%%&t&&`#w# w#&t##Se$i$Sm$$S%D%Sk%n%S%%S#k$Wm$s$W$$Wk%&We$k$Ws$$W%k%W%%We$i$S%%Sg&&S&&u&&u&I)t&&&&V&&t&&V&&t&I)VL)M)uM)O)uO)n)tp)q)uq)s)us) +tp))P))V))V) +Vp))R) +tdp))Q))tp))Q)M*tpM**t`**tp**Q**tp*+t`+ +tpp)++ +t + +*4*Q**Q +!+u!+#+u#+9+t<+=+u=+?+u?+f+th+i+ui+k+uk++th++P++Vh++R++tlh++Q++S++W++P++W++u++u+4,t++P+,S ,$,S(,0,S++RQ++VQ++VW(,*,VW+++4,t+++4,t +,,(,t(,4,+,V,,P,,V ,,P,%,V*,1,V4,5,u5,7,u7,o,t4,@,P@,m,S4,M,RQ4,T,T,o,tp,q,uq,s,us,,tp,,,,P,,u,,u,"-t,,,,S,,t,-S-"-t,,,,R,,P,,R,,P,,R,,V- -V,,P$-%-u%-'-u'--t$-[-[-s-Ws-w-t w--W--t $-J-Y-`-Pw--PG-O-P--u--u-K0t--P--S-K0S--R-K0tP--Q--W-K0W.$.VL//V//V040V--V--tH.8.tH8..V..tH.L/V//V//tH00V40K0V--tp8..tp.L/tp//tp00tp40K0tpL0M0uM0O0uO0p1tL0^0P^0k0So0p1SL0b0Rb0l0Vl0o0tPo00V00R01V1 1tP 11V1.1tP.151V51G1tPG1p1VL0b0Qb0m0Wm0o0Qo0p1W 11R!1:1RD1P1Rb0o0tp1p1tp|00P00Pp1q1uq1s1us12tp11P12V22V22Vp11R11S11S2 2S12S 22S22S12tp22tp11S22S22u22u23t232P3213S53x3S|33S2*2RQ2V2V23t3&3&33t22P22R$3-3P53;3P;3@3R33P23V+323VB3y3V33V22V|33Vy23tl+353tlF33tl33u33u33t3333P33u33u35t34P44V45V55V33R34S45S55S33Q34W45W55W55u55u56t5556S6 6t 6{6S{66t 66S66u66u6J8t66P67W77W7J8W66R6J8t66Q6J8t666J8t66P67S}77S77S 818SE8J8SL8M8uM8O8uO88tL8q8q8|8S|88t88S88tv8}8V88V88u88u809t88809t88V 99V#909V0919u1939u39 @t09I9I9b9Sb9f9tf9 @S099;D;g;n;>> ?i?0999>t>>> @t\9f9tv9 @t\9f9tp:;;tpg;n;tpu;h=tpt=>tp? ?tpi? @tp\9f9t:;;tg;>t> ?tX?]?td? @t\9d9W ;;;Wl;n;W>>W99RQ\9f9t9;;tg;>t> @tO: ;Wg;l;Wn;;W??W\9f9tlr:;;tlg;h=tlt=>tl? ?tli? @tl\9f9tl;;;tlg;n;tl;h=tlt=>tl? ?tli??tl? @tl\9f9t;;;tg;n;t;h=tt=>t? ?ti??t??t? @Pg;l;W<<W>>W??W@ @W\9f9t;;;tg;n;t;h=tt=>t? ?ti??t? @t @ @u @@u@NAt @P@P@NAth@@SV@@SV@@WV@ASV'ANASV@@SA#ASPAQAuQASAuSAAtPAAPPAARAAth}AAQSAAuAAuABtAAA`BV`BcBtcByBVyB|Bt|BBVBBtBBVAAABWBBt BGt>GlGVlGoGt/F3FS3F5FP5F9FS=FJFPJFvFSFFSF GSGGS1G:GSbGkGSvFFSG1GS>GbGS\FFtpGoGtppGqGuqGsGusGHtpGGPGGVGGVGHVpGGRGGWGGWGHW=HoHSHHSGGtlGHtlHHuHHuHHtHHHHVHHPHHtHHSHHuHHuHnPtHIIxISxI|It|IISIItInPS=IyIVILVLLVMNVNNVNnPVtI|ItIJtLLtMMtdNNtOOtPPt:PLPtcPnPtdIzIWIJW?JBJWJ+KWP:PWtIzIWLLWMMWM[NWN3OW[OOWOOWtI|ItIJt|KLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItlIJtlKLtlLLtlMMtlMNtlN3Otl[OOtlOOPOPtl:PLPtlcPnPtltI|ItIJt"KLtLLtMNtNPt:PnPttI|IthIJthKLthLLthMMthMNthNNthN3Oth[OPth:PLPthcPnPthtI|ItIJtKLtLLtMNtNNtNNRNDOt[OPt:PLPtcPnPttI|ItIJtKLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItIJt(KLtLLtMNtNPt:PnPttI|ItdIJtdLLtdMMtdHNNtdOPtd:PLPtdcPnPtdtI|It`IJt`LLt`MMt`MNt`[OPt`:PLPt`cPnPt`tI|It\IJt\JKLt\LLt\MNt\NPt\:PLPt\cPnPt\uu<tP5t5:P:<t''5t 5<P33P::PP ,P13P<=u=?u?t<cPcvtlvyPytl<LRQLNSQNSVSVSV<tttNRRZWWW\QQuutPthRWWtt`t t`t t+tl+.PR.tltltlFsSVSVSVSVpQQQnPPPPPuuat P atl R ath Q YWY[Q[aWWS[aS 0PDSP[aPXV[aVdeuegugtdrrPtPtPtuRPPuutPWWRVVQSQSttht thuu<t<t  Vt7VW78t W8:t :<VWF Ft <tqqt< tX<tX/6SqS/:tpqtp/:t\\t\t\t\4<t\/:t`it`/6SLqSS<S<=u=?u?Yt<MMWPRWYt \]u]_u_xt\mPmxth\pRpW$,W.xW\ppstsvt`t vxt`\xt\  .t.[ [xt*S24ShjSotSvxStlPR4P<xtlSV.2SVAaSVjoSVtvSV+VajVxyuy{u{vtxvtxt tHttHVWPRVWtHWvtHx `t`j jvtx"t"jjvt`tPjvtPP S APU\PnP(SjvPPP$$P;SPejPtT,tTjvtTtX,tXjvtXt\,t\jvt\xyuy{u{txPRt uu tP t PtP tt  t  t t  SS RQtpPtpP tp !u!#u#t 00@P@ItIXPXtPt @@It Iggt t t  t 3FSISS@GVZ^V^^P^VV@BPPuu tPP S V u  u q t % P% b Wd o W % R+ H R\ \ Pi i P! ` Sd m S# a Vd n Vt u uu w uw tt  S t S P t S t St  W t W t W t W V V R V P P P P u u t   V  t , V, / t/ V  S + S6 S  W% - W4 6 WC W  tpb tp  tp tp u u : t  ) tH t : t  + 3 :  W P W W  W! ) W+ 3 W8 : W P4 tp  tp+ 3 tpuutRtwRwtR~~t Wt;W@WtW~ ~t tP|PPPuu*tVtVt*Vt ""*t StSt*SWW*Wuu[t[RuuPtR6t6FRFLtLPRISNPS>VFJVPQuQSuStP]]nPnytyPP]]yRyyt yRuu?t  #P#(t(:P:?tuu4t4R2V24t 1S14tuut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Suu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uu\tZWZ\t$S$&V&XSXYVV$P$NVNTPTYVY\P\]u]_u_t\yySt St St SPuutWtWtBtpIVuu t u u,t ,P,,t,-u-/u/t,EENSNRtRS,EEOVORt RVuutStuuttt tuu#tSt S #tR RRPV$%u%'u'Vt<NRRVRuu@t!P!>W>@P =V<S@AuACuCt@SSVtVVt@SSWt Wt Wt elSllPlSSuutuutPVVRWW u  u `t))6t?`t&&=t =`&t&`)V)1P1NVNQPQ`V?IRKVRVaPaR=FPQ`R`auacuct`tuuLt P )V+LV (S+2S28PBLSLMuMOuOtLWPWSuutPSSuutt%.P.5SIPSP\P\SVP6V69P9VV19t_\t_RR19t_\t_PDct_c}t_} t_ t_t_t_t_\\P P5PP19t_\t_t_t_=t_QSt_t_19t_\t_t_19t_\t_19t_\#t_#+V+.P.Vt_t_Vt_16V\VVP!VVV19t_\t_Vt_uu5tWtWtWt5WVt Vt Vt 5V\S\tStSt S tS't')S).t.0S05tGRP_bPP\SSS S'S).S05S89u9;u;t8JJVtVtVt8wwt t 8JJStStStuPPPbpPPPSSSuuttXSSS{SSattttttvttIKW WattUttaSSS=DSDRPRhSSPSHTVTZPZVVPVVPVVIWWW{WWuuPtPRPQ$S$'t'PSPQuQSuStPaPi|PPP_R_gWgiRipWp|R|WaaPP_eSsSuuttRtWt WPPPSSuuJtPtPJt  Jt !!JtP#3PBEPLMuMOuOtL\\tLuut L||tPP\lPP\nthth\ntltlcjSeS\ntptpVVuutPtuu1t#S#)t)/S/1tRPR R)RP45u57u7dt4NNbSbdtdeuegugtdttySytSttyPyWWPWy}SPSPSPSPSuuBt(:R>BRDEuEGuGtDTT]S]ataSDYYat akkt %t 35t Ft t t t DtD tY_WVW%VF]V_fVfnWnyPyWVVWVYPYWYathththVthuthYatl|tlYatp%tpAtptptptpYaRRRRYaQQQQYaRRRRRDVRuutP u u tuu>t@AuACuCt@SS]W]_t_W@SSUVU_t _Vt Vt @U[SSPSSSPSU\V\_RfSVRSSVUWPW_tptpPtpfwPzPUWPPPuu)t P )Q R R P 'P,-u-/u/3t,1P45u57u7t4BPBQ4ORO_W_qRqWRWRWMSSuutuutVtVtuutt tt*S.SSQRVW!,W1W!.Q5SPSeQePQuu?t@AuACuCrtJpStuuuwuwtuutPtPRRuutPtPRR u  u =t@AuACuCt@VPVt@@VRVbVeVV@VQVaSeSSuutuuWtStWS1PSWPXYuY[u[tXiiVtVXiirPrtPuutt QtQt Q tQSSSuu\t--TVTVtV\V--SSSVtV\S0@PZ\P\]u]_u_ t\rPr tp\rRrWW W\QQlrSrQSQS StPP  u u6t 2Q26t89u9;u;rt8GGnQnrttuuuwuwttQtuut..VtV..t"7PPPuutP-W/WWYWRQthQtht%'PADPv{PPuu t t\ tX tTx W W u u t   t   + W+ t   t u u F t  F t PR . PRH I uI K uK ptH g g t ptH s s ptl } P P PPe W + W Wz R R t~ pt~ We WpWl r R Rl S S!S Vl VpV PR PR PR t~ t~pt~ P t~a v P  P; N t~N U Va t~pt~pquqsustptt  ttptPtPtPt4t>ttVLtT}tt#\S*fSS<V[_V_fPPtLtQQt't'Q+QtQQSSSR)RRy/VfxVVVV#SfSSSuuututlS!t !mSmut uthxyuy{u{txPtVVVuu@tQ@AuACuCtO|QuutStSuuTtStTSTUuUWuWtTttTkkt SWSPSP@QSQSPSStptpPPwSSS*VSVV"VW\VxVuuttMMttStjSjltltSOZPrtPPPP9PtuuuwuwttttStStSPPPPPPuubtNtN--bttP't'.R.2P2CRC-t-URPCLW0WbWV"t{CSVCKt{VKNt{-t{-]SV]vt{Vvt{t{Vbt{QVCKV PCFPQQCNQQCNQLW-0WSCJSQQCNQACPRPRPRRCNRRP3;PJLPFNt{[bt{FJS]_S_cQcSPSQSQSRQRbSuu?tP5S7=SRQ@AuACuC4t@]]Wt2W24t~(t(t RQuuGt  Pt"PR"'t R')t )4PR4APtAGt uudtIaSdeuegugtdxPxtldxRxthVSW~VVVuuvthSlrSrvtPvt iVxyuy{u{tuut\\|t |DIP6AtHACStLCxSVS;SUSuutuutStStuu t tuuVt IPuuntuu_tPR]VQ\S`auacucrttuuuwuwtuutuutMVMOtOxVxztzVHHOt Ot HHOtOLSOwSzSHOttnsPszttttPttuut-V-/t/XVXZtZV((/t /mmt ((/t/,S//S(/ttNSPSZttttPttuut {ttt EE^t^ss{t{t ttttt7W{WWW7V{VVV7SSS>kSs{SSS7tpR)tp)6R6StpS^R^{tpRtp7tlP)tl)6P6StlS^P^{tlPPtlPtlSSSSuutuu~tFQFntn|Q|~t,S,.t .BSBaRnzSz~R>QPQaPprPtvPx~PFaQ|~QuutQt Q tSt SR S RPPPPPQ Quut""t7Vt7HVWHLtWLtVWt>tdtd,OPRPRPRJiQmwQQQ$Q3[V/WWRetpemRmtpRtptpXytlytLtlRtlHtlHtLyWWWyVVuthth`thuyPPPyRYRyV[Vuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_Pttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttukku,,/R/u ,,uk ku 1FWFkSkqWqSWttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt)u)Q 'S &Ptt~uRuR\\~uRu R\\~u XSX\u\~SYV\mV2W2BupBZWZ\up\~Wttuuu VVWupWupWupttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt&u&R01t13t3=u0<<<P@AtACtCfu@^^fRpqtqsts}up|||PttuRttuWuWuVVttqu33VuV``qu^W^`u `oWoqu ]V`nVttuuttuttu//uhu`hu`hupupWFWWhVjlPtt~u  ~u**Du Dff~u   MWMQuQ~W  JVJQuQ~VGSf~SttuStt6uPu P 6utt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttu !t!#t#)uttu !t!#t#u EEuhuVVACPySttutt uttu !t!(t(4u@AtAHtHTu`atactcuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttuttu !t!#t#.u01t13t3auttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuWuWPS7[QSSQ{QupQ !t!#t#u CCWuWuCVVttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nulultt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt'u'Q01t13t3;u@AtACtCKuPQtQStS{uPbbwQw{QPbbqSqwu wySy{u tt% uPuPSuPSuPPBuPB_S_uPSuP>S>uPSPSPSuuPuS*uP*NSNuP S uPSuPSeuPeSuPSuPSuP0S02uP2>S>buPbSuPSuPS% uPRuVGuGVuuVu?u?VuVeueV u VCuCSVSbubVu% VQ% uuuu>>CuCSSbub% VVu u  u % uyyuuVVuuuu*u*PPu++u u RReueu>>bubuu% uWWV(W*LWLW V RWReVeWVV>W>CVCSWSbVb% WPRP_cSnpPPSRSPDSDQPQpS*RPqPt|PSSCSPSP  SPRPRuSuaSatutSu S RuReSe% uW(W W]eWWQ)QQ9RQQ>CQSXQZbQPPPPPPPReP>~SSSS S&SNSCJS0 1 t1 8 t8 k up q tq s ts u t t u t t u t t + u0 1 t1 3 t3 Q u` a ta c tc | u` j j | Rl | Q t t u  S u Ptt;u@AtACtCaupqtqstsupupVu VputtuPttiu  5S5>u>iS  :V:>u >iVpqtqsts+upVu+Vp+u p+uS+S01t13t3Qutt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt uttu !t!#t#ruceQttuttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttru""rQ$:S=rSttuttuttuttuP !t!#t#3u22P@AtACtCSuttutt u PttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9QF) )dk#O"F4J4JBe""_?b+M6}+jNe""_?b+M6 }+j^i Ks S g 1 E s  F e  = n  T ~ ? m 0 ,?b}j ,?b}j s G _ 9 ^i_w +g"" 5"" 58Aq6H; e"%z&"#% e"%z&"#%||  8 Iyh+<8 r Iyh+t<b .yg .gyL g@! g|@aL0<@ *  &(0 Q dI0IZ0G''ll,N,N]),r,++ - ]tb,r,;,K,++" - ]F r,,+),.*+)$*()c((''""r,,+),3+++!+**y**@*b**$*))))()((((u((''"" xaD)4I))r,,+ ,I)),,+ ,*$*))((((xSa7 !$*.*))((+'O'&&"|#'(O''-$%%%(.(%&%(.(m%%S%^%2%A%//L MzLLN@AA40F0(LzLKLI2|3?4l5I224l544?4v42|366 JlJ JJ.JlJ::LLKKVKpKyEE|B~C:c:LLKKVKpKyEE|B~Cx::::LLKKVKpKyEEB~C::LLKKVKpKyEERC~CBACBBBBLLKKVKpK CACBC:< MMNKVKI J:d; MMNKVKI Jd<<;O<? @IISEyEDDDDD1EJJL(Ls} YsAK'4fOOfsjf4O f4O  4  ,4  c N 4 $ Yn h n C6 h V h V h  * @] (9 @  TVsn\|     &&%%7#%!" t! s ^4J r_$$>!Q!  &DV$$>!Q!  9Di2&&G&s&%%%<%##2&&G&s&%% %<%####!!."".""#  Q!t! >!4< pQ!t! >!4<%%"&#s 0 e%%#&#"# t0f,e     Jr    J r'*'* o x, 8  ox, 8 Mo8 x P Mo!x  N ^ ;VgTEVtasv 3|  as3v  h [ |  t U   0 ra3s A ?*a)se`PpN3g A r e4PTZ c " A | Z c " A | CT 5aoc l " Z ac l " Z /o!hhydRY @3PU3PCU39'D3PDF@P36ykmS^"3+. +.)  B 5 @",@2 =}Hebe}"2POY 2OY 2NXBDpNX(DpDD$A4yeyeR>BB:,?? ^t}L}2L`2!22mJRYJRY+1BO  MRfMRf^ m c < ^ m < u % *7M% NuvaQM07< ^ 2 c 07 ^ < 2 c 5 < K 5 < K   l YuXuHX3ZAZ0Zh{ e/J:Jc|#LQ#LQ '[f [f'<A<A QnQWdnX]X]X](-(- @ t  [@   ^   z e x K o ^ x   $  :|@L $  :|@L$  [|@L$  [|@L[c[cw\N $ H  N { = H $ *   d z I   228K  w\  u u0s.FxhhxFU.,  r r '08:nnt ""4LBLR$R$TtTtTt)u)uTYTY)7DI)7DI[z)iz)szsz5'5s|T[ T[ m} t}0D=D`Z`q||$@<M R 1<M R 5 <  2(200o0o --8MCMYx Yx jv;Lzz 8@%.8@%y`lBM+LQ +LQ#  # &  hMT'8 s # s # *PQrC*1Qr$CEP_r1C_r1CJQ ,!,@ZOZxBItbDS 0EC 0ECC0~zzpsxsxjxjx, , GOQ,["$Td##%%%0%m$$##}%%g&&&&.L/40K000//L//040//1111V22|3~3o22|3~322{44r5599 ?I?99'?;;? @i??? ?Y>>t=L>_<<;U<`>>? @`>>? @??>>>>;;??i??? ?t=;>o<<;;;;??i??? ?>;>=>==<<;;==??v@@=ANAGoHHHHH H=HHHHHLHoHIIJJIIJJIIIIIILJjJ~JJKLLPcPOPNOMNMMKKLPcPPPOONONNoNyN6NdNN"NMNMM$LLK L(KKLPcP3O[ONNNNMM9KNKLPcPDO[ONNNNMMPMMM;M|KKhKrK  !  !    !#35BEsvLO`cz @ tev t!,etKT  yDf#+ ||||'W*W*.lNY`b`bLp(,,, RTFFu|BP'BP'"`p_"`p_*3*@&(&(*@&(*@*A$p\\,8KT`~X_r02 (:(:@O/25;/hp8X8L0DL]GI$9;57HO`d"*8 *8"8^8EZ^VXT8(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3>% Xto*v|u(Sb>CSb>C % bexXetoXeto3 L u*vCSxjX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)03.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'@-@ 5F@F|?TW@TGF\W@\GMdW@dGRW@GL$ X{@kP ]kufA|uJ~(P, NM `%r0<@G`Xq @&P@@@@F@TW@\W@dW@W@ {@     TW@\W@(F@;dW@H@^{@ mW@ t@{@ XW@`W@PG@dW@|@P@!@L@-|@/@;&@O;@G\@ RY@V_ @1q|@ x| @#|@ |@  |@ @@@ |@ |@ |@ |@ $X@ @%.6|5@gH5@\dM@v(M@JtM@CM@LN@CO@iN@?P@fP@P P@yLQ@2@R@BxW@Tt[@b `@sf@@}@8 y@1$}@  }@ z@K@ @m~@ }@4 p@'}@4 0}@ C@U@=h@Sy8@(@;@7}@ d@X@#l@O@Y@7H@ + ~@4 8@<@nPT~@ ^Լ@ h@s@X~@ \~@ @@4@8,@n@-@J@^@q@@K$@`~@ &@,d~@  p(@~p~@  "-|~@ 72@P2@jt3@E`o@ 4@Q`X@ @T @T9@`:@@,p@ (B@B@C@,$@ 6?H|L@S[@m~@ ~@ @lP@jTQ@Q@U@U@# V@{ TW@ W@M- xf@< e@L V ~@ d 0i@s Pi@b j@k k@9 |k@= k@ k@ `l@ Lm@4 m@5 m@ tq@%& r@< lv@N @W @_ @p {@A  @ ~@  @$ ~@  X@;   <@  @ @@ ! ) <@4 X@OF @XY ` m w @@  x@  @, @W  @K   @ ) @-   \@l* @u6 h@MP @Bb k t  @   @ |@  ,@?   X@ t@ 8@ @/ @< H P @d 8@r    @9   @J  ~@ @e    0@J 1@,6C7@Q:@^d/@PilA@tA@qhB@IB@+B@R4C@IC@C@C@&C@dD@TD@@E@Y,E@AHE@ XF@kF@|F@>PF@(G@nG@$H@UH@I@I@J@L@N@$~@ )S@9T@J V@TV@]W@-n.@yb@0c@c@H@"d@+.@j@"j@l@Vl@thm@;$n@-q@$;r@JPs@Zu@hw@~.@@8@C@<@@ @y@/8@e@@@'@4@D@R<@bę@rL@d}@e@q@`@~p@t @~h/@l/@ /@ 0p@;~@ F~@ N~@ U_~@ c 2@@lv@@,@@@Lq@ <@L@5@O @O#Ⱥ@21;d@EMd@)^@p@`@@q@( H@65@@@#@2@3 @0<@0l@5@Z@:<@@@*@9@@C@Qp@*[@:f@Cq@|0@4@y@  H@@@(@d6@8@@fD@`y@ ~@ @`4y@ =~@ M@aXh@PfX@p@{X@n  @? D@d@~@ y@ ~@ ~@ ~@ ~@ ~@ "+5@_D|6@N6@Xby@0 tz@  @ @ (@ 0@ @@ L@ 8@ H@ P@ @! {@ -6=GQ[hr{d@ l@ h@ e @i @,3 @I<t@ SXbx@ n@gx~9@@{@ `{@@ |@ @ @ @ @ {@ {@ {@ {@ )2@  :@ B!@Kp@aX@ că@ o}@ @ $@K %@R{@  .@@  @ 3@)1<@@ O[d@ pvP<@7E@'F@ F@   F@+PF@PP@#+0P@9CNV @ ahpY@q(@ z$@  @ ,@ k@E0@ E@`@@$ xE@tE@D@ ")0:JQbq@yd@ h@ l@ p@ .@@bk@0 @0S@N`@)@>T@ T,@q@@\@z@@-0@ p@Q@%@p@B*@A@T1@:@ @0L@b@<@ h@v\@/@Ա@&m@@ 2@@e@ @  @( @1 @`? @T I@l @O@#s J@ |@& `@" p@! @ @@ 2@ @ @ @O @  @!4@!0 @-!@"y@3"@E"P_@UL" @OV"@*p"02@"H@"@H"H@&"D@("@@%"5@0#1@ #@9#/@%#|@rF#@LP#T@Fa#@Ym#t@ #@#$@ ##@Z#@#@^#,@#@9# @($@$C@'$`@2$:@L$h)@h$T@+w$T@$0@$<$@$@$8@ $i@$,@%@e%/@3%h@.K%XH@ [%.@ a%T@t% @hy%Tl@%@Z%4 @E%@% @% E@%@%@I &@f&v@'&@F1&p@8&@WX&p.@_&S@=u&@l~&@&@ &0@r&@&@&@l&2@&p@&X@+&܀@c'@2!'S@&'K@>':@+M'l@l^@h'[@|{'>@'Д@V'@'@{' @d'@U'@Z'O@;(,@  (-@ (`@c5(0@;(P@[Q(@?@f(O@!m(I@h(pb@(й@r(@M(@E(@(@(l@)h"@Z)@()@:) S@ ?)t@H)P@ [)@b)@k)@})@)@@ )W@) @o)@5@")@K)`@T)R@$**@"* -@q*x@ *4@&%*T@k**`"@/*@7?* @:X*P@`* A@y*1@*@*1@*p5@#*@H*Z@a*p@*t4@#*Ā@*p@?*W@ *\@H+P@+-@+@,+$@ 3+@ U+4y@i+@?q+8)@/+ԧ@ +@[+@"+08@+`@+8O@+$@+J@,7@, @-,@!5,W@ B,@G,@^,D@s,T@,6@,p@4,@,@,@r,{@ ,X@1,@-$3@(-,@45-w@I-5@Q-HM@:e-d@|-p@u-@@/-h@N-@-J@-pZ@x-@$-@- @.x@ .@=$.` @:.l@W.@!s.@].P@.@%.(@H.@`.@.@.@[/@ /`@_/&@t/$@4/@I>/Q@P/p@g/p@x/@~/|@/@ /@0/8@'/@/X@o/Y@-0h@0P@0ȷ@A80 @A0`.@G0p@ T0`@ c0@@>w0P@20@/0P@0Xn@0@_0@30&@0@1@ 1@[1@@B11@ A1P@H1@m_1.@d1:@Ay12@%1 @ 1P@91@1@1@51@2e@2@)2@$2@;2P)@ P2,@i20U@jt2 @ |2@32G@D2Њ@*2 @2@ 2\@=2@2`@)2~@ 2I@3`'@I$3@$/3xT@4A3@F3O@]3@ j3@ }3/@E3@u3P@!3J@38/@3!@I3@3@G3@@ 3@f 4@4pH@+4p@0<4@<C4E@T4@If4@V4p @4@&4@640@ 4@34.@ 4 4,@\5@5@G5(@[15@+?5/@qT5@g5@ 5D@50@ 5<@5$#@^5dW@5\@z5l@j6`@l!6,@ ?6@P6{@ W6h@0d6@@9k6dz@|6@@6j@'6@6y@6@ 6g@6 3@#6HN@7P8@D7@,7.@ 27@F74@h[7@r7L@Q7@97$/@7p@Y7P@7@F7l@h7@@ 70@7(@.8W@8@ 8@ /8@R48 @W;8'@@8T@?\8:@v8\@8q@ 8@n8@ 80@8@K8H@ 8L@#8$@9@+9ܢ@19W@89S@<J9i@b9@s9`@Q{9@ 9 @_98T@=9@9p@t9p@&9P@'9@9(@29 A@:`T@\:@V:@1:8@V;:E@K:w@_:0@}:dH@ : @1:P@:K@:`@7:P@d:@ ;@";@%;T@2;l@VO;@(@ V;-@[;P@!b;ܞ@ y;(@;@r;@; @;@ ;@;@ ;_@U;8@<`@W0<ē@FM<@e<p@Jl<0@v<d@<#@Y<p@!<@0<@*<@o<-@"<@<4@X =P1@=` @>&=@c@6,={@8=*@;?=@I=@P=@U=lb@ e=@D{=t!@h=1@=|P@*=l@=@n=[@=\W@=@ >@>>~@ &>t@A>`@+W>(P@'s>&@>W@><@@>y@a>`[@> @&>S@>@ >@?>,@>N@|?1@1 ?@%?p6@ -?P@D?@L?`@ Y?H/@8q?@?K@?@.? @?p@A?T@N?L@4?@?@@0@v@@>#@j@*@t@ =@xx@N@@@[@8X@ m@t@)@@W@@"@@c@@@E@!@@@@@I@@@|@C@@@/AP@!A,@BfUE+vUEvUWVS Ɖϋ@u,Fu%ӁFt*9^ u@F1e[^_ÍvF,e[^_Ëux$ VTRjQShVP uF^ 1e[^_Ãt릋 5L.@NPh@jVӸ zfUE1UE1UEfUEfUEfUVS@]u 9s sBuBEPs蹊;uw<-tyEC 31e[^ËEt;C,e[^ËEuC, uVh@jS C, s Vhp@jS C,fUWVS }mrtBJ1e[^_ËBG Zt*fB sV$VZu؋_taW$~/11ۃjjjjG(PWF 9w$LJG$G(t PPVG(@ jjjjhW {t RV PULJ1e[^_ÃGTPjjjhWG Ph@jWUWVSÉUMpt(%;C tEEe[^_fu}|VE;CT}NC$~#{(U9tiw 1 v M9tUB9uQh@jSEEe[^_à sTuh@jSE Ee[^_ÅtWtv%BGE@C,E-U jjjjMPSRE C$~4@s( }襋C$HC$uC(t PTC(EPh@jSEUS]E P1sT1ɉ6]ÐUS]E P1sT ]fUS]E P1sT]fUVS]t SCt  P!SCt PSCtv PzƃC(t PRC(]tf} f]tXډ@t]؁}uߋUg@uлN؃,[^_û؃,[^_1ҐUWVSLÉUME1sT@ME1sT @U1} UUt$@}ЭuFUUu;fuVuUME‰ƅuJAPuVjuUMue[^_ɉ ƅtfE1sTtPh @jSe[^_1;:U+E1sTtUS]E P$U M@]ÍvUWVSƉӉϋRKM;HT1ECECEu'K U4@SC1vTM@t]EvS@t8S9CFuŋNutCK Sye[^_ÉűErSz@tCS^K S"ECEMAMK9NTv]S uVPCE;FTPh @jV6'Ce[^_F,1/Ph @jVvUWVS,u] tD.@H.@Ve[^_ǃǃǃM܍~}䋓EЋuEЉ~e[^_Ph< @jS؍vUWVSLEEEEljUMUEfMMEP^ƅ]UŰEH P/Eȉu]č]ỦUEt!uuuuuWU  Ve+M؋UiÅ_UxMEȍe[^_ËUJ Ru#EPtRhp @jWUEEȍe[^_à V*UՋEPu]ȃ V*TPh @jWfUWVS]u11҉Ste[^_C VMU Ke[^_ÍvUWVS]@ߥExuptQuu udƃe[^_úEtރ SMU EwƋE UWVS|]}uCuCtC, e[^_à E PE1sT@C}U MMEPuEtUD29E>C,{,u }wC, uU M EP,EIQuu u2.ExE1sTM@UEԉEfUԉUM@}u;}wӋUUEE܉uEEE&M-@ uVuURSP@tc1Et u'E1sT! uU MC,EE@tދtU@}@>PUEUE|M캨@UqE1EEEԉE3Ut9v=UU;ENjEEUUԉUMԉ@t:E9EvUP us SPEUUE}ԋE1sT@oEE܉uEEE&U@F uVuURSP@$ME1sT@C,@P jC @PSR K TU!)ʉUEȉC %Psx+C1|EES +UM@fUUE(MU@UUЋM MЋE E̋u `} 1wT*ŰEMЉHEe[^_u 5L.@UPh @jVӡD.@H.@}W } M܉}@tMME :Åt5EM9ɉމu$ SU 1ۋE Et+ STu tVt S%D.@H.@}WSh @jWWh @jVE ǀ,QfUWVS,u;Åt ؍e[^_ÍvM-@uhX@ZM1ۍ}9E=fE܋M RPPQhH @]܋M؉M t] RjWQV @ug؍e[^_ùG؍e[^_1PSSh @袋Ã؍e[^_ÃPh( @t؍e[^_ÐUWVS,Ɖ׋XTte[^_ÐM1ɺ@t ]uv~e[^_ÃWho@܊]tf RjURSV @tm uuuuuuSWh @茊E؃0Mډ0@tNE؃U9tQPRh\ @W]ԉ]vASh @2E#Sh8 @]ԃ뼐UVSuFTt1ۍvډC9^Tw hx@^e[^wvUWVS\]EwzBuMrOruSttB;G}܉Auڐ]u1҉Ѓ[^_ÉU뻋Mt!UEދMA @A BЃ[^_É}ڍvUWVSE׋EU EU}E]UZ ]J EșMȋ]eÉ_wjVSw 11 t_L.@t*1ɋ]StVPQuuuuS҃ e[^_ÐE+ϐUR Uk]ۉ]EH XPuuw<9Et %+1UWVS EUωӃE1 vFt>C ttc C t3jC1RPUEtEFuÐEe[^_Àc 뫍vUE8+uPX:+t+1\+ÐUWVS lj։ˋEU EUA <t'C C USF @F Ce[^_Ív1jA1RPvUWVS,u }E8+PXU؁:+tE+E܍e[^_f}EXEE~̋UUE7vPUr u3C E׈C UB MtEEPEXu]WVًU؋E뛹U؋EE܅;uuWVU؋EE܃E+uuWVU؋EE܃ UuuE 1RPuÍvUWVSE׋EU EUEUEP UEUB Mȋ]eÉ_wjVSwm11 thL.@uKE+11ҋE)UWPjRUBtQSVuuuuRЉÃ ؍e[^_f붋UډUMvPuuwm99Etx Ɖ»$+넻$+v1UWVS,E UEȉŰU:+MIXMЁ9+t +e[^_Ã}huSEE4QMq 0uWMEUE@ EԃEURUȋM̋E[u}>]ȋũEvE؃M9MtU؍DPډEZtuuuuȋUЋE"E؅eEȋUEfM܋\Ɖ׃RPًUЋE Ep u3ZUR UE܃M9MuEUEH1EŰE)EE1e[^_1ɋUЋEquuuuȋUЋER+HEfUuuE 1RPuÍvUWVSE8+umXX;+uUP@u u/Et(WjEPuщƒE8u SKy G+e[^_1v+e[^_ø+UVSE8+ugXX;+t+e[^ÍvƅuPjCE u s~5x%Puus59Et%+멾+뢋5L.@fUVS@ X1fCCc tE Pw EFue[^UWVSB Z1vCCc w h tEFu1e[^_øF+e[^_ÍvUWVS ]} ;+uSsX>+t+ [^_Ð9{ t+1ɉ4u{ ؃ [^_:f1 [^_ø+붍vUWVSu>+u3^X;+t+e[^_fFHF~1e[^_ÿ+1ɉډǃ sB/x_LFXE PEFXFt FE PEF VX=L.@UWVSUc j` Ã5Pj`jS+$ ƃ` @C 1}Q ECuPRsXC CCC hjVc+džvǃubE E t Ps3Fx\Ee[^_fF+ Sre[^_ÐF+t VKfF+e[^_Ë=L.@ο:+뷐UE U|#~L.@Ív=wRuPus1ÐU @UU @t  @Ð @8f@U @ @8f@UWVS Eu }UUt&5,@P-T5,@jjhh@R uBtPuW5,@>G5,@jjhk@wR,@Ee[^_O,@ V^ZSPSZY5,@j TU @tEEPuu uf @8f@U1ÐU1ÐUSf=H!@y]f hn@ ƒt:QjEPRH!@E8tH!@]fL.@ufH!@̀H!@=t889t1L!@xh@h@QWL!@V889u h{@2 th@P WL!@듍vUVSut e[^ËD!@t NC9HuB9Ht=ӋuH!@t vVPh@5L!@nE e[^Ë RH!@u 1e[^à vVPh@5L!@ E1 e[^ËD!@뮐USj ÃtIu(ECD!@D!@H!@u+1]à SwL.@]f]f EpuPh@5L!@zD1 ]UE@EVfUWVS EЉU)ЉEu@!@t6J]A%9u2JA%9uD!@t(J]A%9E;AP!@@ߥf u$^_PS 1fǁO!@ =P!@P!@vA9u}cQmE)ӍS0A)EgfffEE)B0A)UE0AP!@e[^_ÍvJA%9uE;AUe[^_à RQ8uP!@@f} {SP!@USUl!@?t @Cul!@[ÐU]Ít&'U]]u}CvMsV tRx!@Ѓ|!@%=t&ftt]u}])믍t&!@!@֋~t11҃9Љw~N1)=!@!@A)AVF ޭޅttYPtOAtU!@fP +PA +A9R !@G!@!@]u}]ËVfQ맍v9 !@tQ9 !@t=tABAtA 1)!@!@A $ D$x!@뷋A!@륍'U0VS !@ !@ @ @9s։ D$ $xۉt11҃9ᆳމw1 AqA AA!@!@[^]Ív Ft&P|^~ @t&9t&wv|.~5 @t& @t&w0 @vwv|ލ~ @t&!@!@$&UWVSt&!@!@EEEhMtы!@! !@5!@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5!@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf61hfL QA UQEyACKGDGE1ҍY!@!@ڃt )ÃfC[^_]ÉE}tETF^05!@E;11FKAA y]YEAGDGFE!@GG@ GG@GxUGPGMHGDGE1!@!@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0F-CP X9<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Íx!@Ѓ|!@%=t ftu!@!@=1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUVS]utU t&tu[^]Í؃tu[^]ÐUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$tt$|$$5؋u]}]ÐU1M9t :u)]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]W&UWVS ]} &$ qu+1-1`@.tn|B< v5؍v؍ftt [^_]fƒ0P$%d@ٞw…u, t&z롍& `@ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$ou<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$nHAEEs{xC{$>nEE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& !@t;=%@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$W1 f?[D$E`.@D$U$suɍFD$ ED$E<$D$Uh.@FD$ ED$E<$D$%@v'UUE !@U]f.UW V`.@S1ۃED$D$$D$ED$E$ft&߃ t;>t[`.@D$ED$$ru˃1[^_]Í& tED$`.@D$$E h.@[^_]Ív'U,$@%@D-`.@&@ =/@uÐUWVS }1=v%@t$$nt&9{u%@t$$n$ƍ [^_]UWVS }1 v9{t+%@t$$nu [^_]t&%@t$$n$ [^_]UVS%@$ƋE%@F%@11&@;Fw%@\$$|mu%@\$t$$nE D$F$\^[^]o%@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$.\$D$D$ E D$E$l![]ÍUED$E D$ D$D$E$1! UED$E D$ D$D$E$ UED$D$ED$ E D$E$ U5n%@ @%@Ít&UWVS,EUMI=%@G%@%@ Eu&)ċE\$#D$D$$?ED$ED$C$E\$t$ |$D$$t&1 &%@\$$ktF;~u%@\$$kE;u|;~t)&+bV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$+$#]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEz%@t`$É0E{C<$|$ƋE4$D$*s \$%@$j]u}]%t&뙐U 0]Ít&U j0]ÐUED$%@$&h1tÍv'UED$%@$g1tBÉ'UWVS }1]v<$D$Zt&%@t$$guԃ [^_]0$&C$$%@t$$gUWVS 1t&<$D$t.%@t$$"gu [^_]Ðt& [^_]É'UE1҅tPÐt&U$h@]]uu1ۉ؋u]]Ðt44$9E r݉4$t$$D$&$4$E $7맍vUE]utoU1u ]u]ÍvE $e$ƋE $M4$D$E D$WE tC$e1s롸$tE$$E $$g҉CthtdE$D$ED$$E $D$E D$C$%@\$$g%@1$C$$U]]u$\$D$$h@o4$E؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&L.@eU%@$-cÍt&'UWVS,EEE EFEEE}&$EF$]]x;D$E$EED$D$EE$|$FD$]$EEEED$%@$clED$ ED$E܉D$E$EE,[^_]m'UWVSeD$`@$l@%@$} u [^_]ÐD$ D$D$l@$EtЉ‹@ tljB9s&<$<$D$tt$<$x4$nUDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&L.@獴&UU S]G) ʃ) 1[]Ðt&L.@獴&UU SG,Ћ] ʃ)[]ÍL.@䍴&UVSUMu t+@+@B+@Bt\1ۅt.L.@[^]É\$$+@Ht\$4$4u؃Hu1[^]Í&+@F+@F+@1[^]Í&1 t&Ht\$4$t\$$+@p֍&'US%@]uu%%@1[]Í&$ti@B$ @D$%@1[]ÐUED$ D$$1Ít&'UED$ D$$o1Ít&'UD$D$$&@>D$ D$$+@"&@t&@@=+@u%@ U=%@]]uu}} G~&L.@&]u}]Ív tՅt4&@&@C&@C &@C &@C1t&@G&@G&@G  &@G&@1rfKUS]=%@t=G( t#M &@ &@[]Í&[]Ív[뼉'US]=%@t=GH\$$+@u&@t$Ѓ1[]Ð1[]v빍L.@ U$nÍUEwE]1t&]Í&'UU ~ÍD$D$ D$D$E$;1ÐUL.@]ÍUL.@]ÍUWVS1ۃ }9~t3+@\$$\uL.@ [^_]f+@\$$[$#uȉ4$a 1[^_]Í&UWVS1ۃ}9~t3+@\$$[uL.@[^_]f} tr} t} ft"L.@[^_]ËF [^_]Ë]F 9t!tD$,@\$ D$@$^ 1[^_]Ít&]F9tD$,@\$ D$x@$^1[^_]ËE cF[^_]ÍUWVS }+@1 f9>tl+@\$$`Zu$>Ƹt>+@t$$2\+@>+@F+@FF t&F [^_]uL.@fU +@tÍ\+@,@$,@$,@$Ðt&UVS+@t519pt#+@\$$_Yu[^]Ít&[^]bf&'U(Eu]}t;$!D$4$NjED$2"t.]Ћu}]fL.@ލ&Et$ D$D$E $"D$|$4$!څt떍t&U(Eu]}t;$ !D$4$NjED$!t.]Ћu}]fL.@ލ&Et$ D$D$E $b$D$|$4$!څt떍t&UE]uu}} #tEt$|$$ t]u}]Í&]u]}] t&L.@ÍUEt&D$ ED$D$E $!ÍL.@Í&UE]u\tVD$ ED$D$E $8#t]u]Í$XuL.@ӍvL.@ UE]t&UVS u ]00 D$f@$(&0$8ft^ErtDaDED$$%t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$f@$h%@L.@됍&15D$f@$(%uLvEwfvEwE+D$@$$v$L.@UE D$RD$E$0ÐUS /@u!@tr/@B!@/@:#!@8 @U::/@D$@D$,@$?[]Ð!@E /@;] !@}A!@-t!@m@[]QA!@-/@ta7D$-U!@m@$t/@-1&?[]Ív!@t&y/@D$E$x:t,!@/@8u!@/@[]Ív!@8uh!@9E!@PE:!@m@8: @D/@D$@D$,@$V?U /@!@m@bC!@U]ÍU1]É'UL.@]ÍUL.@]ÍUE D$'@D$E$1ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$?<É'U}׉$]ÉuD$4D$5G!$D$D$$,$D$t$$G G1G,w, O0tAG0G]G+@u+@G}1] US] D$f@E$t[]vL.@[]Ít&'Uuu]}} D$f@4$t%$]u}]Ðt&4$>tI$1Z>D$4D$<$GAGG+@+@GL.@농v'U(]]}} u$|$t]u}]Í&$D$.@tԋG G\$ D$D$$KG0G$두U1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG+@\$$KNuL.@ [^_]$1@:ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f+@\$$MnU;uݡ+@\$$M [^_]fUED$$D$Í'UVSu1 t&;0tk+@\$$ Mu$ D$_D$>@$E@1D$ 93CC+@\$$N[^]^&'UWVSE}}Et[^_]1&;8t +@\$$bLuމ<$1ۍt&;>tV+@\$$*Lu1D$ D$D$>@$E@9UFF[^_]f뿐U%ND$@$X@+@ÐUL.@]ÐUED$a@D$@$+@D$ 9+@U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVSbF1ɉ‰EE#E$DËE$;CStdfuC.C E\$$E11vD$xE$CtXC$ƋCt+rǍ&CC뗐t&$z@Ɖ떍F$-EE$BuE#&tcu :F/<$褿mED$E$Bt8_4$\$$1ƋGu/볍&|E$CE[^_]Í&$(E$AD$E$kB8$F@@E$A\$D$E$CaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$ҍUUE $T$E ÐUL.@$}@D$ED$,ÍU,@$Ít&'U]&US$,@]t$D$ $É[]Í&]ED$$*6؃$[]fUWV1S }',@$st4$ t7,@$t7 [^_]f,@$u,@$t1fʍ&'US$,@]tE $D$ $É[]Ít&]ED$$J5؃$[]fUS,@]U u$T$5؃[]Í\$D$ D$$ []Ít&US]$\$$t,@t$ 2[]Ðt&D$l@$|4ؐt&UVSD$f@$@ wD$ D$D$4$5 Ƅw,@D$D$@4$$,@D$ D$D$$D$f@$@[ )wD$ D$D$4$ Ƅw,@ZD$D$@4$6$,@D$ D$D$ ,@$D$f@$@ wD$ D$D$4$ Ƅw,@D$D$@4$,@D$ D$D$$$cĠ[^]Ð,@,@@,@Ġ[^]Ít&D$@4$ ,@vD$@4$ ,@*D$@4$ ,@U1]É'U]Ít&'UE@1] U]A&US]U taҋCu@CC{%t't#9t$t&賷1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$@F$Ɖ]u}]Íu \$KS<$!/C $6/U|$T$$胿\$ D$D$@F$tƋC $/뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$4$딍US$]u$[]Í&Ct$ELED$ D$D$@C$zD$Ë@ D$E$^C $s$kE뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+1҄u뱍vC!C$뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$9$wt&tyvC!C$辱:vK9Crt$ED$ $osY&{Cft$ED$CC$2sv'U]]u$U $D$T$ D$^$ĺ]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;(.@v/$.@Eܣ(.@$)$.@$!) .@$.@EED$ D$D$@G$RË@ <9}sE<D$ .@D$E$!C $6$.,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$C_utRu4ttG!9u܍f]v֍ovɍt͉$vSG!9uIvvE<$ED$ D$D$@G$Ë@<9}sE<D$C $'t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$/ )čt$<$9s@a<w%$@vЃ|+uf<$յ9rE1ۉ$ĵUT$D$F$˵E$蠵t$ D$@$D$U$贫w t Nun1ۉ<$蜫e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$ʹ$RFU$T$0$&4ËFCFCF C FCFCFCFCF C F$C%C$$D$ D$$D$C%4$ov'UD$@$@Ít&UWVS] D$f@E$~C$ D$@$N84$t$ D$D$<$uN,@D$D$@$4$ $L.@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$11[^_]á,@D$@$%L.@e,@D$`@$L.@<,@D$@$4$ L.@ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$X@4$袰]$t$D$ D$D$$O$wf&'U$~ÍU,.@tED$,.@$-,1Ðs,,.@uL.@É'UVS1ۃ,.@uu!&Ѓ,.@\$$)uu[^]U(}}EU u1]]EUt\$t$ $T$4EU\$t$ $T$U3]u}]ÍUWVS,E ]E(@E܋EuE@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$$~8$t 1҃[]f[]Ít&'UWVS$;1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&U(E E @E@ED$ED$E$LÍv'UE D$E$ÍUuu ]]4$薙9~tu ]]u]9u EUE $ÐU}MU EtÐD$T$ L$D$ @,@$AU $]t$u |$KA9rS׃r9w)uD{t&$t$|$]Ít& {܍UVSE0uEE] EuD$E]E@ED$E$x9v0[^]Ðt&UED$ ED$E D$E$zÐUED$X@$Ðt&UED$[@$w1҅t $U]w&UED$X@$71҅t $IU]W&Uuu]u1ۉ؋u]]Í&4$u$t$ D$D$É$"UFu u0]ÐUSD$ D$D$^@$t@ MZ$؃[] UED$g@$D$ E D$8ÍUWVS E}D$@$!U v2t&D$@$U 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$ t<U$ Ɖ<$蚕9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$|$\$E$\$4$ ËE$]؋u]}]Í&'US]$\$ D$p@$D$[]É'UWVS,]D$@$EU)čD$ET$\$$UE$EtD$$Ue$}$y@$)č\$t$$脓D$~@$2EE(&D$~@$e܅e܉<$謓UƍD)č\$|$$ 3/ED$D$D$$u$X$݌E\$1ۉ$輒e܋EetjU$$ƍx@#)ċE\$$D$聒U TE$/\$ |$D$@$t$e[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$@]$$@D$D$@D$P$@$UT$D$$*$@D$\$D$D$$D$ -[]Í&U($@]uu}袑4$蘑D$$@~$D$@D$芑4$b$@TWT$t$$^$6\$D$D$$D$ o]u}]fUED$ D$D$@$ÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$@C$襠$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$(D$$FFF D$D$$ta$8EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأL.@EE؃<[^_]ÍvEEL.@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$\$UT$M܉ $D\$E$FU F$E] UMV~HU1fC D$CD$EE$MC K9}MƋVT$D$U$薋F D$$ 4$蕁UE ]u$tD$E$^$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-L.@ [^_]Í<0C Error while determining whether %s is mounted. e2undo should only be run on unmounted file system Failed to read the file system data The file system Mount time didn't match %u The file system UUID didn't match Replayed transaction of size %zd at location %ld fFailed tdb_open %s Failed to open %s Failed tdb_fetch %s Failed write %s /proc/swapsInvalid error codetdb_unlockall failed (%s) tdb_lockall failed (%s) tdb_unlock: count is 0 tdb_reopen: open failed (%s) TDB file lock failed in tdb_expand flvalfreelist top=[0x%08x] hash=%d freelist:SuccessCorrupt databaseIO ErrorLocking errorOut of memoryRecord existsLock exists on other keysInvalid parameterRecord does not existwrite not permittedtdb_brlock failed (fd=%d) at offset %d rw_type=%d lck_type=%d len=%d tdb_transaction_lock: failed to get transaction lock tdb_rec_read bad magic 0x%x at offset=%d tdb_rec_free_read non-free magic 0x%x at offset=%d - fixing tdb_rec_free_read bad magic 0x%x at offset=%d remove_from_freelist: not on list at off=%d tdb_oob len %d beyond internal malloc size %d tdb_oob len %d beyond eof at %d tdb_transaction_cancel: no transaction tdb_unlock: list %d invalid (%d) tdb_unlock: An error occurred unlocking! tdb_reopen: reopen not allowed with locks held tdb_reopen: reopen not allowed inside a transaction tdb_reopen: munmap failed (%s) tdb_reopen: WARNING closing tdb->fd failed! tdb_reopen: failed to obtain active lock tdb_reopen: fstat failed (%s) tdb_reopen: file dev/inode has changed! expand_file write of %d failed (%s) transaction_read: failed at off=%d len=%d tdb_write failed at %d len=%d (%s) tdb_read failed at %d len=%d ret=%d (%s) map_size=%d tdb_transaction_recover: failed to read recovery head tdb_transaction_recover: failed to read recovery record tdb_transaction_recover: attempt to recover read only database tdb_transaction_recover: failed to allocate recovery data tdb_transaction_recover: failed to read recovery data tdb_transaction_recover: failed to recover %d bytes at offset %d tdb_transaction_recover: failed to sync recovery tdb_transaction_recover: failed to remove recovery head tdb_transaction_recover: failed to remove recovery magic tdb_transaction_recover: failed to sync2 recovery tdb_transaction_recover: recovered %d byte database tdb_open_ex: can't open tdb %s write-only tdb_open_ex: tdb_new_database failed!tdb_open_ex: could not open file %s: %s tdb_open_ex: failed to get global lock on %s: %s tdb_open_ex: spinlocks no longer supported tdb_open_ex: %s (%d,%d) is already open in this process tdb_open_ex: failed to take ACTIVE_LOCK on %s: %s tdb_open_ex: failed to close tdb->fd on error! tdb_alloc_read malloc failed len=%d (%s) transaction_write: failed at off=%d len=%d tdb_transaction_start: cannot start a transaction on a read-only or internal db tdb_transaction_start: nesting %d tdb_transaction_start: cannot start a transaction with locks held tdb_transaction_start: cannot start a transaction within a traverse tdb_transaction_start: failed to get hash locks tdb_transaction_start: failed to read hash heads tdb_transaction_start: failed to prime hash table tdb_lock: invalid list %d for ltype=%d tdb_lock: lck->count == 0 for list %dtdb_lock failed on list %d ltype=%d (%s) tdb_free: update_tailer failed! tdb_free: right read failed at %u tdb_free: right free failed at %u tdb_free: left offset read failed at %u tdb_free: left read failed at %u (%u) tdb_free: left free failed at %u tdb_free: update_tailer failed at %u tdb_free record write failed at offset=%d tdb_delete: WARNING tdb_unlock failed! tdb_next_lock: loop detected. tdb_next_lock: On error unlock failed! tdb_firstkey: error occurred while tdb_unlocking! tdb_traverse: key.dptr == NULL and unlock_record failed! tdb_traverse: unlock_record failed! tdb_nextkey: lock_record failed (%s)! tdb_nextkey: WARNING tdb_unlock failed! bad magic 0x%08x in free list entry offset=[0x%08x], rec.rec_len = [0x%08x (%d)] (end = 0x%08x) total rec_len = [0x%08x (%d)] ERROR: failed to read record at %u rec: hash=%d offset=0x%08x next=0x%08x rec_len=%d key_len=%d data_len=%d full_hash=0x%x magic=0x%x ERROR: failed to read tailer at %u ERROR: tailer does not match record! tailer=%u totalsize=%u tdb_transaction_commit: no transaction tdb_transaction_commit: transaction error pending tdb_transaction_commit: locks pending on commit tdb_brlock_upgrade failed at offset %d tdb_transaction_start: failed to upgrade hash locks tdb_transaction_commit: failed to get global lock tdb_recovery_allocate: failed to read recovery head tdb_recovery_allocate: failed to read recovery record tdb_recovery_allocate: failed to free previous recovery area tdb_recovery_allocate: failed to create recovery area tdb_recovery_allocate: failed to write recovery head tdb_transaction_setup_recovery: transaction data over new region boundary tdb_transaction_setup_recovery: failed to write recovery data tdb_transaction_setup_recovery: failed to write recovery magic tdb_transaction_commit: failed to setup recovery data tdb_transaction_commit: expansion failed tdb_transaction_commit: write failed during commit tdb_transaction_commit: write failed tdb_transaction_commit: failed to remove recovery magic @@ @@@8 @\@`,@h @ @L2@ @@@@@@@@ @@ @offsetUnix I/O Manager: COMERR_DEBUGCOMERR_DEBUG_FILEa/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ A?CWDGET_ENVVWarnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c tyndurlrwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %d..:/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/create@@@x@@@@@@@@h@@@@@@@@@@@@@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZ@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@}@@@@@@@@@@@!@r@@@@@r@@@@@@}@}@@@@@}@@@}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@{@@@@__Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK telldir: Nicht implementiert IO_ULINKlwIO_LINK zR| ,'AB E<4_AB E @filesystem MTIMEfilesystem UUIDfilesystem BLKSIZE @+W@,d@Xc@b@`@]@[@a@a@pY@^@l\@8f@m@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@1@W @nPJpY@: [e@G\e@02`$g@`dk@9ek@3mt@Qn`t@<Dot@.pt@>pu@-yq@u@JLru@su@tPw@ u x@Yy}@|p@1~P@gH@!@Ma@@y0@m@;@#@ՠp@7@f@n@07У@d@@ P@A@|@@*Э@@@P@(@@$@@?@x@B@@ @f 0@S+@@D@@@@`@At@p@KT@@9@ )@]P@9@,@'T@_Oj main mtime_key uuid_key blksize_key prg_nameG#ext2fs_check_mount_pointext2fs_check_if_mounted6a ext2fs_tdb_error ext2fs_tdb_errorstrext2fs_tdb_increment_seqnum_nonblockext2fs_tdb_name<ext2fs_tdb_fdjext2fs_tdb_log_fnext2fs_tdb_get_seqnumext2fs_tdb_hash_sizeext2fs_tdb_map_size1ext2fs_tdb_get_flags_ext2fs_tdb_enable_seqnumext2fs_tdb_set_max_deadVext2fs_tdb_set_logging_functionext2fs_tdb_get_logging_privateext2fs_tdb_unlockall_readDext2fs_tdb_unlockallrext2fs_tdb_lockall_unmarkext2fs_tdb_lockall_read_nonblock'ext2fs_tdb_lockall_readUext2fs_tdb_lockall_nonblockext2fs_tdb_lockall_markext2fs_tdb_lockall<ext2fs_tdb_transaction_cancel$ext2fs_tdb_chainunlock_readaext2fs_tdb_chainunlockext2fs_tdb_chainlock_unmarkext2fs_tdb_close.ext2fs_tdb_reopenxext2fs_tdb_reopen_allAext2fs_tdb_transaction_recover>ext2fs_tdb_open_exext2fs_tdb_openi ext2fs_tdb_transaction_startr!ext2fs_tdb_lock_nonblock!ext2fs_tdb_chainlock_nonblock4#ext2fs_tdb_exists#ext2fs_tdb_parse_record$ext2fs_tdb_fetch(ext2fs_tdb_delete(ext2fs_tdb_firstkey)ext2fs_tdb_traverse_readQ*ext2fs_tdb_traverse,ext2fs_tdb_store.ext2fs_tdb_append/ext2fs_tdb_validate_freelistq0ext2fs_tdb_chainlock_read0ext2fs_tdb_chainlock_mark0ext2fs_tdb_chainlocku1ext2fs_tdb_nextkey1ext2fs_tdb_printfreelistU3ext2fs_tdb_dump_all4ext2fs_tdb_transaction_commit6tdb_null"Jubunix_io_manager [ext2fs_llseekf\_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hook2`het_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#dPerror_table_namee?%errnoQeinit_memory_managerfreeZmallocrealloccallocmostrncpyndstrcatDodstrchrpdstrcmppdstrcpyyqostrdupLrostrlensomemcpytmemset u9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoulYylibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerE|timer_cancel8timer_callbackytimer_register1~rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*Hnsyscall_psyscall_vagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsa7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill0=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatRmPlgetoptoptargoptindoptopt+opterr=optresetKfgetpagesizeisattyforkpipegethostnamei#chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat<ՠgetuidgeteuidgetgidgetegidGvwaitpid,waitXwait_child_addqinit_waitpidfutimenxstrerror'7Zrpcsend_messagenyieldR,io_split_filenameio_get_absolute_pathZio_split_dirnamedAget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"nset_rpc_handler#yadd_intr_handlerJ*a)vfprintffprintffprintf_putsn+fprintf_putc}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr# Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6_exit2abortGatexit{exiti 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintfF0vprintfcprintfprintf_putsnprintf_putc$a_assert;~]snprintf_putcvsnprintf!snprintfxPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read Bysyscall_timerdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name lio_seekV create_shared_memoryopen_shared_memoryclose_shared_memory +ysyscall_putsnqmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6Dnwait_for_rpcv_and_wait_for_rpccppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperdstrtollist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createtstrcspnostrncmp(TQd__strtok_r strtokomemchrrunlink)oaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4 io_remove_linkio_create_link__udivdi3__umoddi3fQ@@q@h"intXI5Lf7e~t](e 'eoy.Z%1H id2# (3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFz'H0I3B0c-vl3d@@k@@q<b7IY+, 3 t@@oh"intXI5Sf7l~t](l 'ly.a%1?id2#(3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % >?#e@# SAli SRZc,38lJ:bs   # # # #  #X # # # #  #$K #( #,2 #0 #4 #6 #8. #: #< #>" #@? #D #H #L #PU #R #T #X #Z4 #\k #` #d #hG #x ! # "# '#O (# )# -#x .# /#- 0# 1#w 2#  3#b 4# 5# 6#d 7# 8*#5 9# :# ;# <# =#~ ># ?#i @# A#  B# C#! D# E# F:#% %?*:Jk z| ` f ut 7 CJ# Da# E# F# E G #6 I: # K_ #V L# N_ #  P #$ Q #(z S #,4 U #0 V #4 B H `  "J# #U# $?# %:#  ,s#P 3# 4:#! 5:# 6#  7#Xp 8#\B   ; Eu <:# =:# >s# ?s#Js7::J EJ7::J  yz Ja: 7 J7 J 7:  J: 7:  J_ 7: @ J 7aa e J 7   J 7s:  J 7s:  z ^!t@@2( 6 ?^): tdb( (7*+A,JH-)-. a: tdb` `7b:AcJHd)dz:@@qf 0y:B0yf c{: {:twtdb| twkey}tw-}tw~73AJSy:`??Utw ( - !D "9 #0$O A%Z P$e _%p tw&{ % w' ! " #& & % tw& ?(:8y  V(\ ':(% Y:( tUS ) ( @S )n 9 @S ) I @)6?@.@5@@oh"intXI5Sf7l~t](l 'lv(l)l(l)l*l +l,:|-lp.l0zy.a%1id2#(3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 3$4`a#b#c#d# e#f#hg#@*i#k# l#$m#(n#,o#0 k z  % :fbuf cpyret: %]#@@!y!"": $A%fd&:(w1 :EQ@@ZPyP6  @nY@h"intXf~t](Ok"] 'Ov(O)O(O)O*O +O,3|-Op.O0]1yo`  =!#O "#3$4`a#b#c#d# e#f#hg#@*i#k# l#$m#(n#,o#0 >'    M  Fz9 G,#<H,# I# J#K|# 3  6  C        b   ;  h   ) >"?"#e@d#AA  #z# fd3#D v# 3# 3##3#$D#( #, #0!O#s # ##S#logM# 1#" 3#  O#C  J#  #Q3#U 3#z#\3((z3!.17OGG('v#z#9OO #} v#v#v#  O#O# \f\#O# ~ O#$ځ#(ہ#,Y ܁#0o#4lll] Q3#;O#;O# # offO# O#3# ? b##/ ## #>#3zv3b3vO3333>333dP?    9#}<J#%C[ # C[ #  H3#cM3#Pv#YEB  C#6C#G,[  -[ # -[ #w.#/v# -0"#  > @ @ tdb= Q @7 @ tdbPiROg38 @ @c tdbeH we! f3!Gf3!S f3lenfd"flh'reti3f3 @1 @, tdbeX!;e3x x34 @} @ tdbwrety3q23 @ @ tdb1>off1\ O3 @ @oy tdbNoffNiP#;QOQz @I @ bufz4!B.ORiOp"p 3L @c @ tdb$ d @y @% tdbP3| @ @q tdb !w- dq @ $+  @- @S tdb !9  hO % @- @offO* Y30 @ @J 4 tdbv !w dq &offtp3 @ @ tdb !w; rec d  3 @e @ tdb !w rec  &rT$h @ @ +tdbK !9 v hO !3 @ @ xtdb  len + S  3 <3 @ @m tdb: w: ;3 G;3 S ;3len;d@ 3 @ @ :tdb wR vQ  v @@ tdb &el[ R# vn3@@5tdbaoffrec K  3@b@>tdb 4off ]!  # &i tp* 3d@@tdb( !w( .rec) L'g+ tx( @@_tdb ' tt$2 @!@tdb1 \$@.@<tdb[9f30@;@Bjtdbeo<@J@ntdbn3L@n@tdb~'t|s 3p@{@tdb9 d|@@1tdb3@@_tdb(@@Jtdb O@a@vkeyG#=+OiO$ d@i@tdb fmt(v l@}@Vtdb 3(+@@Ktdb 'Mz@@wtdbB3@`@tdb!;3)Yz3`@n@!Dtdb<3p@@Mrtdb 3@@ytdb,3@j@tdb!;3op3)Yz 3l@@'tdb3@@Utdb3@@>tdbA3@@jtdb&3@@tdbc3@@<tdbblenb;!S b3&std= 3@K@tdb*@@"el[ %)@@i3E' 3L@@c$tdb!Q3!;3ret3Ei3lckD)Yz *3@@atdb)key)( 3@F@tdbkey(W 3H@r@Ktdbkey(3t@b@w(tdbi(ret3g 3d@?@xtdbA&st =+6@ =3@@@! <3tdb>3@Y@1tdbF!B.f!3&buf1w,8"n+3"ret,3B-l%Z3\@@/tdbX[offX{bufXzKlenYvkcvY3el[[ +]@,P#_v23@@>tdboffbuf lenv9 3@@ tdb off bufzL!lenv!cv3!%4@@reto"3@ @5";tdba"!~ 3"#;")B.3ret3"+: @sx3 @#@2#tdbw^##y##i y#)-z"pz"$' {Otl&rec|D,xofsOO$lenO$. /tdb0K3>1/ino"ic #@8*@%!3%!~ 3%!~3&!"3'!o'! (! &)tdb )&st =rev38*#v3*vp"?+) O2+Y%@3#@#@T45n# 3]+6 '@F'@7'+7+%'@F'@83+8*@X*@+  ~ 3 ~3 "3 "X*@*@ ,mtdb8,!wl,lenv,buf", 3*@+@ - tdb5-key(t-!w-lenv-!l %.!z2.#-(^.#3.3%((z  I +@_,@.tdbG .keyG (/! G O/rH ^/'J tlC3`,@/@/i tdb/off0buf0lenv0el[ 1#[ ]1+0.@58 #v1*-@.@R )9 O,#-"1nO3/@I2@1 tdbN2+0@-3L2@n2@g2 tdb+ B.+ 3,I3p2@ 4@2r!tdb2!Q32!;33op33) Di33)Yzk3 4@94@3!tdb Q3 ;33<4@f4@4!tdbkey(J3h4@4@14Y"tdb]4!Q3{4!;34ret34 d 4@45@4"tdbb  5keyb (A5! b O5!b 35recc 5#e O5-  345@o5@?64#tdb k6key (6!  O6&rec \  3p5@5@6#tdb key (6#  O7 35@"6@7$tdb @7key (7 l  %  z# 7&rec Xret 37#  O7  ($6@6@8$tdb 28key (t8# 8&rec T"ret (#  O8 6 36@K9@8d%tdb5 8!w5 9rec5 -9#7 V9#7 9+ 7@+W 7@+ } 87@5P%&l[ P# \ :,0&rF P0 <3%/tdb;/off;"i=0/I3%/tdbH/offH 3L9@p:@T:&tdb :! :rec 9;# m;i ;'"  P3d%v9@9@ p&4%4v%%v9@9@8%;6%9@9@ 4%4%$ 3p:@;@;'tdb# <! # O4<res% 3h<&rec& P#' <+A :@,P# 2 <0  3j'/tdb 1  O"res 3) "rec  H 3;@<@<(tdbG <keyG (/=! G OG=#I =&recJ LretK 3=9'hW 49'4-',8E'=8Q'>:]'= | 3<@<@G>m(tdb{ key{ (s># } O>Uz 3<@>@>(tdbx >!' x >recy .?' { 3tp+ =@,) / T (>@?@b?2)tdbS ?"keyU (&recV TL 3?@JA@?)tdb @fn ;@! z[@tl {@&key (t@' (t&rec Pret 3@'; 3tH;out @@ % 3LA@A@@Q*tdb# Afn$  $ z&tl& \ret' 3SAQ > 3A@0B@qA*tdb< Afn=  = z&tl? \ret@ 3A0 t 3+/tdbs /keys (1 s O1s ("recu )v 0> c+/tdb 1  O/r 1 v) 0 ,/tdb 1 v/rec ) ) ) <  + # #}  v#) +2f  2 0 x,/tdb 1 v1 /rec 1 )2 ) 0<3,/tdb;1B.;"rec=)w>2{=)^! 30B@ I@A.tdb Bkey (HB  ( !+ 3B&rec L#  OB# Bp BCret 3C2"2 >* -4*4*7*C4*,:*8 +C3+OC@C@ .7J+ D4@+44+4(+,8V+TD9c+4+4+4u+,08+D?+?+?+@,D@@,E@>,x .4S,4G,4;,7/, E4#,,:_,8k,E9x, 7,E4,,:,?,@,E@,P?,/3 I@NJ@6Fx/tdb.bFkey.( .( ' 0OtX#1(Fret23F+2 PJ@,h)>"[- 3PJ@J@F/! , $G!, 7Gkey. (VG'-. (l 7 3J@K@nGk0tdb6 G!6 k0G# 8 H&rec9 P#: H): ret; 3H+n K@3%3K@K@9I0tdb$key$(3K@K@eI0tdbkey(3K@L@I(1tdbkey(A 3L@6L@Iu1key@ (I!-@ (I @ zm (8L@O@J1tdbl =J!(l (J#n O7K"keyo (&recp Tkq "`K0 3O@oP@Kg2tdb Kret 3sL# ]L)w # M&rec P0  2/tdb 1  31w "rec )y )  3pP@Q@2MU3tdb ^Mi 3M' tp"top 9g2 42424y2,:2L82M82M(Z Q@Q@N3tdb 0Ni 3fN0r33/tdb1w/lend);3="tv0s34/tdbq1qrq "elt[ ) uv)-v""pv")C wJ"recx ) y)y)z){O){O0P$34/tdb 1 !41 "q 1#4"rec%)C &J)'ve 3Q@nY@yN^6tdbN#C JN#q35434343,83O,?355"el2[ 9304343,h84O84MP?48+4P854aQ8A4Q8M4PR8Y4R8e4bS8q4S8}4-T9444444444,:4?484Tn6l 'D6@^6'}P@'@P@'* #4:#!5:#6D# 7#Xp8#\B;u<:#=:#>]#?]#   : k :  7  : 7 k : =  dT n  : nT  z   :   :    : 7     *  * U  ] : 6 z  ] : 7[d@bufA#eB#C:#DV# EV# LYM:#devN:#!O:#P:# wQ#ERY#BS#ipptrpB.ptrpppY@Y@T#)UE*kUAU-#USY@IZ@U-P#VeQ]KV`RVETVTtpTWiU::WLZ@X[@XWpW-#We]W;: Xbuf7*XB.vJXX:XAYZ@X[@[@BY}nY-~#YK:YEYAYgtpi:'ZQ[@\@EZI qZ-#ZAZ p\@i\@Z n'[-n#P[Eoy[eo][/l\@]@[` \e]7\;:\!buf7\-#\E]o;]A[]cp]%:]]@]@] "e^";:#buf7 2]@^@O^j {^-#^e]^;: _buf,_Ad_B.v__:6`$^^@uE^@`@T`2 C`eC]`;D:+a!bufDca-F#aEGaoG2 XAHbcpIObiJ:{bjJ:bB `@a@b "eb";:#buf a@a@/c [cc!argc-#9# :]# 4<# A=Z#! : ]O>]4`k  :-,    v  %92e@f@k 20(%0vfmt0'1% %   %E_f@$f@'l_DSlxFrl  P_$f@8f@lxQl8f@f@l2l(%v&mfmthm'%m9f@$g@m926(%7vfmt8:%m:8F k. @dr $g@k@oh"intXI5Sf7l~t](l 'ly.a%1?id2#(3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4Kkz u #z#:#    %  #{#   ul Q:$g@+g@m \:,g@3g@*n?Farg4g@-h@Vn?nfn?ntmp?nfd:!:):a0h@i@!oetMoeloel2qai@i@>p0etjpel:i@i@pZ-9ei@k@p(%dap wf:tletg:q ghatpi:cpj?Xq!(Vk@"6k@>k@msg#%$% H3P!@ :H!@ 0L!@ V&% Y:'5@!@'V6D!@@k@k@ok7]D%intJ>k@k@qnum,q chIq iI pr% % ? 7 @ % bufl!@;b[k@k@%7L.@int[k@s@/h"intXf7Z~tyZ](ZEI J# K#Lh#B.Mh# ^Nh#*OM#OM YM# ZM#e[#\Z# B.]h#^h#s3z3 # s cO nz i3  7 ptr3  3e~ d s1 s2d nzkkaxxjqoZ T s c3 nz i3k@k@)r k@sm@UrptrrminMrmajr-h+sSk@k@`:l@@l@m`l@{l@~`l@{l@Isl@l@h"h Fm@]m@!m@o@\sZ"B.hs#sths maj m@n@$s%m ~$8s&> o@_r@t'=zBt?3bt@atpAuBh;umajCuminDMvEM,wB.Fz?w`>o@Jo@ZSSo@Xo@P`Ip@Kp@`p@p@pP`Dhw`q@q@Lq@r@hx&0`r@s@,xpXx'B.zxptryminMty zyp.hySr@r@0`r@r@m( qs.$$7BMyXy`Cs@Hs@i`s@s@^&} s@s@ z' z8z'B. zXz3pxz ~s@s@s@s@)R*b!@*c!@+eM,3*f3 @*dg:!@*h:!@*k:!@*pl:x!@*m:!@-q.A0Bt@Qt@h"intXf~t](O:*t@Qt@zdst)zsrc)zn)d1{d,Qs-R o  |eB`t@t@h"intXf~t]n#`t@t@r{s"{"{u$o Bt@t@(h"intXf~t]z+t@t@{p*|ch*3?|c,QokBt@u@gh"intXf~t]*3t@u@S|s1)|s2)|oBu@=u@h"intXf~t]#u@=u@|to" }"+}u$o KB@u@u@h"intXf~t](O&@u@u@V}str%}len'd}(} o  Bu@u@;h"intXf~t](O$du@u@}str#}s%R oVBu@Iw@inth"Xf~t](OAu@Iw@~:J~:j~:d~dstB~srcC tDd`}pv@   o   BPw@x@'h"intXf~t](O#A%Oy]<Pw@x@:c0:3^:d~ t=d c?z dstAA o5z| x@}@h"intXf~t](Oj#d x@Yx@ws"6"dlen$d  o 1/`x@x@Cn.O+s.CK.Ow st0IKi1Oy;O t5O YY r]x@Xy@str+3]m3 c`y@gy@str>5N3py@yy@1s1s2]y@z@ wɸ8endn˽]e̽_ͽ^neg3 3̈́outz@ 95 C z@z@w end U5Vz@z@ Kwend=EVz@O}@8wDdD܅D3FVXnegG3out{@3P}@s}@>sF1}@}@j1w3y] }@n@h"intXI5Lf7e~t](e 'eJ0Zzo y , -# ~!.#  /k}@&@jZ‡=.jZ=-j]il3؈BqZrZupe0@J@5dAa~!dAF4P@&@4E~!EGdiHZ̉e,HZ5;90@n@^i:Z6%@4%@  x'1!@  2`.@ p@@ h"intXf7Z~t](Z' 2(#B.)o#x*zo  &'#(O#  ap@Ԁ@42 `O`b2ic3 O@O@y NOʊP2iQ3 i,OP@@* +VR +Oid-O52<2i=3#%@$O%@ P@@ h"intXf7Z~t](Z 'ZJ0|Ooz 3 pid4O# 5O# 6o# -7z# /8 '$ 2(*# B.)o# x$*Ao tpids|sOe,u3 vCrP@@pidp|pO q;b@@pida|aO a3SЂ@@gpidQ|QO ROC@@@?pidA|AOlenAo-B; hA@@\@k`@@{pid|Ì;o-; OL:{ Kg\ rj}A H!1@ʄ@}pid0|0;0o-0; " 2! ;Є@U@#pid|Ս$;$o$-;5%=+;U% h% O{&\3`@@pid|;ڎo-;=+3: X&O@@ppid|;͏o-; =+O- ߉K'L @@tJ|JO֐Ko-Kz, M{NzL(3O%@):*.%@0g[  @@&"h"intXf~t]oQ @̆@_G  І@@| @=@]"h"intXf7Z~t](Z 'Z3pid4O#5O#6o#-7z# /8 o   ' 2(#B.)o# x *y(V)#=+*#!+1 1!@@e,3 ͙ V `  @G@e,3/  !CP@Ї@OB{iD3 E Ї@7@ϒdi3$ B @@[@` *!e`@@dB.do!=+hY !3@O@w_=+Ô 3 ' @y@!  3P@@E(r q3 #3@?@str"Õsep$H .o/ 3@@U@  \`@c@K!pidZ|wZO"=.Zo"-[z # ]zud# ^ouh# _oul!_o$i`3up a  6p@=@ʖU&=|@5@m AU @5@>C)hK=+LG # -l%@ %%Y3h">"@@@$h"intXI5Lf7e~t] 'ey !#A }" "   3 +"{!#"#!3#0"!F!oR!3@@@Zs\!s"3 !3@ٍ@\!s"3T!&3@)@\!%"%3 q">30@"@^=3$\!=f"=sʙi?3 8"os0@@5!nsaidpZ%@p!3@@\!s!3@@Ϛ\!sc!3@Q@i43+"3`@:@'csig3S."coldr i+" !@@@"3!~!"n!H3@@"G3~![5"g @4@#!{@@b@O<"z3{!k3p@@w pidjz"j3ǝG!!+w&@!!,+@!"-%@5"%Y39 P#>"@@%N!0D:oh"intXI5hf7~t](k" '*,Oy.v%1uid2# (3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * (# " ^# " ' 2 (# B. )# x  *#'8 I#(8#fd)O# "+O# 6#,O# dupO@Ԓ@kfdO"O@@fdO0#OO@y@JfdOv"iO "O@@֞fdOcmdO"iO @4@sap%argOT@@l@ap%argOg"PO@N@zI#O8"\ܠi]O":P@@ q#~8@@.7fd}OZ!"iO"@@fdOءbuf";"w8#8p#A#ret $#@\@բZfdObuf!";A"wa#8#A#retգ`@ԗ@fd~O*"w~J"~O#8f@)@ fdeO9HeB.e#g8Ys(oH0@@wfdGO"HGå"B.G#I8K#s(Qi #8@̘@%fdO& ':OИ@t@4ߦ!O8("lf#nfdO#%8)af 8@Й@|f8*f80+:,-|#:O@@o499(#0+@ (#3O+@."68.b78.:88.% YOL##>"@@'oh"intXI5Sf7l~t](l 'ly.a%1?id2#(3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % #C:@@ #@:Ǩ #A #Bag oliE?é#D?!@  ?:8 V#4?/@\1:!@#2:/@#0: @#3:/@b##>"@t@)h"intXf~t](O 'Oy#'3@@#03@@w./3$8o@$@D#A30@D@p @ 3#J3P@t@K bufIK lenIdQo %Y3$D$>"@i@~)h"intXI5Lf7e~t](e 'ev(e)e(e)e*e +e,3|-ep.e0sy3$4`a#b#c#d# e#f#hg#@*i#k# l#$m#(n#,o#0o.Z%1p id2#(3p# pid4#.5# 7#8z#>9z#:A#4]4|  $43@@Ȫ 43 3  $C3@@ B3 B  $3@@ N 4 ޾ 8$3@@L 4   $@ʝ@x " X$3Н@@ ( ̾.$R3@@ЫDfQD$QJposSs8   >$3@@K3w$JfD٬ 3$y3@Ɵ@ 4x#$xJ|K$z3{Dۭ`@Ɵ@dir  | R$3П@i@"4N$J3fDٮ&@i@buf}$$(+@% Y3%^$>"p@@*h"intXf~t]v(O)Oym$#dp@w@e$)d@@#|$/o@@Ot$5o@@{7&$>"@v@S+h"intXf7Z~t](Z 'Z' 2(#B.)o#x *o y $ )  pid*|#$+ #K$,3#5 $BCCpidA|iC3$DC $nvpidm|io3$pC$|@@&pid|ӯK$&Z$3z$CȠ@@#.7Ip@@Vaʰj 3$|@ӡ@XK$&$T@r@pidS|@$VCoutfg@@@V#.k7$@O@qpid}|}O=.}o-~z"$CB  K# .`7!8 #P .s7"$9P@v@#$0+@ $%Y32(%>"@@p,h"intXf~t]0]y%!$"d# %#d#%*3@@4)H)  o  %v %Y3(6%>"@У@,h"intXf~t]oyd-%*r@У@"%)3++@d ? V^) 0 У@4@;-h"2>intXf7e~t]orpc"У@@pid!ZA #ZP A%2>@4@`Dpid0Z B0Z 0Z׳len1Z -1z" 33P N%:Th ZT D*]% @@L@-h"intXf~t]oW%@@L@A(e*%P@@-h"intXf~t](Ooyo' 2(#B.)d#x*  & >& & % !&%/ 1&1&E&2#m&3#5&# o6%pQpcwd}%v&3e%Qp&pcwd}%v&(3i)3*&FvDlenEdE&Em&E%Gv o%iP@@m(hQhp&h3ִN&jugposk&luhE&mul%nv`x %wd~  !!!! "#@إ@(!!!! "#إ@(@[!!!! "$8@@!!!! "5%%}@:@&(<%v'%p\(@$@'}z'dV&@Qpi3%3%v)&:dQ9pB.;di<3%=v&_Q]pH]}%^ib3%cv%&}@@@Z&(׶%v*%pud&3'B.d0'%}C+6@@r!C ,Nn"Y"d-|8 !P ,,",,۷- ! , ,)8,4X+@@@!!R "^,j"t.@@!!! ,,/w&}@@Ѹ&('4}*Qpul'B.dH'%vf-@H +!R` "^,j"t.@@-!!! ,ù,׹,' @@/h"intXf7Z~t] 'Zv(Zo''o@@ pid(o&8o @3@) pid7o 9oU'Vo@@a@hm &TO uidTz 'T 8'Uo pidWo &kp@|@,'z@@Ӻ {-O' @@N0h"intXf~t]o?'@@!.a' @í@0h"intXf7Z~t]ot'!@í@> O].''Э@@0N!0D:oh"intXI5hf7~t]( 'y.v%1Tid2# (3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`&(  O :(  O  O  :'   (v# '#arg#'##fp$## k'4OЭ@ @jfp3#s+3ap3%'5 t'6h'<O@1@fp;#s+;ap=%A>OP'/O@@@»%arg.%^.n.OD  ((O@@darg'%c':/Q('@@1h"intXI5Lf7e~t](e 'ey.Z%18id2#(38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 7(3 ?(@@F%Yo@@ۼ1)3@@I# d/(3 @n@3,c3_P@f@cs>u{g)8p@@8pos3c3o (3@N@3c3_I#0@F@cs>u{(3P@@ nestrY)3@@E7strYqF(/ @@~d(0ӿ(1~~B.2z>V>VY() ,@"$,@b%,@:&,@%Y3 k1('@L@Z3h"intXI5Lf7e~t]o(e 'ey.Z%1?id2#(3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#5Z#6#-7# /8a 7id8#(9#):#);Z# (<?Iid@#(A#)B#)CZ# -DI# AX )EOyidP#)QcUidV#)W K5  zl)& zres {K#) |#%)I# V(2%B.1)3EI#%@@0c8@@\4*3@@I#2_3г@ٳ@4^S*3@@_I# H?p3B. y(_* ?out8@ )R3д@@I#Qw*M3@-@ I#LHL?B.L)G30@^@6I#FHF?(`@[@bsrc()I#=.;*3R)&*m F@-@-d  A  X)3`@ض@w7I#B.*3@A@uI## Z)yp!))3P@Է@Y"I##Zi*hs@j@I#g @)nposGm wg (N3p@@dI#MwMsM3$b*@@?I#[* @@k-()I#$=.q)83@@:%str7I#7)%3@5@c$3I#$&ch&zu{)3@@@'c3SI#H*E!)@@ ""(/")g"I##n( M)\' m MB.`( )' m *B.,@@*i3+H*E0)F3@R@ I#E,cGz=f)]?`@%@]u \?\3I#\,i^3,c^3!)K0@f@; "4Jg"J-6)L?up.msgR +(SE*iW3#m ~#I#/( +y(_ z 0*p@@O(l3@Y@{ o*k)k Hm _(n(o,srcq,dstx&/@ H A 1!(`@L@fM "(""(#(+(V-(- .@-'.Z$.@-)/(.@2:82% Y3$4*'P@x@6h"intXI5Lf~t](Zoy' 2(#B.)o# x* $eP@@& d3R msggd hzVK$i,A, 3*E@@q*M3@'@sBLus $10@x@ 03P@j@i43 B5u *(,.@%Y3 b5g+'@u@7h"intXf~t]N!qD{o&(3 d {(3 d 3 { '  (# '# argd#]+M,*+z+L,*** *0 +3*:+O*V,6+1+{>5 95 &, H5#=+ ]#J+}'=+|buf|V,|OP+2V@@3^+1V_*1O*1*3Vrem4OOW+L@@.=+KVbufKE*KOq'+KOpMuX!+N.u`*OVC+PO*QOup +3@@m'm(c{R+3@z@'m^n3` i3A3T `,3@@r!q+"e,3#;,-@@!s+,$ap,f%A,.ud"*/3%e,03ul"+03:"+03" +13",23#&i33q#+3@u@ !'m!s+$apf&t"3"!{". O"V,!OX""O"+#O'*$O"+%3"A,&+(+?@) &ret23t) &ret=3) '"^) &len3<&pad3) e&ret3*e@@&ret3Y)0 &ret3*F@q@&ret3*@@+ret3P)H &ret3X,@8@&ret3,@@&ret3*@@E&retX3A)` -bufl %=+m]) &ret~3. }/01]) +buf "+3i)H &len3y*@@+ret13P*@@!&retH3*{@@?&ret 3D)xY&ret#3x*@%@w&ret?3*8@]@&retC3*]@@&retE3)&ret-3=)&ret3,8@e@&ret)3*@ @ &ret^31): "=+:O)T "=+V*@@r &retS3(&retY3#)@ &c{b`&ret3,m@z@+retc3P2{ 3 45{6 B,8''@9@I;N!0D:oh"intXf~t]y&(O :(O O : '  (# '# arg#+<O@@cs+;ap;%'=l'CO@@s+BapD%AEOP',O@ @"arg+^+Nn+Olen-O(%O @9@arg$c$::9v,'@@@;oh"intXI5Sf7l~t](l 'ly.a%1?id2#(3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K ,'@@@ ,%1 %\ 3'%: k,&:  % :8 Vz9,'@x@{<h"intXf~t](ON!|Do&(3 o (3 o 3 '   (# '# argo# , "W H#W# ,$d# %d#,)3@@arg(c(4 ,C3@K@v!HBWB.Bds+BapBq'D d,EXAF38,U3P@x@KHTWB.Tds+TapVqAW3P;-'@@=oh"intXI5Sf7l~,8~t](l 'l0y.a,/H%1`id2#(3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %&#H5'#B.(s#)#*#+# %  --<-$!!4#' l -%,*:PI#)!@@wnK-C@@4B'I#D5 w2@@ D -P@@9?4O'edirQ!@@Q)e2@ @S\->:@@I#=!w==:--0 @@I#/!51 f< @@>h"intXf7Z~t]ok-!@@O OR  O<-@@y>h"intXI5Lf7e~t](e 'eo 3 pid4Z# 5Z# 6z# -7# /8y n.HJE KE# H5L3#@ 9.Mz#D .NU#H U? Ad-3@@{.res3 -3@*@devB.z-0@@S'ؒ0B0SP0zppos3G.3@ @'103uppos35-@@+'03Wsupret3B0 %(.C@@jQB.l@@;cmdk#k3pidm0.pzuh-q;.rul-zd.zw:Jx(-Ydir-z.h J Y h w-X @@W3y-YmsgZX.1@@<0y-2msg3 |.N@@hpidM>.@&@?h"intXI5Lf7e~,8wt](e 'ey.Z%1Cid2#(3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#wJl#K3# .Ld V5 ..@&@ I#- w-l -3 ./dJ?8/ 0@@@h"intXf7Z~t]]/%zoH/O0@C@CB.O idOo/zP@c@ idO /o $/p@@ idO?s/ @@IAh"intXf~t]otde/3@@nOsnid@/ @w@Ah"intXf7Z~tyZ]/$h]/%o&/'#z/(z#/) /! B. O ! O ptr" @@.  h/1@@EB.0O!0O ptr22p/7 @;@qB.6O&6O!6O ptr8/G3@@\@3/FB.FOHO5/U`@w@/TB.TO~A0 @@QBh"intXf~t]o0@@0 @@4AP0@@Bh"intXI5Lf~t](Z&1)3 'Zo y0$ 1 ;1 /0 ) H5*# =++z# len,o# 0/& num0o# 1&#5 04z ppb5z# "06o# 07o# k08o# 0QoldPG0Po0PonewRA0>b?50Y@ @`Yppbzowoleno"0oai3Q503@f@ppbzoi3R030p@@ +ppbz5o`B0+03 i3Qarg 31b3b`H5`=+alenao t0co e,d3newe!"""!#$X03bshm3 B.opi3 3 wz 30903@@@9B09bshm3*p9V%& #%1@"a"V"K"B&h'l#w#(@{@k"""&#)"&##''''#?01@@@*ŢB09Gshm3gretȇz+%Y3CW1@u@Cg14AAc3Aintw19Adc8AG1 AcA1*Ac)A1HAcGA1MAcLAd@@vo1%A@@c$A@@; 1/A@@Gec.A%@@s7H @?@Z_1>A@@n@ c=A1CAp@@ cBAB@@a@@31RA@@ cQA @@Sv 1 H@@S O1WA @7@ cVA01\A@@U@O c[A{1aA`@u@ c`AD1[@`@Dh"intXf~t]1#]@`@str"""3A$]J1%3~+&i1'3 o %Y3ZE;22`@@Eh"intXf~t](O' 2(#B.)d#x( ##=+$o# *q o2N`@x@ QM*5  Y2Vd@@I7 QUu 1@)@ Q e,3R"n3l 1o0@K@ Q e,3G2ݿ}2oP@@HQ@e,3v=+ oG2&2( (2o@l@  Q52=+okL2Bp@@ QA 2@'@' Q  e,3B =+oz2@'@2 12h0@@n Qg =+goH%m c26@@hQ71+0.@2,34.@B2-8.@F2B@j@&Fh"intXf~t](O2&zy2%d@j@s$2$s1*  bit+o tbl,Lidx-3   o oG2Bp@@Fh"intXf~t](O2%3p@@1 s1#] s2# n$d oMG2B@@Gh"intXf~t]32@j@ s1 31 " 1 33 tok3 c43N sc43a  3@ o   3`p@@t  s_3_" a<.@H%3B@@oGh"intXf~t](O.3)@@ s& c'3 n(dF p+R    AaI<3>"@@Gh"intXf~t]yo53'3@@e 4'kIE3>"@M@Hh"intXI5Lf7e~t](e 'eyo.Z%1?id2#(3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K N3&3@M@  (% %3f) dir-(   V d%Y3J3>"P@@Hh"intXI5Lf7e~,8wt](e 'e0~y.Z,/A%1Yid2#(3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> e3!{3"S#3## _  DIR&l%"&"#H5'#B.(l#)#*#+# _2 --3tP@r@F sdirssws~ 3i@@r dirhs]3]~@@ dir\sU3C'@W@ 'dirBs r3D-3J4l3P'h w 2353`@z@_dir4s3*s@@) _Ke4@+@Ih"intXI5Lf7e~t](eo 'ey.Z%1?id2#(3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z[4[#,4\#3^z#_#  a}4`dc,4d#3fz#g#  a4h =43@@34 3c4?ul4?3U@303zB.zHR)  V  a  333@+@31G34142543Uq45364G?Q4H?z3@L4@ 4@k@+@3mzB.nzHoR)r5  a %Y3L44,@S@@Kint~]ohf"5%5,F5XE5tU5M5>5e5 95154low`#4`#  s llv )5 5M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww 4km1km0k[5_,@S@n^$d^DH`A7-`LWbmuxC:t`@@r@S@DN44T@@Kint~]ohf"5%5,F5XE5tU5M5>5e5 95154low`#4`#  s llv )5 5M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww 4km1km0kt5ST@@uRvRwTxVA7-LWbtPmx9Y<O@@{$@@% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I  : ;  < $ >  : ; : ;I8 I!I/ ' II&.: ; ' @: ; I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@4: ; I4: ; I 4: ; I 4: ; I 1UX Y !1"1# U$41%41 &41'1UX Y (4: ; I? < )4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > &I .: ; ' I : ; I4: ; I4: ; II!I/.? : ;' I@: ;I: ;I 4: ;I4: ;I1UX Y1 U4141 41.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8  : ;  (  : ;   : ;  : ; I8  : ;I8  : ;I8 ' II' &II!I/ $ > &&I : ;.? : ;' I@: ;I : ;I4: ;I.: ;' I@ : ;I !: ;I"4: ;I#4: ;I$.: ;' @% &4: ;I '4: ;I (.? : ;' @)4: ;I* + : ;, U-!I/..: ;' /: ;I0.: ;' I 1: ;I2 : ;31X Y415 U61X Y7184191UX Y:41 ; : ;< : ;= >1UX Y?41@ 1A4: ; I? < B4: ;I?  % $ > $ > : ; I  I : ;  : ; I8 $ > &I ' I I &I!I/  : ; I8  : ; I 8 .? : ;' I : ;I4: ;I: ;I.: ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I4: ;I 4: ;I: ; I : ; .: ;' @!: ;I": ;I #: ;I $ : ; %1X Y&1' (41 )1X Y*41+41,4: ;I-1UX Y. U/4: ; I 04: ; I? < 14: ; I?  % $ > $ > : ; I$ > .? : ; ' I@: ; I : ; I : ; I 4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ > : ; I : ;  : ; I8 .? : ; ' I@: ; I  I &I &I 4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include../lib/ext2fs../lib/ete2undo.cstdint.hstddef.htypes.hio_struct.hstdio.htdb.hext2_types.hext2_fs.hcom_err.hext2_io.hgetopt.herrno.ht@ g D K] Lɲ~K/X~f< [C6/0>ɽ=.=rtzy+~H /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etismounted.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hcom_err.h@S1u!=!=3&XH$g  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systdb.cstddef.htypes.htypes.htime.hstat.htdb.herrno.h @X<_Ou[~nxX`t {[xuLthu+YL夔f t={ yfK~Ȼ $f~vu~>$i8~fɠJ=&0x'*f&Luh$~XZY1 $'~guk.'vu& .@0 /=r Yugfj u. Jv<<x/r@Mvw(<u!G#>"u2a=e< < f!bք<{=0<t  "5h2'u<Y$  f !uEf5CuivJ<{YeX_'yfK"yfJ"u Kx Zvju".֟y?,ufcf#@ ޮ = uKZP\f"<<y r=?=Mh~f-Bv>iot> <=gn (_$fN^> %kv@  y=/>Б <wx>Ⱥm}tz] Juf<@g=gu8/Ktt@w<xt tX  X*k=jft% th"g=gwZlz$ʻ <i Xf<#.DuAtmf$Zgl tJlX f ]֓w !O#s hOw.gY[hv|\ttJgn.P>S,<N2XqunfpttY~f8u.P/.j=gl"eAm3!!tbef$fb]_?nfuXch.YpY<>.uyX#%<;Z'e!iɟewv۳z@u<fs rX y .$ȭl?/g"r .~fyv+Kguggg̑.#iBY.~uY~gg>(Z  f!~+Y Au0Q~/fD fqEOfz .lX~Au~f   /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/et../../lib/ext2fsunix_io.cext2fs.hstddef.htypes.htypes.hstat.hcom_err.hext2_io.herrno.hpY@k=*ux.`.>rkvtu0q Xx Ȝ Mpu <JiKLiZttj=*2S X|<gggzg'b \svf gw<!Y=mfsgK{Xu%R!inFJQ4U=v<fzz"u/M$VLr"gKX=!w/g}vtXoKt=t$p t|uuvKfYuyyf f^tuuvJs?y. v X=tZ=uNpxt .pa=pl|"tguztguz~ zfzz<J=z<=uuuvg#g@6t XXzv[KtkzX@Y ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cext2_io.herrno.he@vAyX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.he@1=g.gZKk90=YG.uKhNK1=sxXu$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.hk@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJZ: ../../includestrncpy.cstddef.ht@)Xg[ye_9 strcat.c`t@"?; index.ct@*8 ../../includebcopy.cstddef.hu@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.hPw@;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.hp@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.hP@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h@@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]9 ../../../includeuser.ctypes.hp@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h@i+t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c@=gP ../../../include/arch/i386add_intr_handler.cstdint.h@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.hЭ@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.hP@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h0@?Dx ?Dx =3 puts.c@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.h`@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.hp@$>9LV2z \ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@(JgKwp@6 unlink.c@&? ../../../include/arch/i386../../../include../../includeaccess.cstdint.hstddef.htypes.hio_struct.hstdio.hdirent.herrno.h@%t? JvN73x<  ../../../include/arch/i386../../../include../../include/sys../../includeposix_dir.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hio.hP@gsgrgcg;?+g,02zt4Zd/Yvcgust>T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h,@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hT@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@#AB O.84@ D  F AB DW.W.I. ^.|  @@AB IG.@AB M.|  @ AB  @+AB 8 @AB Dg. @qAB Dp. c.4 @IAB Di.  @+AB `.  @RAB D@.  @IAB CL @AB d @AB | @&AB BX.  @AB F$0 @TAB Fc.T.J.$ @AB F[. k.b. $ @YAB Fs.T.h @AAB B @ AB  @AB  @AB  @>AB A(@AB F[. i.v. C. @nAB FH.d@$AB D@DAB E @UAB D_. P.R. $@ AB 0@ AB <@AB L@"AB p@ AB |@ AB @AB @AB @AB Fd@AB l@AB @AB @AB  @AB Bj. k.`@AB p@AB @AB $@AB Fs. y.l@AB @AB @AB @AB @AB $@AB E^.X.W. 8@AB FF.W. m.o. J.U.R. ].(L@AB F.l. . @'AB DG.O. @*AB DG.R. H@*AB DG.R. t@AB BQ..,d@AB Ef.B.f.N. W.@@NAB Bh.$@AB I}.d. ,\@AB Fq.r.G. .$@AB FJ.m. (@AB FV.z._.D. $@-AB FR..< @AB FM. o.l. w.q.K.M..h. k.p#@|AB FM.v.R.l. v..d. f..f. S.r. Z.e. t.S. S..m. S.}.Z.P. _.S. 8*@ AB V. ,X*@AB FS._. n.Q. [.(*@AB F|. I.Q. +@AB F.(`,@+AB F.\. F.8/@AB B\..]. _.t. V.a. J.U.L2@"AB N.(p2@AB FN. h..  4@AB Q.<4@*AB DG.$h4@VAB FI.t. $4@tAB Fj.f. 45@;AB DM.X.p5@)AB DG. 5@AB EG.f.$$6@AB FJ.N.<6@AB F.U.V. `.u. \.h.d. W.(L9@$AB FQ. V.Z. ^.p:@AB F0;@AB F.].g.a.n.f.<@)AB DG.(<@AB Fn.p.o. >@AB F.0?@AB F. R.P.W.G.P.$LA@aAB Fz.L.(A@AB Fj.\.].J.h0B@AB Ft.U.n...K.T.W.X.x..Z..a.D.~..O.a.`.`.a.4 I@BAB FS.Y.\.a. ].I.o.[.PJ@8AB Dg. ,J@ AB F]. ^.t.Q.W. K@'AB DG.O. K@*AB DG.R. K@*AB DG.R.L@"AB B88L@AB Fn.a..y.w.i.U.^.Q.4O@_AB FH.~. A.y.Q.].Q.,pP@CAB Ff.l. d.0X.]. Q@EAB Bf.U.Q@rAB FY.C.`. S.. P.a.r. N.r.|. `.K.j. L.G.C.|. I.X.R.G.x.V.S.V.S.}.P.T.R.W.s.| PpY@<AB PY@AB F(PLZ@ AB Fn.w. D. PX[@yAB FI.P[@/AB  P\@eAB FR.,Pl\@@AB F{.s.\.U.^.P]@AB S. (P]@AB Fe.S. q.0P^@AB Fc.t.h.._.P`@AB S. Pa@AB Fy. Pa@AB BH.Pb@dAB Et. P|b@eAB Fn.Pb@qAB F(PXc@AB FX.N.O.,P,d@~AB FP..o.G.I.| e@GAB y.| (e@ AB G.(f@$AB ($f@AB ((8f@AB F].].O.(f@8AB ].| $g@AB ,g@AB (4g@AB DY.\.j.W.X. 0h@AB BV. i@AB DB.N.u.i@AB J. i@AB F.| k@9AB A| k@AB k@AB FIm@AE E o@?AB F`r@VAB Fs@3AB D| t@QAB B| `t@<AB AD| (t@.AB | Tt@>AB A| u@-AB A| @u@JAB FI| u@AD | u@AB F| HPw@AB F| | x@9AB |`x@AG F|x@hAB B|`y@AB |py@ AB |y@AB F|z@ AB |z@ AB |z@oAB F|P}@#AB |}@!AB |  }@vAB FIF0@AB  P@AB AFF0@>AB | Dp@dAB FD@oAB FDP@AB E| P@:AB D@1AB Ђ@1AB @0AB @@AB `@IAB F@AB AЄ@AB ON`@YAB X@YAB X  @AB IFF| @ AB І@AB | L@&AB L @'AB LP@AB FLЇ@gAB AGL@@AB L`@AB MFL@_AB LLP@GAB FFL@AB LL@@AB L`@AB FLp@AB F| @@IAB D@IAB D@IAB D0@AB E0@_AB D@%AB @%AB @aAB  `@AB MFF@@WAB D@qAB D @AB @@"AB p@IAG | P@AG P@AG P@yAB CP@ AB CP@AB FPP@KAB P@RAB AFP@AB OP@AB OP`@tAB LFP@IAB P0@AB LP@ AB PИ@AB EP@"AB |  @;AB D| D @ AG D @AD D @AG D 0@AG D P@$AB |  @AD  @AD  @ AG  @ AG  @ AG  Н@AB  @AB FHE @EAB D @AB FI П@AB IFF| !p@AD !@AD !@AD !@AD | l"@AB Cl"@#AB l"@AB El"@AB Fl"P@&AB | #@AG | <#@0AB | h#У@AD h#@DAB E| #@@ AB | #P@7AB C#@AB F#@@AB F#@AB F| t$@ AB t$ @AB t$@@!AB Dt$p@ AB t$@ AB | %@AB | 0%@AB | \%Э@;AB \%@!AB \%@@JAB IF\%@"AB | %@$AB %@AB %@ AB % @NAB D%p@AB BF%@NAB D%P@\AB D%@kAB D% @jAB H| &@AD &@AB &@AB &г@ AB &@AB D&д@+AB &@-AB &0@.AB &`@AB FK&`@xAB D&@aAB D&P@AB FF&@AB D&p@zAB D&@#AB  & @fAB IFF&@RAB FF&@EAB D&@@UAB FF&@UAB F&@RAB D&`@AB II&0@6AB C&p@AB &@AB I&`@AB F| )P@bAB E)@AB )@GAB )0@HAB B|  \*@dAB FLG\*@AB F\*@'AB \*@AB F\*@EAB A\*@0AB F\*@uAB C| H+@6AB H+@AB H+@@AB FFH+ @AB | +@@?AB |  +@dAB FGG+@[AB H+P@(AB | `,@AB `,@0AB `,@ AB `,@0AB `,@ AB `, @`AB FF|  -@AB | 8-@QAB A8-@*AB 8-0@mAB F8-@mAB BC8-@rAB FI8-@7AB D8-@DAB F8- @AB D8-@AB PF8-@+AB | p.@fAB D| .0@AB .P@AB .p@AB | .@AB | (/@AAB LF(/@AB (/ @AB (/@@AB (/`@AB | /@ AB /@ AB | 0@lAB C0@VAB C0p@jAB F0@`AB F0@@HAB L| 0@AD 0@AD 0@/AB 0@AB 0@AB 0 @AB 0@@.AG 0p@/AB 0@AB 0@AB 0@4AB 0 @AD 0@@AB 0`@AB | 2@AB F| L2`@AG L2@!AB L2@yAB HFL20@AB  L2P@AB FFFL2@lAB FFL2p@)AB DL2@AB MFL20@OAB DL2@!AB | |3@AD F| 3p@KAB DD| 3@AB BD3p@"AB | 04@9AB A| `4@ AB | 4@]AB D| 4P@"AB 4@#AB 4@AB 4@AB IH4`@AB 4@ AB | h5@dAB Fh5@+AB JI| 5,@'AB E| 5T@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdouts_mmp_intervals_journal_inums_journal_devcheck_filesystem__s32bytes_writtens_jnl_blockss_mmp_blocktdb_contextblksize_keys_mnt_counts_algorithm_usage_bitmapstruct_io_channels_lastchecks_stateprg_names_checkintervals_prealloc_dir_blocksdsizes_feature_incompats_flagss_reservedGNU C 4.2.2s_reserved_padrefcounts_free_inodes_countread_errortdb_files_min_extra_isizes_rev_levels_prealloc_blocks/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/misc__u16s_first_data_blockerrcode_tnum_fieldsTDB_DATAset_blk_sizes_raid_stridee2undo.cs_def_resuids_frags_per_groups_first_inosupers_creator_osblk_numbytes_reads_log_groups_per_flex__u32s_blocks_counttdb_datas_wtimestderrretvaltdb_keywrite_erroroptind__s16TDB_CONTEXTstruct_io_managers_feature_ro_compatext2_super_blocks_hash_seeds_free_blocks_his_log_frag_sizes_inodes_countforce__u64s_uuidunix_io_managers_jnl_backup_types_first_meta_bgs_last_orphanstruct_io_statss_inodes_per_groupusages_mkfs_timeapp_datamount_flagsmtime_keys_minor_rev_levels_default_mount_optss_inode_sizes_last_mounted__u8s_max_mnt_counts_r_blocks_count_his_blocks_per_groups_want_extra_isizes_reserved_char_pads_blocks_count_his_volume_names_def_resgids_desc_sizeuuid_keys_def_hash_versiondevice_names_reserved_gdt_blockss_block_group_nrs_journal_uuidmains_magics_r_blocks_counts_mtimes_free_blocks_counts_errorss_log_block_sizes_raid_stripe_widths_feature_compatext2fs_check_if_mountedext2fs_check_mount_pointuid_tblksize_tst_ctimest_bufst_devtime_tst_blksizest_gidino_tmtlenst_atimeis_swap_devicedev_tmode_tst_nlinkst_mtimegid_tst_blocksnlink_tst_uidmtpt/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/ext2fsst_rdevblkcnt_tfile_devst_modeismounted.csuseconds_tpartialtdb_log_funchave_transaction_locknew_dbuflist_structTDB_DEBUG_FATALtdb_ofs_readtransaction_expand_filetdb_unlock_recordTDB_DEBUG_TRACEext2fs_tdb_map_sizeF_UNLCKmax_dead_recordsagainparsertravlocksrec_lentdb_find_lock_hashext2fs_tdb_reopen_allTDB_DEBUG_WARNINGtdb_rec_writel_starttransaction_brlockhash_headsext2fs_tdb_lockall_unmarkzerotdb.celements_lasttdb_unlockfailedl_typetransaction_syncext2fs_tdb_traverseext2fs_tdb_transaction_commitupdatetdb_dump_recordprevtdb_count_deadext2fs_tdb_errornum_locksmem_tdbtdb_headertdb_mmaptdb_transactiontdb_parse_datanew_lcktdb_write_lock_recordlastrectdbsext2fs_tdb_firstkeyTDB_ERR_CORRUPTprobesequence_numberrecovery_eofext2fs_tdb_set_max_deadTDB_ERR_NOLOCKtdb_update_hashext2fs_tdb_validate_freelistext2fs_tdb_existsnull_log_fntdb_delete_hashext2fs_tdb_traverse_readTDB_ERRORrecovery_offsettdb_next_hash_chaintdb_methodsremove_from_freelisttimevalTDB_DEBUG_ERRORtdb_transaction_unlockF_SETLKext2fs_tdb_fetchtdb_recovery_sizeF_RDLCKext2fs_tdb_errorstrparent_longlivedvertestflockdefault_tdb_hashext2fs_tdb_lockall_read_nonblocktlocktdb_exists_hashext2fs_tdb_deletetv_usecext2fs_tdb_chainlock_unmarkext2fs_tdb_hash_sizeleftsizetdb_freetdb_munmapext2fs_tdb_transaction_cancelrw_typetdb_findext2fs_tdb_chainunlock_readfull_hashwant_nextrecovery_headtdb_dump_chainext2fs_tdb_storenewrectdb_len_ttransaction_writetdb_next_locknestingssize_text2fs_tdb_transaction_recovertdb_allocate_ofsext2fs_tdb_closelock_rwtdb_new_databasetdb_writeTDB_ERR_RDONLYrightext2fs_tdb_log_fntdb_brlocktdb_debug_levelext2fs_tdb_chainunlockext2fs_tdb_printfreelist_tdb_lockinodetdb_ofs_writetotalsizetdb_lock_recordnew_dptrtransaction_methodspnum_entriesboolext2fs_tdb_chainlock_markl_pidkey_lenext2fs_tdb_get_seqnumtdb_allocateext2fs_tdb_lockall_reademapbestfitecodeext2fs_tdb_lockallext2fs_tdb_fdtdb_transaction_elext2fs_tdb_dump_alltdb_rec_free_readhash_fnnewrec_ptrtdb_purge_deadext2fs_tdb_enable_seqnumoldhashdonelocktypeext2fs_tdb_nextkeyext2fs_tdb_lockall_nonblockupdate_tailerext2fs_tdb_appendsave_errnoext2fs_tdb_set_logging_functiontdb_already_opentdb_traverse_funcext2fs_tdb_transaction_startlog_privateext2fs_tdb_chainlockdata_lentdb_nullF_WRLCKfailtdb_do_deletetdb_increment_seqnumF_SETLKWTDB_ERR_EXISTSext2fs_tdb_get_flagsglobal_locktdb_logging_contextltypeext2fs_tdb_lockall_markmark_lockext2fs_tdb_open_exlockedio_methodsrecovery_max_sizetransaction_next_hash_chainTDB_ERR_EINVALtdb_oobnum_lockrecsnewdbleftbest_elTDB_ERR_IOext2fs_tdb_increment_seqnum_nonblocklog_ctxtransaction_readestringtdb_find_deadtdb_traverse_internalTDB_ERR_NOEXISTtdb_brlock_upgradeext2fs_tdb_chainlock_nonblocktdb_transaction_locktv_sectdb_off_tTDB_ERR_OOMtdb_expandnew_map_ptrold_map_sizeread_onlyTDB_ERR_LOCK_TIMEOUTtransaction_setup_recoveryadditionl_whencetdb_errnametdb_converttdb_lock_typeext2fs_tdb_lock_nonblocklast_ptrtotal_freeext2fs_tdb_chainlock_readtdb_readTDB_SUCCESSTDB_ERR_LOCKext2fs_tdb_parse_recordtdb_alloc_readtdb_rec_readtransaction_oobtdb_key_compareoldkeytdb_write_unlock_recordlck_typetdb_recovery_allocatemagic_foodmagic_offsettdb_flagscurrentrwlockstdb_io_initext2fs_tdb_nameext2fs_tdb_unlockall_readtdb_expand_fileext2fs_tdb_openext2fs_tdb_get_logging_privatetransaction_errorrecovery_starttdb_hash_funcext2fs_tdb_unlockallpage_sizeseen_insertext2fs_tdb_reopentailer_ofstdb_traverse_lockfind_cached_blockext2fs_get_memaccess_timeerror_outunix_private_dataflush_cached_blocksunix_set_optionunix_write_blkcleanupfree_cachewritethroughraw_read_blkalloc_cacheinvalidateunix_io.celdestretval2reuseunix_read_blk64unused_cacheext2_loff_tactualunix_closein_useraw_write_blkdirtyunix_read_blkunix_get_statslocationunix_write_byteoldest_cacheunix_cachereuse_cacheunix_openunix_write_blk64unix_set_blksizeunix_flushstruct_unix_managerext2fs_free_memoriginllseek.cext2fs_llseekcom_errnew_procreset_com_err_hookcom_err.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etpvardefault_com_err_procerrfwhoamicom_err_va__builtin_va_list_et_dynamic_listtable_numadd_error_table_et_listremove_error_tablen_msgssafe_getenvdebug_maskdebug_fet_list_lockstartedet_list_unlockdstrerror_message.cadd_to_error_tableinit_debugerror_messageoopsnew_tablechar_setet_name.cerror_table_name/home/tyndur/tyndur/src/lib/stdlibcerrno.cdiffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockpagesl_pageCountmajSizefirststrncpy.cstrncpy/home/tyndur/tyndur/src/lib/stringstrcat.cstrcatsavestrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cstrdup.cstrdupcopystrlen.cstrlendst0memcpy.csrc0memset.cu_charu_intendptrpositivedecimal/home/tyndur/tyndur/src/libitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpc_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeouttimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flagsold_posio_resposix_files.cF_GETFLflags_sizefd_to_filecreatfd_listnext_fdoptargoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptmisc.cgetpagesizeisattygethostnamepipeforkumaskmkfifostat_buffchmodinode_numlost_statmknodfstatstat.cstatuslstatmkdiruser.cgeteuidgetuidgetegidgetgidrunningwaitoptionswait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidactimeutimbufmodtimeutimeutime.cerror_codestrerrorstrerror.csend_messagemetadatayieldsleep.cresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closeio_direntry_type_tuint64_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.cisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigitoverflowstrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrtok.cspanpdelim__strtok_rstrtokcontmemchr.cmemchrunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu#tP$(u(.Q./u/1u11t$qV1q$qS1qPPPQtl1tl(P:WPcPPPPVVVQScfSS$VVQfS]tSS1SPPzPtS)PfSS/Suu@t@tBMVM`P`V5V.W6W;@W@AuACuCWtuu t u u7t 7t,P.5P89u9;u;t8KKYSY[t[ySy{t{S8QQTtT[[t8 t 8tRRPuu1tPSS1SR45u57u7}t4CPCLSN{SIIPlxPuutPQRuutPSSRPPQuuItPFVRBIRESLMuMOuOctLaPdeuegugyt|}u}ut|P|R|Quu-tVt-V-t SQSQSQ-Stp-tp01u13u3t0?P?bSfS0TRTdWfW0^QfuQuu tPS SRW WQV V  u uet PNSReS >R>etP (Q(5Vhiuikukth||Pth||Vt uxRxSRSRuutRPt Pt uutuutPuutPSSuut1P1wS{SS7R7YWsyW{WWBQBxV{VVuubt P 9V<_V R :W<`W Q bt`  S R S 4R48S<^SdeuegugtdPdpRpSdyQuutVtuu!tPSPS$%u%'u'.t01u13u3;t<=u=?u?JtLMuMOuOntpquqsus{t|}u}utuutuutuuatSat_W^Vdeuegugitlmumouo}tuutuutuu` tPVV` V R% 7 R` a ua c uc n tp q uq s us t u u t u u j t P V V / V2 j V R S R S R S  R . S. 2 R2 D S Q W Q W Q 0 W0 2 Q2 j Wl m um o uo  t u u t u u t u u t u u t u u t  7 S7 : t: Q SQ T tT S  8 V8 : t : R VR T t T V A A T tT [ [ t  u u K t  W t  W  t K W V2  VL M uM O uO tL f Pf S P S SSL d Rd tlL d Qd k tdk  P ?td?RPRtd tp tptp:?tpMRtptptp R$R W W?WRWuutuuFtHIuIKuKrttuuuwuwbtt@S@CtCbS2RXbRAVQbVdeuegug?tdxxVtVt?V@AuACuCt@RRVtVtNSSuuYtYtWt MWMOt OWWWYt StStSOtOUSUYt\]u]_u_t\kkth\VWVWt VW)V)*W,;W;[V[]W]VWVWV\tttd\z zt`tp,t`,9tp9t`tpt`\t\SS,;S]SS,tl2]tl]WtlWtluutV!t!+V+.t.VIIt t W!t!,W,.t.WuutWt/W/1t1WVt .V.1t 1V$t$KKt St-S-1t1S   t $t$$tpDtpuutPtlRVUVVVSWPPW?RVVVVVuutWtW\PchP|tttp tpt@Gt@t@ Et@Kt@SSSSSththth EthKhthththtdtdtd EtdKhtdtdtduu8!t#t#ssststi ti   t  8!txx#t #t Qt Qssst st i t i   t  8!t ##t#tststApti   t# #t#t sti ti    8!t#t#ssststi ti   t  8!tVtVtQVQatasVsstsVtVtpVptVi ti  V t V 8!tSt St QSQat asSsst sSi t i  S t S 8!t tPWtW\Payty~Pt t  Pz tttQatssttpti t t t 8!tttQatsstt0Atpi t t 8!tQ Q*SQaSSaQQaRR[PP8!9!u9!;!u;!X!tX!Y!uY![!u[!!tX!l!Pl!!S!!S!!SX!l!Rl!!tlX!y!Qy!!V!!V!!V{!!W!!P!!W!!P!!W!!W!!u!!u!"t!"P"/"SR"X"S\""S""S! "RQ!3"3"\"t\"w"w""t!""-"Q-"\"t \"p"Qp""t !R"R"\"t\""!R" R"\"t\"" ;"D"PW""VWF"Y"V}""V""V""u""u"_#t""P"K#VN#\#V""RQ"""L#WL#N#tN#]#W]#_#t"""J#SJ#N#t N#[#S[#_#t `#a#ua#c#uc#&t`###$t$$$&t`#w#w#2$V2$e$t e$j$Vj$m$t m$$V$$t $%V%&t &&V`#:$:$e$te$$$$t$%%k%tk%%%&t&&`#w# w#&t##Se$i$Sm$$S%D%Sk%n%S%%S#k$Wm$s$W$$Wk%&We$k$Ws$$W%k%W%%We$i$S%%Sg&&S&&u&&u&I)t&&&&V&&t&&V&&t&I)VL)M)uM)O)uO)n)tp)q)uq)s)us) +tp))P))V))V) +Vp))R) +tdp))Q))tp))Q)M*tpM**t`**tp**Q**tp*+t`+ +tpp)++ +t + +*4*Q**Q +!+u!+#+u#+9+t<+=+u=+?+u?+f+th+i+ui+k+uk++th++P++Vh++R++tlh++Q++S++W++P++W++u++u+4,t++P+,S ,$,S(,0,S++RQ++VQ++VW(,*,VW+++4,t+++4,t +,,(,t(,4,+,V,,P,,V ,,P,%,V*,1,V4,5,u5,7,u7,o,t4,@,P@,m,S4,M,RQ4,T,T,o,tp,q,uq,s,us,,tp,,,,P,,u,,u,"-t,,,,S,,t,-S-"-t,,,,R,,P,,R,,P,,R,,V- -V,,P$-%-u%-'-u'--t$-[-[-s-Ws-w-t w--W--t $-J-Y-`-Pw--PG-O-P--u--u-K0t--P--S-K0S--R-K0tP--Q--W-K0W.$.VL//V//V040V--V--tH.8.tH8..V..tH.L/V//V//tH00V40K0V--tp8..tp.L/tp//tp00tp40K0tpL0M0uM0O0uO0p1tL0^0P^0k0So0p1SL0b0Rb0l0Vl0o0tPo00V00R01V1 1tP 11V1.1tP.151V51G1tPG1p1VL0b0Qb0m0Wm0o0Qo0p1W 11R!1:1RD1P1Rb0o0tp1p1tp|00P00Pp1q1uq1s1us12tp11P12V22V22Vp11R11S11S2 2S12S 22S22S12tp22tp11S22S22u22u23t232P3213S53x3S|33S2*2RQ2V2V23t3&3&33t22P22R$3-3P53;3P;3@3R33P23V+323VB3y3V33V22V|33Vy23tl+353tlF33tl33u33u33t3333P33u33u35t34P44V45V55V33R34S45S55S33Q34W45W55W55u55u56t5556S6 6t 6{6S{66t 66S66u66u6J8t66P67W77W7J8W66R6J8t66Q6J8t666J8t66P67S}77S77S 818SE8J8SL8M8uM8O8uO88tL8q8q8|8S|88t88S88tv8}8V88V88u88u809t88809t88V 99V#909V0919u1939u39 @t09I9I9b9Sb9f9tf9 @S099;D;g;n;>> ?i?0999>t>>> @t\9f9tv9 @t\9f9tp:;;tpg;n;tpu;h=tpt=>tp? ?tpi? @tp\9f9t:;;tg;>t> ?tX?]?td? @t\9d9W ;;;Wl;n;W>>W99RQ\9f9t9;;tg;>t> @tO: ;Wg;l;Wn;;W??W\9f9tlr:;;tlg;h=tlt=>tl? ?tli? @tl\9f9tl;;;tlg;n;tl;h=tlt=>tl? ?tli??tl? @tl\9f9t;;;tg;n;t;h=tt=>t? ?ti??t??t? @Pg;l;W<<W>>W??W@ @W\9f9t;;;tg;n;t;h=tt=>t? ?ti??t? @t @ @u @@u@NAt @P@P@NAth@@SV@@SV@@WV@ASV'ANASV@@SA#ASPAQAuQASAuSAAtPAAPPAARAAth}AAQSAAuAAuABtAAA`BV`BcBtcByBVyB|Bt|BBVBBtBBVAAABWBBt BGt>GlGVlGoGt/F3FS3F5FP5F9FS=FJFPJFvFSFFSF GSGGS1G:GSbGkGSvFFSG1GS>GbGS\FFtpGoGtppGqGuqGsGusGHtpGGPGGVGGVGHVpGGRGGWGGWGHW=HoHSHHSGGtlGHtlHHuHHuHHtHHHHVHHPHHtHHSHHuHHuHnPtHIIxISxI|It|IISIItInPS=IyIVILVLLVMNVNNVNnPVtI|ItIJtLLtMMtdNNtOOtPPt:PLPtcPnPtdIzIWIJW?JBJWJ+KWP:PWtIzIWLLWMMWM[NWN3OW[OOWOOWtI|ItIJt|KLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItlIJtlKLtlLLtlMMtlMNtlN3Otl[OOtlOOPOPtl:PLPtlcPnPtltI|ItIJt"KLtLLtMNtNPt:PnPttI|IthIJthKLthLLthMMthMNthNNthN3Oth[OPth:PLPthcPnPthtI|ItIJtKLtLLtMNtNNtNNRNDOt[OPt:PLPtcPnPttI|ItIJtKLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItIJt(KLtLLtMNtNPt:PnPttI|ItdIJtdLLtdMMtdHNNtdOPtd:PLPtdcPnPtdtI|It`IJt`LLt`MMt`MNt`[OPt`:PLPt`cPnPt`tI|It\IJt\JKLt\LLt\MNt\NPt\:PLPt\cPnPt\uu<tP5t5:P:<t''5t 5<P33P::PP ,P13P<=u=?u?t<cPcvtlvyPytl<LRQLNSQNSVSVSV<tttNRRZWWW\QQuutPthRWWtt`t t`t t+tl+.PR.tltltlFsSVSVSVSVpQQQnPPPPPuuat P atl R ath Q YWY[Q[aWWS[aS 0PDSP[aPXV[aVdeuegugtdrrPtPtPtuRPPuutPWWRVVQSQSttht thuu<t<t  Vt7VW78t W8:t :<VWF Ft <tqqt< tX<tX/6SqS/:tpqtp/:t\\t\t\t\4<t\/:t`it`/6SLqSS<S<=u=?u?Yt<MMWPRWYt \]u]_u_xt\mPmxth\pRpW$,W.xW\ppstsvt`t vxt`\xt\  .t.[ [xt*S24ShjSotSvxStlPR4P<xtlSV.2SVAaSVjoSVtvSV+VajVxyuy{u{vtxvtxt tHttHVWPRVWtHWvtHx `t`j jvtx"t"jjvt`tPjvtPP S APU\PnP(SjvPPP$$P;SPejPtT,tTjvtTtX,tXjvtXt\,t\jvt\xyuy{u{txPRt uu tP t PtP tt  t  t t  SS RQtpPtpP tp !u!#u#t 00@P@ItIXPXtPt @@It Iggt t t  t 3FSISS@GVZ^V^^P^VV@BPPuu tPP S V u  u q t % P% b Wd o W % R+ H R\ \ Pi i P! ` Sd m S# a Vd n Vt u uu w uw tt  S t S P t S t St  W t W t W t W V V R V P P P P u u t   V  t , V, / t/ V  S + S6 S  W% - W4 6 WC W  tpb tp  tp tp u u : t  ) tH t : t  + 3 :  W P W W  W! ) W+ 3 W8 : W P4 tp  tp+ 3 tpuuGt  Pt"PR"'t R')t )4PR4APtAGt uu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Sttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPtt uttu !t!(t(4u@AtAHtHTu`atactcuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttutt0uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qtt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_PQ1`cQ`1ntLufMfz;M)/ 8@%.8@%y`lBMGOQ,["$Td##%%%0%m$$##}%%g&&&&.L/40K000//L//040//1111V22|3~3o22|3~322{44r5599 ?I?99'?;;? @i??? ?Y>>t=L>_<<;U<`>>? @`>>? @??>>>>;;??i??? ?t=;>o<<;;;;??i??? ?>;>=>==<<;;==??v@@=ANAGoHHHHH H=HHHHHLHoHIIJJIIJJIIIIIILJjJ~JJKLLPcPOPNOMNMMKKLPcPPPOONONNoNyN6NdNN"NMNMM$LLK L(KKLPcP3O[ONNNNMM9KNKLPcPDO[ONNNNMMPMMM;M|KKhKrK  !  !    *3*@&(&(*@&(*@*A$p\\,8KX_r02 (:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)030DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@<'@-@ 5@\? @ F @ M @ R @  X !@! ]!Zfb)u"2L XOGrL$60*~5^`3yۊx% x@@@@@ @ @ @ @ !@     @ @(@; @H@^ !@ m$ @ t@$!@  @ @8@ @@P@!t@#@P 8 @ @q+4 @IB @+R @Rd @IpL @{d @| @& @0 @T @ @Yh @A @  @  @ @>0@B@nWd@$e@Uz@d@@@@L@@@u@/`@`@x f@$10@E0@[@j@qT@_{`@t@@Id@I @ ,@'@-@ @@p@/$6@0@_e@  I@B`.@ "@)0@. x@960@K@Rk@f @jqs@3x@D@*z@ @p@)@!@ @I@`y@@E@!@*p@I/@Ei@S<@e@0v`t@<}@@@@6@  P@GP@i@ @p@z@l!@ @90B@0@@I@'VA@j,@ p/@@#@Dp@@ k@9@@ П@@@ @@W0@ @ py@ @ p@K|@ &i@9@@t@QH@ O@_V @l @'yP@\`r@V@.@ @0@ Ђ@1 @@@7 @dp@"@%)@ 0@5@rB @Jp@^`@h@Un@u@Ju@!@0z@oK@*0@>0@6!@@;Pw@@ 8*@ H@* 0h@@% @4@+J@'f@oLA@aP@@&@@  @!@ @@@.@@A@N t@>@@@&<@)8@<@@!K@Y`@`@mq%@ {@RP@$0@mO@_z@ @G@/@ @*t@@Y ,@ @I $g@- @L@ \}@vq@Ew/@ ~@dJ@ @p5@) @p@j@` @ @@ @f ( @ @] @`*!@1p@ Af@8I/@Nl@o @|`@@@#`@@@1%@ 0@H@e@G@I0@."@/p@ DP}@#I@Q@@J_@"l@@y@@N@,g@І@@P@bP@P@D!@ u@ @-И@29 @ ;`@C@DOt@.V@de@Rk<4@*@ `@ K@'P@@ @L@"Н@ 1@8@y>@ F @+Z@@"r@zЭ@;@ @q @k@0@@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_starte2undo.cusageismounted.ctdb.cemaptdb_brlocktdb_transaction_locktdb_transaction_unlocktdb_lock_recordtdb_unlock_recordtdb_converttdb_munmaptdb_mmaptdb_ofs_readtdb_next_hash_chaintdb_ofs_writetdb_rec_readtdb_rec_writetransaction_next_hash_chaintransaction_oobtransaction_brlocktransaction_synctdb_recovery_sizetdb_rec_free_readremove_from_freelistupdate_tailertdb_increment_seqnumdefault_tdb_hashnull_log_fn_tdb_unlockall_tdb_lockalltdb_oobtdb_unlocktdbstdb_expand_filetransaction_readtdb_writetdb_readtdb_new_databaseio_methodstdb_alloc_readtdb_parse_datatdb_findtdb_key_comparetransaction_writetransaction_methodstransaction_expand_file_tdb_locktdb_locktdb_find_lock_hashtdb_exists_hashtdb_freetdb_do_deletetdb_purge_deadtdb_delete_hashtdb_next_locktdb_traverse_internalC.64.4017seen_inserttdb_dump_chainunix_io.cunix_get_statsfind_cached_blockraw_write_blkflush_cached_blocksunix_flushreuse_cacheunix_write_blk64unix_write_blkraw_read_blkunix_read_blk64unix_read_blkunix_set_optionunix_write_bytefree_cachealloc_cacheunix_set_blksizeunix_closeunix_openstruct_unix_managerllseek.ccom_err.cdefault_com_err_procerror_message.cinit_debugdebug_maskdebug_fbufferet_name.cbufchar_seterrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrncpy.cstrcat.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetopt.cplace.1334misc.cstat.clost_statinode_numuser.cwait.cwait_listrpc_child_exitutime.cstrerror.cerror_message.1085rpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrtok.clast.930memchr.cunlink.caccess.cposix_dir.clost_link.clibgcc2.cparse_pos_paramsputcharstrcpyinit_dev_listunsetenvrpc_send_responseyieldext2fs_tdb_parse_recordrpc_get_envvarswaitpidtmpfileppb_from_argvext2fs_tdb_set_max_deadext2fs_tdb_unlockallstrtok_rlist_sizerpc_get_responsegetgidprintfstdoututimelibrpc_rpc_handlerrpc_get_stringext2fs_tdb_errorungetclist_pushext2fs_tdb_chainlock_markext2fs_tdb_enable_seqnumsigemptysetstrerrorgeteuidrpc_get_intsnprintfio_split_dirname__strtok_rreset_com_err_hookext2fs_tdb_namemknodatolext2fs_tdb_lock_nonblockget_parent_pidlio_seekgetenvfchmodlist_poperrnoext2fs_tdb_transaction_commitstrtoldgetegidisblanksetlinebufgetsext2fs_tdb_lockall_markio_create_linkext2fs_tdb_open_exio_split_filenameppb_get_argctimer_cancelgetpagesizeio_get_absolute_pathfgetsext2fs_tdb_dump_allext2fs_tdb_nextkeygetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreattdb_nullinit_waitpidputsdup2rpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_emptyisattyoptarg_assertvsnprintfrpcstrtoul__dso_handleitoaispunctopterrreaddirext2fs_tdb_firstkeyjvprintfisspaceext2fs_tdb_unlockall_readfflushset_com_err_hooklist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddsetext2fs_tdb_reopenblksize_key__udivdi3setbufferabortprintf_putcchmodisxdigitext2fs_tdb_fetchalarmcom_err_vaext2fs_tdb_appendmessage_handlerstrtolpipestrnlencreate_shared_memoryrenameinit_memory_managerstdio_initcallocext2fs_tdb_increment_seqnum_nonblockinit_dev_registerstrtodlist_insertlist_destroy_et_listwriteext2fs_tdb_get_logging_privateatoffstatfprintfext2fs_tdb_lockall_unmarkkillinit_service_registererror_messageext2fs_tdb_log_fndirectory_createstrcatadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infochdiropen_shared_memoryadd_error_table__dtor_end__fseekppb_is_validoptindmemchrext2fs_tdb_storeext2fs_check_mount_pointjprintf_putcext2fs_tdb_traversestdinext2fs_tdb_transaction_startwaitsend_messageinit_envvarsumaskerror_table_name_startlstatferrorsyscall_psignalreadcom_err_hookstrcollisupperstrncmpext2fs_tdb_map_sizeadd_to_error_tablefpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocprg_nameset_rpc_handlerext2fs_tdb_fdrpc_send_dword_responsesync_rpc_response_handlerext2fs_tdb_lockall_readinit_service_getsnprintf_putcstrtoksigfillsetfdopenforkinit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullext2fs_tdb_chainlockinit_messagingfopen__bss_startgetoptmemsetmainext2fs_tdb_openext2fs_tdb_chainlock_unmarkremove_error_tableftell__dtor_start__init_service_get_nameext2fs_tdb_chainunlock_readclearerrext2fs_tdb_traverse_readfclosegetenv_name_by_indexgetcharopendirisgraphintr_handlerext2fs_tdb_lockall_nonblockisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsnext2fs_tdb_deletedupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcgethostnamecmdline_copy_argvext2fs_tdb_printfreeliststrtofatexitstrcspnoptresetext2fs_tdb_chainunlockext2fs_tdb_closerpc_get_dwordstderrsigismemberet_list_lockext2fs_tdb_transaction_recoverdirectory_closelibrpc_c_rpc_handlerfputcoptoptdivmodext2fs_tdb_validate_freelistpreadext2fs_tdb_exists__ctor_start__ppb_copy_argvwait_child_addunix_io_managerstatisdigitfwritemtime_keyaccessdirectory_read_edatadestroy_processcom_err_endext2fs_tdb_lockall_read_nonblock__ctor_end__mem_free_physicalext2fs_tdb_get_flagsrewindfreopenext2fs_tdb_lockallrpc_send_int_responserpc_response_handlerexitsyscall_timerext2fs_llseeksigdelsetsetbufmem_allocateext2fs_tdb_hash_sizeatoiiscntrlfprintf_putsnfprintf_putcgetenv_countext2fs_tdb_reopen_allfilenoet_list_unlocksyscall_vext2fs_check_if_mounted_exitregister_message_handlertimer_register_et_dynamic_liststrlenext2fs_tdb_set_logging_functionopenuuid_keytoupper__init_execstrchrio_remove_linkfputsext2fs_tdb_chainlock_nonblockdirectory_seekclosedir_Jv_RegisterClassesext2fs_tdb_chainlock_readlist_removefcntlext2fs_tdb_transaction_cancelext2fs_tdb_get_seqnummkdir__register_frame_infopwritecloseget_pidext2fs_tdb_errorstr_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/chattr0000755000175200017520000064640011517101521016175 0ustar tyndurtyndurELF@@4`4 (@@\\\\@\@ QtdSƝU=@t8v@ҡ@ut h@!@ÐUth@h@l@tt hl@ЃÐQSP UWVS] _:$E't&k0v<vkKEE$D$y$@u^")ċEt$|$ t$D$$\@=d@s& d@sBwҁd@rt$<$á@$P$^GÉ$yǍ")čt$|$t$$4yoUS5@jjhơ@GI@Ee[^_pF@ V^ZSPJZY5@j JU `@tEEPuu uf`@8 @U1ÐU1ÐUSf=й@y]f hɡ@W!ƒt:QjEPRй@E8tй@]f@ufй@̀й@=tk.t.9t1Թ@xhn@h@!NԹ@VJ.S.9u h֡@ thn@PMԹ@듍vUVSut e[^Ë̹@t NC9HuB9Ht=Ӌuй@t vVPh<@5Թ@>< e[^Ë Rй@u 1e[^à vVPh@5Թ@;1 e[^Ë̹@뮐USj ÃtIu(EC̹@̹@й@u+1]à Sw@]f]f EpuPh@5Թ@J;1 ]UE@EVfUWVS EЉU)ЉEuȹ@t6J]A%9u2JA%9u̹@t(J]A%9E;Aع@ @ߥf u$^_PSw 1fǁ׹@ =ع@ع@vA9u}cQmE)ӍS0A)EgfffEE)B0A)UE0Aع@e[^_ÍvJA%9uE;AUe[^_à R-uع@ @f} {Sع@USU@?t @Cu@[ÐU]Ít&'U]]u}CvMs5V tR@Ѓ@%=t&ftt]u}])믍t&@ @֋~t11҃9Љw~N1)=@@A)AVF ޭޅttYPtOAtU$@fP +PA +A9R $@G@@]u}]ËVfQ맍v9 @tQ9 $@t=tABAtA 1)(@,@A $ D$Xp$@뷋A @륍'U0VS ,@ (@d@d@9s։ D$ $oۉt11҃9ᆳމw1 AqA AA(@,@[^]Ív Ft&P|^~d@t&9t&wv|.~5d@t& @t&w0d@vwv|ލ~d@t&@@$&UWVSt&@@EEEMtы @! $@5 @Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5$@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf1hfL QA UQEyACKGDGE1ҍY@@ڃt )ÃfC:[^_]ÉE}tETF^05 @E;11FKAA y]YEAGDGFE @GG@ GG@GxUGPGMHGDGE1@@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0FCP X9<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Í@Ѓ@%=t ftu@ @1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUWVS ]f$nu<+E<-<0E}1EmfB;EJ~-$nto$+oV;E\$oH)ʉ}9}EE{ƍ4Ct"$mu$mu߉M tU :Uth}-@ [^_]Í<0Ct9u1ҍu[^]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]n&UWVS ]} &$ hu+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%Ģ@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$fu<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$eHAEEs{xC{$>eEE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @@t;=D@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$W1 f?[D$E@D$U$huɍFD$ ED$E<$D$U@FD$ ED$E<$D$@@v'UUE @@U]$UW V@S1ۃED$D$$D$ED$E$Fht&߃ t;>t[@D$ED$$gu˃1[^_]Í& tED$@D$$gE @[^_]Ív'U5#$p'@D@#@&@ =`@uÐUWVS }1=vL@t$$ct&9{uL@t$$c$ƍ [^_]UWVS }1 v9{t+L@t$$?cu [^_]t&L@t$$7c$ [^_]UVSL@$?ƋEH@FH@11&@;FwL@\$$buL@\$t$$cE D$F$S^[^]dL@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$f\$D$D$ E D$E$[]ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$Q UED$D$ED$ E D$E$UUc@@+@P@Ít&UWVS,EUMI=T@GT@P@ Eu&)ċE\$#D$D$$dED$ED$C$E\$t$ |$D$$Rt&1 &P@\$$$`tF;~uP@\$$(`E;u|;~t)&+YV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$\$ƋG 4$D$bG $"<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1$[$S]u]Í&U(E uu}}]EEEzP@t`$TÉ0E{C<$?|$ƋE4$D$*s \$P@$_]u}]%t&뙐U 0]Ít&U j0]ÐUED$X@$F]1tÍv'UED$X@$]1tBÉ'UWVS }1]v<$D$`t&X@t$$\uԃ [^_]0$C$$X@t$$\UWVS 1t&<$D$z`t.X@t$$B\u [^_]Ðt& [^_]É'UE1҅tPÐt&U$Ȣ@]]uu1ۉ؋u]]Ðt44$`9E r݉4$`t$$D$&$``4$E R`$맍vUE]utoU1u ]u]ÍvE $`$zƋE $_4$D$E D$WE tC$1s롸$+tE$_$E $_$҉CthtdE$__D$ED$$E $<_D$E D$C$X@\$$2\X@1$.C$#$U]]u$9\$D$$Ȣ@o4$؋u]]É'U(]u}D$=E$~]¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&@eUX@$MXÍt&'UWVS,EEE EFEEE}&$]EF$}]]]x;D$E$"EED$D$EE$|$FD$]$EEEED$X@$.XlED$ ED$E܉D$E$EE,[^_]'UWVS"ZD$0@$̢@X@$u [^_]ÐD$ D$D$̢@$EtЉ‹@ tljB9s&<$8\<$D$tt$<$\4$\UDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t @$@B(@Bt\1ۅt.@[^]É\$$ @Ht\$4$4u؃Hu1[^]Í& @F$@F(@1[^]Í&1 t&Ht\$4$t\$$ @p֍&'US`@]uu%`@1[]Í&$ti@B$7@D$`@1[]ÐUED$ D$$1Ít&'UED$ D$$o1Ít&'UD$D$$@>D$ D$$ @"@t&7@= @ud@ U=d@]]uu}} G~&@&]u}]Ív tՅt4@@C@C@C @C1t@G@G@G @G@1rfKUS]=d@t=G( t#M @ @[]Í&[]Ív[뼉'US]=d@t=GH\$$ @u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE]U(t&]Í&'UU ~ÍD$D$ D$D$E$1ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$A<É'U}׉$]ÉuD$4D$G!$D$D$$L$D$t$$G-G1G,w, O0tAG0G]G,@u,@G}1] US] D$֢@E$c\t[]v@[]Ít&'Uuu]}} D$֢@4$!t%$$]u}]Ðt&4$?tI$1@D$4D$<$GAGG,@,@G@농v'U(]]}} u$|$t]u}]Í&$D$բ@0 tԋG G\$ D$D$$kG0G$ 두U1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG0@\$$+Nu@ [^_]$آ@;ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f0@\$$MnU;uݡ0@\$$M [^_]fUED$$D$Í'UVSu1 t&;0tk0@\$$Mu$ PD$_D$@$@1D$ ;3CC0@\$$N[^]&'UWVSE}}Et[^_]1&;8t 0@\$$BLuމ<$1ۍt&;>tV0@\$$ Lu1D$ D$D$@$@:UFF[^_]Jf뿐UND$0=@$@0@ÐUED$@D$@$@@D$ g;@@UE D$D$E$<Í&'UED$D$$;Í'U$@81Ív'UEu1}]$;tL$O$fw7D$F|$$Ɔ<$]u}]Ív‰'UE$:ɃÍU]W:U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVS"E1ɉ‰EE#E$CËE$AStdfuC.C E\$$D11vD$xE$fBtXC$5GƋCt+rǍ&CC뗐t&$<@FƉ떍F$]EE$?AuE#&tcu :F/<$mED$E$At8_4$\$E$qFƋGu/볍&|E$BE[^_]Í&$XE$@D$E$+A8$v@@E$H@\$D$E$UBaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE`J@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$HDҍUUE $T$E ÐU@$?@D$ED$,ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$6؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$5؃$[]fUS@]U u$T$5؃[]Í\$D$ D$$ []Ít&US]$B\$$t@t$ 2[]Ðt&D$ǡ@$5ؐt&UVSD$֢@$M@ wD$ D$D$4$5 Ƅw@D$D$\@4$$@D$ D$D$$D$֢@$_@[ )wD$ D$D$4$ Ƅw@ZD$D$n@4$6$@D$ D$D$@$D$֢@$o@ wD$ D$D$4$ Ƅw@D$D$n@4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$n@4$ @vD$\@4$ @*D$n@4$ @U1]É'U]Ít&'UE@1] U]H&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$@F$Ɖ]u}]Íu \$KS<$/C $/U|$T$$#\$ D$D$@F$ƋC $/뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$! Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$4$0딍US$]u$[]Í&Ct$ELED$ D$D$@C$D$Ë@ D$E$C $裼$蛼E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$,1҄u뱍vC!C$뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$9$wt&tyvC!C$:vK9Crt$ED$ $sY&{Cft$ED$CC$sv'U]]u$)8U $D$T$ D$^$8]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$)@$)@@EED$ D$D$@G$Ë@ <9}sE<D$@D$E$C $f$^,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$s_utRu4ttG!9u܍f]v֍ovɍt͉$v胷G!9uIvvE<$ED$ D$D$@G$Ë@<9}sE<D$C $ (t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$o3 )čt$<$U39s@a<w%$ȣ@vЃ|+uf<$39rE1ۉ$3UT$D$F$kE$2t$ D$@$D$AU$w t Nun1ۉ<$̴e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$ 2$肷FU$T$p1$&dËFCFCF C FCFCFCFCF C F$C%C$$D$ D$$D$C%4$蟳v'UD$@$@Ít&UWVS] D$֢@E$~C$ D$@$N84$t$ D$D$<$uN@D$D$@$4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$G11[^_]á@D$T@$%@e@D$$@$@<@D$x@$4$ @ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$@4$-]$t$D$ D$D$$O$f&'U$~ÍU@tED$@$*1Ð3+@u@É'UVS1ۃ@uu!&Ѓ@\$$(uu[^]U(}}EU u1]]EUt\$t$ $T$y;EU\$t$ $T$5:]u}]ÍUWVS,E ]E@E܋EuEȤ@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$葵~8$t 1҃[]f[]Ít&'UWVS$k1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&U(E Ew@Ew@ED$ED$E$LÍv'UE D$E$ÍUuu ]]4$9~tu ]]u]9u EUE $ÐUMSU AA[]UES4]EEEEx@]D$E ED$E$_x4[]ÐUED$E D$E$ÐU}MU EtÐD$T$ L$D$@@$U $]t$u |$KA9rS׃r9w)uD{t&$t$|$]Ít& {܍UVSE0uEE] EuD$E]Ex@ED$E$(x9v0[^]Ðt&UED$ ED$E D$E$zÐUED$@$Ðt&UED$@$1҅t $U]&UED$@$1҅t $U]&Uuu]u1ۉ؋u]]Í&4$u$Pt$ D$D$É$UFu u0]ÐUSD$ D$D$!@$t@ MZ$w؃[] UED$*@$D$ E D$8ÍUWVS E}D$@$U v2t&D$@$U 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$ t<U$ Ɖ<$:9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$|$\$E$\$4$ ËE$؋u]}]Í&'US]$\$ D$3@$D$[]É'UWVS,]D$@$EU)čD$ET$\$$UE$zEtD$$3Ue$ $<@$)č\$t$$$D$A@$d2EE(&D$A@$4e܅e܉<$LUƍD)č\$|$$3/ED$D$D$$Du$$mE\$1ۉ$\e܋EetjU$ƍx@#)ċE\$$D$!U TE$近\$ |$D$C@$t$Ue[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$L@$r$L@$D$L@D$P$L@UT$D$$*$L@D$\$D$D$$D$ 荿[]Í&U($U@]uu}B4$8D$謓$U@$D$U@D$芚4$$U@ WT$t$$^$ \$D$D$$D$ Ͼ]u}]fUED$ D$D$^@$ÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$g@C$襩$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$踏D$$FFF D$D$$ta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$\$UT$M܉ $D\$E$FU F$E] UMV~HU1fC D$CD$EE$MC K9}MƋVT$D$U$薔F D$$ 4$%UE ]u$tD$E$^$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx顰@t9t)ȉ vt̅u@@@뵋5@9|͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$辆k9@u,@9|Qu!@vWu1]u}]Í&tq $[뛐@ȍ&'U]]u1t#1tr$k9@t]u]Ít&@t@ݐt&@̍t&US]$xu][]駅&U$]]uՈۉƋEFtM u:3C9@t؋u]]Ít&@9E @܍t&U ؃t21빉'US]t$$FU PC9@t؃[]Í؃@[]ÐU$@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUMVuS] u t&8utu1҉[^]Í&C)萐UVS]utU t&tu[^]Í؃tu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$諅tt$|$$蕌؋u]}]ÐU1M9t :u)]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐU]鷿U@]ÍU@]ÍUWVS1ۃ }9~t3@\$$gu@ [^_]f@\$$W$uȉ4$1 1[^_]Í&UWVS1ۃ}9~t3@\$$u@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$@\$ D$@$聸^ 1[^_]Ít&]F9tD$@\$ D$p@$I^1[^_]ËE cF[^_]ÍUWVS }@1 f9>tl@\$$u$Ƹt>@t$$@>@F@FF t&F [^_]u@fU @tÍs@@$@$@$Ðt&UVS@t519pt#@\$$u[^]Ít&[^]bf&'U(Eu]}t;$[D$4$NjED$t.]Ћu}]f@ލ&Et$ D$D$E $2D$|$4$lڅt떍t&U(Eu]}t;$諿D$4$NjED$"t.]Ћu}]f@ލ&Et$ D$D$E $D$|$4$輿څt떍t&UE]uu}} #tEt$|$$}t]u}]Í&]u]}]鼾t&@ÍUEt&D$ ED$D$E $谿Í@Í&UE]u\tVD$ ED$D$E $t]u]Í$u@Ӎv@ UE]t&UVS u ]00 D$֢@$0$ؼft^ErtDaDED$$t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$֢@$@@됍&15D$֢@$uLvEwfvEwE+D$@$v$苻@UE D$RD$E$0ÐUS]D$֢@$t$1[]f$xt$L1[]@ːUWVS]$茮E$ƋE D$@E$ye4$P UP()ԍ\$CHCL$t$$V\$ ED$@D$G$tm3tNe<$4$wU$we[^_]Ítu@t&븍@롍&@ 뉍&@yt&@aU8}]] u}$茨$t|txD$֢@E$ED$@<$EUBU;B@ E$ӸU$ȸ@4$Yv<$Qv؋u]}]f@΍&@딍&$D$@+tE1ۉ$t$ D$D$U$4$lt&e4$}PUP,)ԍ\$CHC L$t$$UUC\$ ED$@D$UB$OtB&vt ev@ftu@t&@ 뷐UWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1UWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS\@t1ېЋX@uX[bUngueltiger PPB! Usage: %s [-RVf] [-+=AacDdijsSu] [-v version] files... = is incompatible with - and + Can't both set and unset same flag. Couldn't allocate path variable in chattr_dir_procwhile trying to stat %sFlags of %s set as while reading flags on %swhile setting flags on %sVersion of %s set as %lu while setting version on %sbad version - %s Must use '-v', =, - or + 12-Oct-20081.41.3chattr %s (%s) ..%s/%schattrASD ac@di@jsutT, ---Secure_DeletionuUndeleteSSynchronous_UpdatesSynchronous_Directory_UpdatesiImmutableAppend_OnlyNo_DumpANo_AtimeCompression_RequestedjJournaled_DataIndexed_direcctoryNo_TailmergingTop_of_Directory_HierarchiesExtentshHuge_file: COMERR_DEBUGCOMERR_DEBUG_FILE/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ A?CWDGET_ENVVlrwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert :/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createX\@[@[@H\@[@[@[@[@[@[@[@8\@[@[@[@[@[@h[@[@[@[@[@\@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZf@e@e@e@e@e@e@e@e@e@e@e@e@e@f@f@e@e@e@e@e@e@e@f@f@e@e@e@e@f@e@e@f@Mn@j@j@j@j@j@j@j@j@j@j@m@Bm@j@Ok@Ok@j@Bm@j@j@j@j@j@Mn@Mn@j@j@h@j@Mn@j@j@Mn@t@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@o@t@o@o@o@o@o@o@o@o@o@o@s@o@Ks@o@o@Yt@__Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK Warnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt IO_ULINKlwIO_LINK zR| 'AB E<_AB Eh@U@@Ϡ@ߠ@@@@ʢ@@@ @ n@*@@@6@>@@@@I@@_@a@S@p@m@@:@@(@@@@8 @GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@ @ $ @ 8 @ L @ @X @0$ @`@9P@3#@1$@<$ @&@ '@F+ #@ .%@0'@g560,@!6`,@MN<2@yA08@F ;@7G`;@`K0>@0)L`>@9O?@dQ@@ Q @@XH@|vZ`I@[I@[I@_J@c`O@o `@(qPa@}{Pw@}x@x@?x@y@z@{@0@f@Sɐ@u @@{@&@0@A@@@KۢP@Qȣ@.@>: @-P@JЦ@@ۨ@9@ _@@]@@ܛ@'@_jQmainfgetflags fsetflags ufsetversion! piterate_on_dirAprint_flagsfX_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hookhet_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#Perror_table_name?%errnoQPinit_memory_managerfreeZmallocrealloccalloc#dstrtol1$dstrcat$omemcpy&memset '9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoulF+librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerE .timer_cancel8timer_callbackytimer_register0rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*56nsyscall_psyscall_v6agetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsN<7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killiAchmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat<FgetuidgeteuidgetgidgetegidGGvwaitpid,waitXwait_child_addqinit_waitpid`KxstrerrorY)L=seekdiryrewinddirtelldirreaddir3closedir_opendir'OZrpcsend_messageQnyieldRQ,io_split_filenameio_get_absolute_pathZio_split_dirnamedXget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"vZnset_rpc_handler#[yadd_intr_handlerJ[a)vfprintffprintffprintf_putsn+fprintf_putc_}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#c Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6o_exit2abortGatexit{exitiq 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintfF}{0vprintfcprintfprintf_putsnprintf_putc8}sprintf_putcQvsprintfsprintfa_assert;~]snprintf_putcvsnprintf!snprintfPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timerdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namelio_seekVcreate_shared_memoryopen_shared_memoryclose_shared_memory ɐysyscall_putsnqummem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6nwait_for_rpcv_and_wait_for_rpcc{ppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv& isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper0list_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspnostrncmpۢostrncpyȣdstrchrdstrcmp:dstrcpyostrdupЦostrlen(Qd__strtok_r strtokۨomemchrrunlink_=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatoaccess4 io_remove_linkio_create_link__udivdi3__umoddi3fQ@@q@h"intXI5Lf7e~t]%(e 'eoy.Z%1H id2# 3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzaHI3c-vl3d@@k@@q<b7IY+,M33t@ @h"intXI5Lf7e~t]%(e 'e(e)ex(e?)e*e+e,3"-e.e~0sy.Z%1id2#3#pid4#.5# 7#8z#>9z#:A#4 ,!|"S###   ]4j4 ` a#u b# c# d#  e# f# g# i# k# 6 l#$ m#( n#, o#0 Z<[#$\#pt@@27co^fpq7 =S@@3@@R st |3i{{3{p}tmp~fl 3 3@a@K3i3tXj33t\err3 3!&"""# $%%H3d@ @,.Xde.x&ret3#`  '9@add;3@rem<3@set=3@'>3@'@@',B3@'C3@'D3@afF@rfG@sfHĹ@    'i_`@(b70 ( 80(  Y3LWc @$ @h"intXf~t](O)Ox(O?)O*O+O,3"-O.O~0]yj4`az#ub#c#d# ed#fo#gz#i#k# 6l#$m#(n#,o#0oE*3 @$ @ R) ) buf+ O\ @    Y3  c$ @8 @h"intXf~t](O)Ox(O?)O*O+O,3"-O.O~0]yj4`az#ub#c#d# ed#fo#gz#i#k# 6l#$m#(n#,o#0o33$ @8 @ R2 2 buf4 O`' @   Y3c8 @L @h"intXf~t]yo(38 @L @!R''dk =3lJcL @ @h"intXI5Lf7e~t]%(e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4 ,!|"S###   DIR&K3L @ @M88ycdiride]dep]3len3ret3! >3]8] V C =lc @ @oh"intXI5Sf7l~t]%(l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  # <#:##  % .5 @ @Jf4v 4 4l6:?fp78:h V dd/ai@[ois @$ @Z!0:oh"intXI5hf7~t]%( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  :,    v  %2 @ @ 090vfmt0a1% %   %XE_ @$ @_MDxF  VP_$ @8 @xQI8 @ @\9vfmta%+ E9 @$ @K 9697vfmt8:%w  8F k\.`@ds$ @@Poh"intXI5Sf7l~t]%(l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4Kz & P#z#N:#    % 3#,#   &l {Q:$ @+ @ \:, @3 @ U?Farg4 @- @ ? fn?Y tmp?w fd: :)x:;a0 @@ et elU el2"a@@ 0et el:@@/ Z9e@@[ 9da af:tletg hatpi:cpj? !V@"6@>@msg#%$% H3ع@ h:й@ s0Թ@ V&  Y:'25ȹ@'6̹@ s@@o7]D%int >@@/ num,[ chIz iI p % % ? @ % buf@; A@@@  7@int k@@h h"intXf7Z~tyZ]%(Z IJ#K#Lh#Mh# Nh#OM#`OMYM#ZM#[#\Z# ]h#^h#s3z3  s cO nz i3   ptr3  3~ d s1 s2d nzokkxuxjqoZ  s c3 nz i3@@ @s@ ptrminM[maj-IhS@@`:@@@m`@{@~`@{@@@hh F@]@!v@@Z"h#sth( maj @@$\%m~$z&Y> @_@'=zN?3@a'pAIBhmajCTminDM8zEMFz`>@J@ZSS@X@P`I@K@`@@p`IDhr`@@L@@Ih&`@@p'z=ptrminMW z* I.hSS@@0`@@m( 8qs.$$P7BMqX`C@H@i`@@^&E @@' z' zW3p ~@@@@)R*b @*ac$@+LeM,3*f3d@*,g:(@*h:@*k:@*8l:@*m:@-q.AN @@ h"intXf~t]#]@@str"D""3-$]}%3n&Q'3 o Y32@@a h"intXf~t]&#@@1s"]U"|-$o ]a2 @@ inth"Xf~t]%(OA @@\:j: :ddstB`srcCtDdo}@   o   t2@@2 h"intXf~t]%(O}#A%Oy%<@@y\:c0:3 :d t=d2 c?z dstA o5 @#@ h"intXf~t]%(O#d@@s","dKlen$dj  o /@R@Cn.Os.C.O st0IKi1O+y;Oj ht5O YY ]`@@str3] 3 c @@=str 3@@i1s1s2@ @ɸend˽]̽_ͽ^neg3-3Voutr@  C   @0 @i end !0 @P @KendEVP @"@DDe D3 FV negG3!out @ 3"@"@!s1"@#@!13y #@%@h"intXI5Lf7e~t]%(e 'e 0Zzo y , R-#  .#  . /k k #@$@" jZK"jZ" j"il3a# qZ#< rZup< e$@$@# dA# dAR F4$@%@ $4 E5$ E GdiHZU$'HZs$  9%@%@$^i:Z' 6D@ 4@@  1@@  [ 2@ %@o'@ h"intXf7Z~t]%(Z'(#)o# C *zo   &, '#: (O#  Q a%@D&@$2 : `O$^ b2ic3% & OP&@&@'%y : NOS%^ P2iQ3% ,O&@o'@% , +% +Oid-O & 52&^ <2i=31&J #L@5 $OH@#k '@',@h"intXf7Z~t]%(Z 'Z 0|Ooz 3 pid4O# < 5O# z 6o# 7z#  8 '$ (*# )o#  $C *Ao  tpids|< sO'u3 v r'@'@D&pidp|< pO q;K b(@1(@p&pida|< aO a3 S@(@q(@&gpidQ|< QO RO C(@(@&pidA|< AOlenAo B;  A(@(@&c (@*@ '{pid|L' ;k'z o' ;'< O' { Kg\r'}A H!r 1 *@:*@(pid0| 0;z 0o 0; " 2! ;@*@*@2(#pid|^($ ;~($z o($ ;(%;(% (% O)& 3*@)+@)pid|C) ;c)z o) ;)3) )&l O0+@+@ *ppid|6* ;V*z ov* ;*O* ߉*' L+@',@* J|)+< JO_+z Ko+ Kz+ M Nz+(4 3OT@) :*a .P@0n 0,@Q,@1h"intXf~t]o 0,@<,@+  @,@Q,@,|i `,@2@hh"intXf7Z~t]%(Z 'Z3pid4O#< 5O#z 6o# 7z#  8 o   '(#)o#   C *y(VR)#*# +1  `,@,@@,'3l,R ͙ V  ,@,@,'3,R  C,@@-@,RB-iD3:-R EO @-@-@X-dR-i3-R - Z-@-@-R.R 5. e-@].@H.pdt.do.h.  3`.@/@/_R,/L/_ 3/R /.@.@  Y 3/@0@/ /3 0 #30@0@ 0str"L0sep$l0. .o0R/s 30@0@0  \0@1@0!pidZ|1< ZO 1"Zo" [z # ]zud# ^ouh# _oul _o@1$i`3upR a 6 61@2@S1U=|1 2@2@ AU1P2@2@>C1RKL1 #C -lX@ % Y3 2@)8@$h"intXI5Lf7e~t] 'ey  #A     3  # #} 3#0"  o 32@2@1s s273E2 R 33@I3@{2 s2732. &3P3@3@3 %7%3?3 >33@4@3^=33 =30=sS4i?34 os4@4@4b ns4idpZ`@ 35@%5@,5 sq 305@U5@X5 s 3`5@5@5i43 35@6@5csig35 c6oldrH6 i j 6@7@~6736  6\ H37@7@77G3A7 [7 g7@7@7 {7@7@7<7z38M k37@)8@$8w pidjz7j3P8G!: +w@!E , @!$-d@ " Y3 08@;@h"intXI5Lf7e~t]%(e 'e(e)ex(e?)e*e+e,3"-e.e~0syj4`a#ub#c#d# e#f#g#i#k# 6l#$m#(n#,o#0o.Z%1p id2#3p# pid4#.5# 7#8z#>9z#:A#4]4|  U4308@78@{8 T 3 3  TC3@8@G8@8  B3 B D3P8@Z8@8N T  ޾ o3`8@j8@8 T   u >p8@z8@+9  38@8@W9  ̾eR38@a9@9DfQD9KQJ9posSs9   |3p9@9@9 3*:KJJ:fD: jy39@v:@: T x:KxJ/;z3e; {D;:@v:@dir ; | 3:@;@;T <KJ8<3n<fD<:@;@buf}[(,@  Y3 ;@W;@h"intXf~t](O)Oy#d ;@';@<)d0;@7;@</o@;@G;@=5oP;@W;@.=S `;@&>@vh"intXf7Z~t]%(Z 'Z'(#)o#  C *o y  )  pid*|#+ #,3# BCCpidA|iC3DC nvpidm|io3pC+|`;@^<@Z=&pid|=& > 3->CA>x;@;@#._>7I <@T<@V8a}>j 3|`<@<@>X&T<@"=@>pidS|>VCoutf=@<@<@V#P.?70=@=@@&>@D@#00@ $ Y3NG 0>@`>@h"intXf~t]oyd>*r0>@`>@p@3)3+@@d ?  `>@?@h"intXI5Lf7e~m8wt]%(e 'e~0~y.ZZ/A%1Yid2#3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> ,!|"S### _  DIR&l%"R&"#!'#(l#)#9*#+# _2 -t`>@>@@sdirssas~ i>@>@@dirhsv]~>@>@@dir\sRC'>@g?@ A'dirBsLAD-lAJA~P'A w 253p?@?@A_dir4s*s?@?@BR) _V ?@@@h"2>intXf7e~t]orpc"?@?@4Bpid!Z`B #ZP 2>?@@@BDpid0ZB 0ZB < 0ZBlen1ZC 1zAC 33P :Th ZT D  @@@@Kh"intXf~t]o@@@@`C(!, @@H@h"intXf~t]%(Ooyo'(#)d# C *  &  Z N !/ 1&2#3#5&# o6ppcwd}=vf3p"pcwd}=vf(3i)3FvDlenEdEE=Gv oWi @@WB@ChChpC+h3CjugposkDfluhmul=nvDEwdD !!!!"#^A@A@(!!!!8"#A@A@[!!!!P"$B@WB@!!!!h" %}`B@ C@/E&[E=v'rp{E(B@B@'}E' dE@pi33=v)I:d9p;di<3==v_]pH]}8^ib3=cv%4}C@F@EZ&E=v*rpudf3'dOF'i}bF+6xC@C@r!C,NF"Y"d-|!,F,F",F,F-!, .G,)WG,4wG+@xE@E@!!RP"^,jG"t.E@kF@!!!,G,G/}F@H@G&H'b }9# :]# 4<# A=Z#! : ]O>]4`  O :  O  O  :(   v# 5#arg#Y##fp$## k4OI@I@Jfp3#'3ap3%a5 tI6h <OI@J@Jfp;#';ap=%>OP/OJ@ZJ@J%arg.% KN.-Kn.OcK  (O`J@J@Karg'%c':KU&fJ@ZO@h"intXI5Lf7e~t]%(e 'ey.Z%18id2#38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3 J@J@KYoJ@J@K3J@J@&L d3J@>K@RL,c3~L K@6K@cs>u{8@K@K@Lp8Lpos3Mc34Mo(3K@L@RMc3~ML@L@cs>u{3 L@|L@M neMstrY"Nh3L@L@dN7strYN/L@ZO@N~ 0N1~~2z&O>V>V)@$@b%@ &@ Y3  (f`O@`@h"intXI5Lf7e~t]o%(e 'ey.Z%1?id2#3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#< 5Z#z 6# 7#  8a 7id8#9#\:#;Z# (<?Iid@#A#\B#CZ#  DI# AX IEOyidP#QcUidV#W K  z& zres {K# |#%3 Vr2%13E%`O@gO@OOc8pO@uO@{O3O@O@OQ_3O@O@OT ^3O@P@O_+PH?P3P  _ ?out8O@ (R3P@P@PQ%M3P@P@)QLHL?LmG3Q@.Q@UQFHF?a0Q@+R@QsrcQQ\QR4RRR eRQ@Q@ R  A  Xz30R@R@R7RR3R@S@SuBS yp!3 S@S@xS"S#ZShsS@:T@Sg$T nposfT wT [N3@T@T@TdMTaMsUM32U$T@T@^U T@VV@U UU\UCVVg83`V@V@V:%str77<%3V@W@Vc$3'W$&ch&zu{B3W@eW@FWc3rWWE!pW@Y@W "p X"NX"\X"X#"Y \'@  lYY(X)'p  *Y,YX@hY@*i3Y+EF3Y@"Z@Y E&Z,cGz\Z ]?0Z@Z@|Zu p\?Z \3Z\Z,i^3[,c^3<[!tK[@6]@Z[ "T J["J[-L?up.msgR +SE*iW3[# ~\#$\/+ _ z 0@]@\]@n\zl3`]@)_@\ k\k\ Hm _nIo,srcq],dstxE]/ g] A 1!j0_@`@]M "]"]"B]#R'^+V-:-@-'.Z@-/@2 82  Y3*6f `@Ha@#h"intXI5Lf~t]%(Zoy'(#)o#  C * e `@`@E^ d3q^ msggd hzVi,A, 3IE`@`@^/M3`@`@^s Lus 1a@Ha@^ 03_ a@:a@i43?_ 5u =(@ Y3 ,fPa@Ew@]$h"intXf~t]!q{o3 d {3 d 3 { (  # 5# argd#]y.xO 0 B3:AOV{    !# ]#}'|buf||O2VPa@a@R_1V~_X1O_i1_3Vrem4OO La@zb@`.KV3`bufKd`KO`KO`pMuXN.u`sOV`POaiQOup 3b@b@amamGac{qa3b@Jc@aamaNan3bi3`bs3sb "3Pc@c@b!%b"'3b#-c@g@b!',%c$ap,fd%.ud"`/3.e%'03ul"03Ye"03e"13f"23Bf&i33f#X3g@Ew@f !amf!'g$apfg&ti"s3k" {:l" O;m"!Owm" "Om"L#On's$O"%3p"&Jp(a?g@)&ret23p) &ret=3p)'"Nq)P &len3[q&pad3r)e&ret3s*5v@av@&ret3xs)&ret3s*i@Ai@&ret3"t*u@u@+ret3P)&ret3wt,v@w@&ret3t,mp@p@&ret3u*i@i@E&retX3`u)-bufl %m])&ret~3u.0}/0u1])X +buf "n3v) &len3w*v@v@+ret13P*o@o@!&retH3:x*Ks@ps@?&ret 3cx)Y&ret#3x*s@s@w&ret?3x*t@-t@&retC3y*-t@Yt@&retE3>y)&ret-3\y)&ret3y,w@5w@&ret)3y*m@m@ &ret^3Pz)(: ":nz)XT "Vz*p@p@r &retS3{&retY3B{) &c{{&ret3{,=o@Jo@+retc3P2{ 3 45{6 B,.@fPw@ x@'!0:oh"intXf~t]yO :O O : (  # 5# arg#Y<OPw@w@{c';ap;%J=l!COw@w@|'BapD%EOP,Ow@w@A|arg+N+m|n+O|len-O%Ow@ x@|arg$c$:}/`fx@x@h(!0:oLRggn:int {gng : (  A# 5p# argn# J  H!# s" #:~-&gx@0x@$}Karg%Kc%:W-g0x@x@P}H,|}',}ap,%}a.l:/`0g}X<gx@x@}H;';ap=%>gP 1ufx@x@(oh"intXI5Sf7l~t]%(l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K ~'x@x@&~ %R~  %}~ %:~ j&:~  % 8 Vz1fx@y@)h"intXf~t]%(O!|o3 o 3 o 3 (   # 5# argo#  "W H#W# $d# s%d#)3x@Ty@~arg(c(U C3`y@y@!HBWBd'BapBq9aD dEXF3YU3y@y@lHTWTd'TapVqW3P2fy@z@,*oh"intXI5Sf7l~m8~t]%(l 'l~0y.aZ/H%1`id2#3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %R&#!'#(s#)#9*#+# %  -$!!b #' l -%*:P)!y@ z@n Cz@@z@Āb B'D w2@z@Iz@.DPPz@z@Z?b O'dirQ!Vz@iz@Q)e2oz@|z@S1>:z@z@ā=!a==:0z@z@/!5R 84 z@{@7+h"intXf7Z~t]o@!z@{@p:  O  O4{@+@+h"intXI5Lf7e~t]%(e 'eo 3 pid4Z# < 5Z# z 6z# 7#  8y CHJE RKE# !L3#@ Mz#D ~NU#H U? Adk3{@a{@gres3Ȃ ۂ3p{@{@devz{@ |@%SaؒQSqzpos33|@}|@σay&3uppos39 |@|@La3xsupret3 %C}@7}@QRBl@}@@;cmdk#k3%pidmQpzuhq;urulyzlz JWYdir߅ czh J Y h wX@9@1W3NYmsgZ-1@@@]R0N2msg3 QN@+@pidM]60@@-h"intXI5Lf7e~m8wt]%(e 'ey.Z%1Cid2#3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#aJl#K3# Ld V .0@@ - a-l# -3 /d7 @@-h"intXf7Z~t]9%zo$O@@dO idOz@Ӂ@ idO oχ @@ idO7O @@g.h"intXf~t]otdA3@@nOsni68h @@.h"intXf7Z~tyZ]$h9%o&'#V(z#) !  O  O ptr" @a@:.  h[1p@@f0O 0O ptr2@ 2X pw7@@6O+6O 6O ptr8G3@̂@3FFOHO UЂ@@TTOP9 @ @o/h"intXf~t]o@@) @ @U9,@@/h"intXI5Lf~t]%(Z)3 'Zo U$  #  ) !*# +z# len,o# /& num0o# 1&#5 d4z ppb5z# 6o# 7o# G8o# QoldP#PoPonewRAp>b?5Y@|@YppbzoaolenoCoi3Q 3@փ@ppbz̊oi3R3@J@*+ppbzVo+3 i3Qarg 3b3b`!`alenao Pco 'd3newe!"""!#$43bshm3 opi3 3 az 3P@@99b"shm3Kp9w%p & #%1 "a"V"K"B& 'l#w#(@@k"""& #) "&( ##''ތ''#?@@<* Ţ9hshm3retȇ+ Y3;?@@1O4AAc3Aint_9Adc8A/ AcAw*Ac)AHAcGAgMAcLAd@@vW%A@@ڍc$A @O@; 2/AP@i@hec.A%p@@7H@@ZG>A@އ@ c=ACA@@7 cBAc@$@0@D@3oRAP@@ڏ cQA [@b@Sv 1 Hh@@S 7WA@@% cVAQ\A@ň@p c[AaAЈ@@ c`A< X@1@1h"intXf~t]%(O'(#)d# (##$o# C *q >N@@ M2  (Vd@1@Q7 U} @@@  '3R*n3t o@ۉ@ ɒ '3ݿ Lo@@HH'3~ o&H (ݓ o@@ =osB@)@ A 0@@'  '3J o@@ĕ h@@n g goP=m 26@1@p7+@,3@-@>2@@@2h"intXf~t]%(O&zy%d@@@s$Ȗ$s1* bit+o tbl,Lidx-3&  o o>2@K@43h"intXf~t]%(O%3@K@9s1#es2#n$dїo3?2P@@3h"intXf~t]%(O*P@@dst)src)^n)d` d,Qs-R o  ?2@ލ@3h"intXf~t]+@ލ@טp*ch*3.c,Qo)@2@@/4h"intXf~t]*3@@Bs1)ns2)o@2 @M@p4h"intXf~t]# @M@ϙto""-$o  A2P@@4h"intXf~t]%(O &P@@Estr%qlen'd'( o  A,2@@5h"intXf~t]%(O5$d@@šstr#s%R oMB<2@@[5h"intXf~t]Q2@j@ s19K1h1E3!tok3?c43ssc43 c@ o   \`p@@ s_K_ha@Bm2@ُ@5h"intXf~t]%(Ov)@ُ@Ŝs&c'3)n(dkx p+R    AC @@6h"intXf~t]yo}'3@@T 'k9C, @җ@O6!0:oh"intXI5hf7~t]%(:" '*,Oy.v%1uid2# 3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  *   B  '  (#  )#   C *'8 (8#fd)O# +O# ,O# dupO@@kfdOO@$@fdOOO0@@fdO:iO| O@@fdOƞcmdOdiOΟ4@d@sap%argOp@@ap%argO+PO@~@>O8j\i]O:@˒@Ơ U~8В@"@7fd}O!iOR0@ܓ@pfdObuf";ܡ"a# 84#$Rretp $@@ZfdOŢbuf";"a%# 8]#${ret@@£fd~O"a~"~O[# 8df@Y@Ѥ fdeOHee# g8o H`@@;fdGOg"HG"G˥# I8#Q-8@@K%fdO& ':O@@wT  O(lJ2fdO[# %8) af 8@@|f8˧* f8+:,-`:O@җ@3T 99(f0@ (n3O@.68.b78. 88.  YOPFv @=@8h"intXI5Lf7e~t]%(e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K &3@=@_ %%3f)ب dir-  V d Y3=G% @@ۛ@9h"intXI5Lf7e~t]%(eo 'ey.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z [#\#^z#R_#  a= `dcd#fz#Rg#  ah 3@@@@3] ?ulO ?@ z*z=H  V  a  33@ۛ@Q1}1ͪj 2k431 56-O G?] H?o@ M@B@@ۛ@mznzHor  a  Y3PH s ܛ@@:int~]ohf" % ,!X!t! ! %!    low`# `#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k!_ܛ@@.n^Zd^z `A7- LWbmx 7y&Rpt`4@7@@@ѯI s @c@q;int~]ohf" % ,!X!t! ! %!    low`# `#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k4!S@c@#uROvRwT( VA7-@ LWbtPm0xoܱ>rt@x@ԝ@c@ϲ% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ >  : ; &I.: ; ' I@: ; I4: ; I&I.: ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I: ; I.? : ;' I@: ;I4: ;I 4: ;I4: ;I 4: ;I!1UX Y"1# U$41%41&: ; I '4: ; I (4: ; I? < % $ > $ > : ; I : ;  : ; I8 $ > .? : ; ' I@ : ; I 4: ; I : ;   I &I4: ; I? < % $ > $ > : ; I : ;  : ; I8 $ > .? : ; ' I@ : ; I 4: ; I : ;   I &I4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I  I&I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I.? : ; ' I@: ; I: ; I 4: ; I4: ; I4: ; I&I' II% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ >  : ;  &I .? : ; ' @: ; I: ; I4: ; I4: ; II!I/ 4: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > .? : ; ' I@: ; I  I&I% : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syschattr.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hstdio.hstat.herrno.ht@jWT_g[C0QXYAluY fjb /<Kȟ! ֟0 Y&=~.XUֿNK=hK~"glcyctju~w?zK="vt=L f1r(yz> /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysfgetflags.ctypes.htypes.hstat.herrno.h @)3< /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysfsetflags.ctypes.htypes.hstat.herrno.h$ @2.<=$ fsetversion.c8 @'< /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeiod.cstdint.hstddef.htypes.hio_struct.hdirent.hL @حBYvf hXn /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includepf.cstdint.hstddef.htypes.hio_struct.hstdio.h @4jKxy XKtȮx9 f!o  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.h @1=g.gZKk90=YG.uKhNK1=sxXu$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XD9 strcat.c@"?8 ../../includebcopy.cstddef.h @==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h%@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h'@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c0,@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h`,@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h2@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/p ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h08@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]9 ../../../includeuser.ctypes.h ;@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h`;@i+@)h#  ../../../include/arch/i386../../../include../../include/sys../../includeposix_dir.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hio.h`>@gsgrgcg;?+g,02zt4Zd/Yvcgust>hC ../../../include/arch/i386rpc.cstdint.h?@!X@Kxx< [3 sleep.c@@=xM ../../includelost_path.ccollections.hstddef.h @@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hH@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c`I@=gP ../../../include/arch/i386add_intr_handler.cstdint.hI@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.hI@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.hJ@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h `@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hPa@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hx@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.hx@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hy@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hz@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h{@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h@?Dx ?Dx =3 puts.c@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h @ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=H ../../includelist.ccollections.hstddef.h@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.hP@)Xg[ye_; index.c@*\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@(JgKwp@6 unlink.c@&?^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hܛ@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@3AB A4@(AB T.4@HAB DG.D4@ID  F AB D...E.Y.E.{.(4d@AB FT._.J.|  @AB | @$ @AB | l8 @AB |  L @AB FE.|   @AB Fx.|  @ AB G. @$AB $ @AB (8 @AB F].].O. @8AB ].| $ @AB , @AB (4 @AB DY.\.j.W.X. 0 @AB BV. @AB DB.N.u.@AB J. @AB F.| @9AB A| @AB @AB FI@AE E @?AB F`@VAB F@3AB D| @AB F| @<AB AD|  @AB F| <@AB F| p@9AB p@AG Fp`@hAB Bp@AB p@ AB p@AB Fp @ AB p0 @ AB pP @oAB Fp"@#AB p"@!AB |   #@vAB FIF$@AB  $@AB AFF%@>AB | 8%@dAB F8P&@oAB F8&@AB E| '@:AB D(@1AB @(@1AB (@0AB (@AB (@IAB F *@AB A@*@AB ON*@YAB X0+@YAB X +@AB IFF| 0,@ AB @,@AB | @ `,@&AB @ ,@'AB @ ,@AB F@ @-@gAB AG@ -@AB @ -@AB MF@ `.@_AB L@ /@GAB FF@ 0@AB L@ 0@AB @ 0@AB F@ 1@AB F|  2@IAB D 3@IAB D P3@IAB D 3@AB E 4@_AB D 5@%AB  05@%AB  `5@aAB  5@AB MFF 6@WAB D 7@qAB D 7@AB  7@"AB  7@IAG | D 08@AD D @8@AD D P8@ AG D `8@ AG D p8@ AG D 8@AB  D 8@AB FHED p9@EAB DD 9@AB FI D :@AB IFF| l ;@AD l 0;@AD l @;@AD l P;@AD |  `;@AB C `<@#AB  <@AB E 0=@AB F >@&AB | 0>@0AB | `>@"AB >@#AB >@AB >@AB IHp?@AB ?@ AB | \?@AD \?@DAB E| @@ AB |  @@7AB C`B@AB FC@AB FF@AB F| hH@ AB hH@AB hI@!AB Dh@I@ AB hPI@ AB | `I@AB | $I@AB | PI@;AB PI@!AB PJ@JAB IFP`J@"AB | J@$AB J@AB J@ AB J@NAB D@K@AB BFK@NAB D L@\AB DL@kAB DL@jAB H| `O@AD pO@AB O@AB O@ AB O@AB DP@+AB P@-AB Q@.AB 0Q@AB FK0R@xAB DR@aAB D S@AB FFS@AB D@T@zAB DT@#AB  T@fAB IFF`V@RAB FFV@EAB DW@UAB FFpW@UAB FY@RAB D0Z@AB II[@6AB C@]@AB `]@AB I0_@AB F|  `@bAB E`@AB `@GAB a@HAB B|  PPa@dAB FLGPa@AB FPb@'AB Pb@AB FPPc@EAB APc@0AB FPg@uAB C| <Pw@6AB <w@AB <w@@AB FF<w@AB | x@ AB D0x@OAB Gx@!AB | x@?AB |  Hx@dAB FGGH`y@[AB HHy@(AB | y@AB z@0AB @z@ AB Pz@0AB z@ AB z@`AB FF| dz@AB | {@QAB Ap{@*AB {@mAB F|@mAB BC|@rAB FI}@7AB D@}@DAB F@AB D@@AB PF@+AB | 0@fAB D| @AB @AB @AB | T@AB |  @AAB LFp@AB @AB @AB Ђ@AB | @ AB @ AB | X@lAB CX@VAB CX@jAB FXP@`AB FX@HAB L|  @AD  @AD   @/AB  P@AB  p@AB  @AB  @.AG  @/AB  @AB  0@AB  P@4AB  @AD  @AB  Ј@AB | p@AG p@!AB p@@yAB HFp@AB  p@AB FFFp@lAB FFp@)AB Dp0@AB MFp@OAB Dp@!AB | @@AD F| @KAB DD|  P@QAB B| < @.AB | h @>AB A|  @-AB A|  P@JAB FI|  @AD | (!@AB BD(!p@"AB | t!@9AB A| !@ AB | !@AG !@AG !0@yAB C!@ AB C!@AB F!@KAB !В@RAB AF!0@AB O!@AB O!@tAB LF!@IAB !`@AB L!@ AB !@AB E!@"AB | #@]AB D| #@@dAB F#@+AB JI| $ܛ@'AB E| L$@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutflags_arrayst_inod_reclenretvalset_versionmaind_namenlink_toff_tgid_tget_flagflags_charprivatest_blocksprogram_namest_uidblkcnt_tuid_tst_atimeerrnoGNU C 4.2.2st_modeoptchardirent/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscdev_ttime_tst_nlinkend_argdir_namest_ctimedecode_argst_rdevchattr.cverbosest_blksizest_gidchattr_dir_procusagechange_attributessilentstderrmode_tst_devblksize_trecursivest_mtimeino_tfgetflagsnotsuppfgetflags.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/e2pfsetflags.cfsetflagsfsetversionfsetversion.citerate_on_dirfuncmax_leniod.cfirstlong_nameoptionslong_optpf.cflags_nameprint_flagsshort_namecom_errnew_procreset_com_err_hookcom_err.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etpvardefault_com_err_procerrfwhoamierrcode_tcom_err_va__builtin_va_list_et_dynamic_listtable_numadd_error_table_et_listremove_error_tablen_msgssafe_getenvoffsetdebug_maskdebug_fet_list_lockstartedet_list_unlockdstrerror_message.cadd_to_error_tableinit_debugerror_messagebaseoopsnextnew_tablechar_setet_name.cerror_table_name/home/tyndur/tyndur/src/lib/stdlibcerrno.cdiffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountmajSizeendptroverflowstrtol.cstrtolstrcat.cstrcatsave/home/tyndur/tyndur/src/lib/stringappenddst0memcpy.csrc0donememset.cu_charu_intpositivedecimal/home/tyndur/tyndur/src/libitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumumaskmkfifostat_buffchmodinode_numlost_statmknoddevicefstatstat.cstatuslstatmkdiruser.cgeteuidgetuidgetegidgetgidrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpiderror_codestrerrorstrerror.creaddirio_direntry_type_tuint64_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirsend_messagemetadatayieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdinio_resstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadoriginshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexsprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.cisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigitlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrncpy.cstrncpystrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrunlinkunlink.cpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initfdl_elementfdopenlseekpreadfd_list_elementF_GETFDnewfdfile_flagsold_posposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdaccess.caccessio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu3tP*S,3P45u57u7\t\]u]_u_t\hPhSSStxwtx%ntxtxuQuutqtTqtP:SP!:P:WWDtlDXPXtlV4V4>SFfSS S VPScVPVVPVS1:V:?P?DSeoSoVuut=_tt VsVlqPuutuutuutuut@@tt9@V@DPDVPVD]PPG]RBWWWuutWtWtW**]t ]bbt t tVVV&tptpuu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Sttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQtt<u<Q9S9<u ttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qtt uttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Pttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_Ph :oh:o|*r  ,*3*@&(&(*@&(*@*A$p\\X_r02 (:(:@O/25;$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)038X8L0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'@-@] 5@\?\@\Fd@dMl@lR@ X@h ]h.fu6KKK<`$08>!Z ) X  0 P:@@@@@\@d@l@@ @     \@d@(@;l@H@^@ m@ t@@ `@h@X@l@d@P@!t@3`@h@( @ @H(@ ,@ 4Ĺ@ 7@ C@ K@ Ud@e@ i@ l@ p@ w@ z@ 8 @4 @й@ Թ@ ع@  @ @@)@ 6@ I@ Q$@ [@ j @ t(@ @d@ D@ L@ H@  '@'@4;(@IDT@ [`jX@ v@-@g @  `@ 7@`5@a@ d@ 8@,@ 0@ 0=@@@@ &28@L @@7^o@ 0Q@@ @ @ @ Pc@E (4;BRYhw@@y@ @ @  @ $-;@ C@ K@K\В@Rgp||c@0J@N @-{@Q,@(@0@@ 0@`;@@]@P@`@" @! *@'@;@.w@5@ <0x@OEp'@X@*@gL @vW@U}@O05@%0>@00;@*@Yy@(F@@$ @`8@ `@hH@0@f -@@8@@l"@ (@0P;@8P@@P@+K@K@P@+_`B@q@V~%@dC@0Z@J@ @  @@@ O@P&@o`>@"J@$ @" >@& L@k @ '@:7 0@? @G ;@N >@#X @Hc R@ah @?o O@ v @ x@? `y@[ ?@ "@! @ @ P@4 >@ g@u @/ 0R@x @$ @ $@ y@& 0@- @_7 @t= 2@IG ܛ@'Q P@-[ `@a w@m 08@s x@  @/ 4@_ @  @ @ @9 @ `]@ $ @ @ L@j @3 p{@* 0 @  0@* @)7 ȹ@ @ @IF @K p9@EQ I@!Y 7@I^ @@t @ z@0 @< I@ (@ Pw@6 P8@  /@G @ @ l@ @T@z! @l. @95 b@'B @ H `<@#M ?@DZ 1@g p8@ m @9~ @@  :@ `O@ 0,@  6@W `@ `@ @  @ @K @ O@ P@Q @  `.@_ @ ,@' L@\& `@V. `I@> @(@1V +@p }@7 x@d p@" 5@% @  |@r @ @ 5@ pW@U P@J @! Pz@0P @o %@>[@6h@+@2@I70 @JS@Pd@_@+upO@~ S@`,@&J@?@ @@@ @.@ @ @AK@N@>a@w@@ @I@!@--@4|@mEP@ OY@RUx@!]{@mo @ v`@G}@@0+@Y@ 8 @P3@I$ @@z@  #@vV@EPa@d@\@@j<@#9@(p@0T@f7@]>z@`Mh@T@I@ d @8l`@qd@~Ђ@T@#0_@(@1@@ a@Hz@3@IQ@.p@"@#@J@J`J@"#0@0@7, @F@,@P `@bV$@o&@~̹@ @@Ј@ @@}@D@.@@d`V@Rz@ p?@ @ @ 8@ /0@60@y<H@ D7@"\>@dI@;mPI@ y7@q@@3@b@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startchattr.cget_flagflags_arrayusageprogram_namechange_attributessetverbosesfset_versionversionrecursivechattr_dir_procremrfaddsilentaffgetflags.cfsetflags.cfsetversion.ciod.cpf.ccom_err.cdefault_com_err_procerror_message.cinit_debugdebug_maskdebug_fbufferet_name.cbufchar_seterrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrtol.cstrcat.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedstat.clost_statinode_numuser.cwait.cwait_listrpc_child_exitstrerror.cerror_message.1085posix_dir.crpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrncpy.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cunlink.cposix_files.cfd_listnext_fdposix_files_initfd_to_fileaccess.clost_link.clibgcc2.cparse_pos_paramsputcharstrcpyinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileppb_from_argvstrtok_rlist_sizerpc_get_responsegetgidprintfstdoutvsprintflibrpc_rpc_handlerrpc_get_stringiterate_on_dirungetclist_pushsigemptysetstrerrorgeteuidrpc_get_intsnprintfio_split_dirname__strtok_rreset_com_err_hookmknodatolget_parent_pidlio_seekgetenvfchmodlist_poperrnostrtoldgetegidisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatinit_waitpidputsdup2rpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_empty_assertvsnprintfrpcstrtoul__dso_handleitoaispunctreaddirjvprintfisspacefflushset_com_err_hooklist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddset__udivdi3setbufferabortprintf_putcchmodsprintf_putcisxdigitalarmcom_err_vamessage_handlerstrtolstrnlencreate_shared_memoryrenamefsetflagsinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroy_et_listwriteatoffstatfprintfkillinit_service_registererror_messagedirectory_createstrcatadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infochdiropen_shared_memoryadd_error_table__dtor_end__fseekppb_is_validmemchrjprintf_putcstdinwaitsend_messageinit_envvarsumaskerror_table_name_startlstatferrorsyscall_psignalreadcom_err_hookstrcollisupperstrncmpadd_to_error_tablefpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopeninit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullinit_messagingfopen__bss_startmemsetmainremove_error_tableftell__dtor_start__init_service_get_nameclearerrfclosegetenv_name_by_indexgetcharopendirisgraphintr_handlerisalnumisprintprint_flagsmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnrpc_get_dwordstderrfsetversionsigismemberet_list_lockdirectory_closelibrpc_c_rpc_handlerfputcdivmodpread__ctor_start__ppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_processcom_err_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenoet_list_unlocksyscall_v_exitregister_message_handlertimer_register_et_dynamic_liststrlenopentoupperfgetflags__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClasseslist_removefcntlmkdir__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/mkfs.ext20000755000175200017520000000000011517101521025211 1packages/e2fsprogs/bin/mkfs.ext4devustar tyndurtyndurpackages/e2fsprogs/bin/mkfs.ext30000755000175200017520000000000011517101521025212 1packages/e2fsprogs/bin/mkfs.ext4devustar tyndurtyndurpackages/e2fsprogs/bin/mkfs.ext40000755000175200017520000000000011517101521025213 1packages/e2fsprogs/bin/mkfs.ext4devustar tyndurtyndurpackages/e2fsprogs/bin/findfs0000755000175200017520000302760111517101521016160 0ustar tyndurtyndurELF@@4 4 (@@@@ PQtdS.1U=@t8v$@ҡ$@ut h@!@ÐUth@h@@tt h@ЃÐQSP UWVS]  t&;vvKEE$D$%y$2@")ċEt$|$ t$D$$%@=@s& @sBwҁ@rt$<$~á$@$$É$Ǎ")čt$|$t$$4oU¡@=@u =@t 9Pu@ 1ÐUS] t[U 5(@h2@5(@$UVSuE Sv0xN+Y1q F$f@ XZSVOF@ 1e[^fUWVS@Ӌ@,P\DH`HpdL\PEPEPh<@h0@PSd gD,G\uIl@H,@`,K,fD u?,B\ t3uƂ, SR_vHtPADLEPPGul@Ha,HLu#P\u xd] @ I L1Ȩu,fg:5hB@h >@l@W\9D@Oe[^_Ð,G\@u @,`\HP3Be,V\D1ШLLpg1PfH,;J`HL;rd9>v h>@c,P\fH` S3]@AVhVSQ17ePVS@׀@BǀJJ5,@`hW@BPb_ Wh=@jXLEP5 @@wjhX} UB@`QXh=@5(@`@Fǀ P-WN5$@jjh=@EX|[v @A5(@jMjh5@$vSh4@P5(@^JBPhQhjPRtGRh5@P5(@% @FgXh h9;M95(@jjh(5@> @@jh@jjj@@ PhjV詋@G"GfEU]PRa Ph3@5(@( jl jk9 R\DžT1ۋ@~h0TT9\hع0uˋ\ItFhXljޥ484848B;\uŃ QTE@PhQhjPR Whx5@P5(@fPRn` Ph3@5(@PSh3@5(@5(@jcjh4@$ 5(@jYjh4@$5(@jajh5@$ShZ=@P5(@*$5(@jjh=@$Wh=@5(@j/jhH5@bRh=@Qhv=@fUVSË@@\@ P% h]@j5@r$^XEP5 @sjh5@衙 t:5@hx6@P5(@G@t PBx j5@h6@Q Y5$@XZuSRXuD5@h6@V5(@넋5@u S e[^f5$@jjh1>@Y5$@LXZS5@ 5@PSƃu|5$@jjh+>@l@uc Si e[^f5$@jjh+>@ S@ e[^5(@j&jhP6@q5(@j ) h6@V5(@$IUWVS PvX V@@@@ PHA(YDž$fa:PEPhJ>@ }-`u @&Dž(1 B$(DË Y($9rNvS5lGC9t3S p0^kuσS r0lC9u(( 9YhA9x sqDž` @Ӂ@u$ىɋAB Q9u@u܃ u-`e[^_H1@$U q3xƃ  BX;XD}C B9XSFjtWjS ,%`u싍 q0j$wƒXEB @PB@@ BPVjSPR`u' APVjuPR`" VsiDž`F+Z Vs`@E A@PvƃtPEPj 9{ÃhPW]SuoÃuv]f}t׋EЅt%9tljEQWu uÃu8 WĶtjh@Vju /à s Vr`RDž`F+ Vr ^(NFPLDž0@(DžX1 Suo Vu,g,4 R&Dž@+00 S$@D@u4RjSj]uRE0hj>@jh>@$d>@t5(@j(jh7@X$\ P$GvL$qUWVSQIt t(@ hF@ X0Dƿ>@8` 2ƿ>@8GC j?qz@t @@Wjpj @@`@ @1vSURjj5@5@5@ l X@EPJLt@9s9 @ Q4z$?@"ÃU?@`EP``@hl@5@y3UJ @ $@ (@ 0@ 4@> @@e =H@t:t@A9>PEHRh9@8=,@5,@!T@L@ <@ =D@D 5@t$]QjCPV_ K@tED@tE쉅 1QmSx:Dž`f@@ YB` h@@I:Ӄj,SwEgMAj=Svt @޿@@EB` h@@,IZ h@u @tEP@B X@tAl@E`@"5(@jOjh<@=8@!5@2@t*@pEHRhA@d hF@Yu4eY[^_ɍa@<@A@%ZX@9RPh?@5(@$-RX9w5(@j*jh(8@$;jSLh?@Sh?@Pj_XjRu Q脒 `@$7 QhT8@ ^f; ug3v?@@@ttPjEP|£@E8u`Ph@@5(@4aDž A@ P3S}@Vh>@hH@h>@EĉtfPh7@StC0v ׍v$A@@C9K9C@Xj?@4r@t@@@Vj4j<@L@4hj>@jh?@$Y@@ PjUR{£@E8@5@hUA@=8@ X5@@fdEHRhmA@;=8@L@@@ A@  Jƒ8 ASRh<;@Hv@tPh%?@j5(@(D@@@cPj MQ5D@ey1RP,$x@E8q lB@Eu 5D@h?@j5(@@@"8@@u @@D@@P@@T@ D@a?@ jo\@@T=@tVhC?@j5(@BD@@@D@@D@'D@@<@ @ 5D@ @PjMQ5D@w@E8@Bu@X@jD@@ @TPjUR5D@Vwp@ud6MDD>>4@@,@D@>@ ~f@(@QjUR5D@mh£d@E8> d@u d@ @@:PjMQ5D@~ 5D@h>@j5(@$@@ 5D@u,@@QjUR5D@ut@E80H@@q|@ 5D@h>@j5(@Md@fA6JPh8@$@;h@fP4EHRh8@(@@fQ@ ;f@d5D@h7@j5(@f5D@hx?@j5(@u05D@h>@j5(@IhO@S^dus hP 8)p@P@Ph@@S5(@ jGvh9A@Scuc hP7U>@Of@5@h8@Ph0@@H$hPS7Ph@A@j5(@ $5(@j!jh@7@k$orhj>@jh>@$I5(@j.jhH:@%$)QЃxPjh*@@$F@$RVhd@@5(@j+jh:@$VhA@5(@;hh>@j5(@l5(@jEjh<@d$hRh9@UEHAD1RP,$5dF@$A6PhtB@ÐUWVS]u F@1RPdx=~, V ؉1=<wZF@ 9w.ȍe[^_Ív5(@j$jhB@1e[^_5(@j&jhC@$PQh$C@5(@$eUWVS81}QYE؃quucE؀8E4Pjuj@]܅]܀;j,SbEMAM܃j=SbEԅt@EԸ޿w@vR]@މuc}ԅt$VjEPu=k@E8VE]܅RMu@ uTe[^_ÐEWE@u @5(@h-jhC@̿ZuST$5(@j3jhC@裿$vUS]EPSbuMEu u^]ÐPShE@5(@} tPuhE@5(@ɲ$=Sh8@Ph0@@]ÍvPShLE@5(@莲} ~5(@jjhF@k5(@j4jhE@žOU5$@X5(@ܻ5$@jjh.F@舾ƅ5 @hPt PhEF@[`tf jFfUSL]EPSP@t$EptShE@B]à 5@dPShHF@5(@f =@t j5(@jEjhtE@謽ݍvUS ]j/S\tX؋]ÐUSEu fӋtB8F@u]Éà j(Ut@F@]á@u˸@ܐUhԭ@ÐUUt:+tËEt ME ÍvUWVS }uE8+t+e[^_Ðu p0] tiMQ] MuM MuGfE vMQM ;BvZRWSVFu&C;]uָH+e[^_ÍGENjEPZ땋E1e[^_ø(+TUWVS,ƉU؉MԋPBdtM܋@$Due[^_Ëz ZjEPEPEPuVF @`V щMH EǍ10v9Xt_@9wF(9wQSuFGF9x vQC;]t2EtUt 9wE9wEt9t EF$9uvSuFGF9x wN$M܋Ef`uV2e[^_ËU6UWVS } uE8+t+e[^_ÐuUr0uwEHy+A1q EgEH%SVDtICUJ;YrY9t+A1q uΉEH+e[^_ËUJ;yr낋E1e[^_ø(+DUWVS}u wQE܉PwjVn^tqEPE 1RPWщÃt"fu܅t uN؍e[^_ÐEEGPVjuPRÃuPjuW!EU먋G0t9EPju WRÃu뭍vF+؍e[^_ÐE6 W/yÃRUWVS E8+t+e[^_ÍvE]E EHY(EAL ;Uv ATEvu쐍F1EujAdtdEUB$UDtNt*EÍX1vSuXCGCUB9x(wE@$EUfbEP0MVuBt-FUJ;1v ALu ;utY(QqT;uuVuAu@E01e[^_ËQTUJY(E H1@EE I+e[^_ËUR,U'+rUUt:+tËEt ME ÍvUWVS uE HN1q(NjMu v,AN$Ef)AUtfAfaF@dt+X(A)‰ЉӍD9E s#WVFU)PNe[^_ÐGf+E fA̓u v,~AtfUjuu u&ÐUWVS ]}KU +Q1q ƅ~[u s0@C$f)x f`VSC)x K&tWE 1RPSуe[^_fu s0@룐Uuuu h+u;fUuuu h +u;fUuuu h+uX;fUuuu h +u8;fUu uh9+h +@ÍvUu uh8+h+@ÍvUuu uh+;ÐUuu uh +;ÐUc;vUW;vUuu h3+h+u9Uuu h4+h +u8US];+t +]C<@SJuju CB DPBHPQSh+"< ]fUM9+t+A<@Quju AB(P2jQh +; fU8vU'=vU>vU>USU] CEU [vUWVS,E܉U؉Mԋ]pCtp1CttCk+e[^_U܋usS e[^_Ðu Q;Bs;Bs4C5+e[^_ÐQs(uujjuPSǃ sRsPQb?Ct됋CEC_EEECS ;uQs(EPU2s sEP3S E tÃCUtt3Ck+}tRsE03>CtCCCU됅EEEfECS ;utăEEtQs(uU2s sP3S E  EdPs(uujju3S ǃ DE1UWVS/Su/G$T09UwAO(D 9Er5~Q1fSu/F9w(~4CSu.tE+ u Eԍe[^_EG;EfRJUE+E+붐UVSӅt&ușƉtt1Z[^øZ[^UE@@du fE uE uպE yÍvUWVSEPJZ E ȉEB`uuFH;E u u^EZYEURU܋zr` EeEљEE 1uǃtM;EE1ɋuV(EtuE0EtuE0utEMtM9)ӍCe[^_fE]KEE2uv EuFH;E B)1fuFu+]1Lvv EH9/1}U KEvUE@PLu@L@T f@XfUWVS<}?+t+؍e[^_ËOfA:fEƋQ`UȋG`M؉C0]fCZG$Efc:S`ЃC`O MЋw1 vF9w]SEPURMQVWwGut MuMt$tuGPuuQPRÃu-]tGHUWURjSPQÃhGfUfP:؍e[^_ËGÃFu܁iQhuwTBgG PPRÃGfUfP:u뱋UWvfBZGPuhQPRÃnG jOM؃jhPRGPuhjPRËWBwRP/US];+t +]Cu*C+F@Nt}VҋL to;Vt*SA1fACfA 41[^fCSA1fACtC=w)-fAC=wfA뱸+본+문+른+UWVS,E8+UJJE EREE؃Efҍ<} t0}t*} tP}tJ}P} v^+e[^_ÐE9PlGaGE } uEP;P]GRE 듐E$\@UBϋGG G W G 6p BG w GPMAUB;BF1҉¸N1ڋMQEH@ G GF )ȋUBGtMI}}MQ;QEHUB;B|+EB@G G G*G uE G E܅UB;B_$G$u BpC/EG$E܋HUB@ P;Vpj3;MA3ApV=ZYNKK FCG E܋@ CC} I4s C UB;B}C$G eE ?GH9G E )vF1҉¸N1ڋMQAA FAA=-AAw 1fEP;PGUBHMA$w } t }-G!G W B;Wpw W MA;AGw 7 PB3jQRPE+e[^_à s CHC CGWCS+|+E+}+~+F+vUVS u>+F@VFS C uVBC CHCt-‹fPKu VtOvaÉ؍e[^fC Ft&E tH1Q@PB PR4K f1Ff@륻+맻+렻+PEPj VÃuu VV NA )BAXLu,Pv vQ%à juv>/@XUWVS0ẺUȋu} EPjuEЃ7ŰB;EU+B;Eu5M]9PEPjuPEЄ+fEЍe[^_ÐPEPju)=|+t;M]11 t!9w3r9w-PURjuuuSEPj uu^ŰBKvr9WE19aw9WPURju=|+uEЄ+EЍe[^_ÉEЋEЍe[^_EЁ+EЍe[^_=|+vUEU MUM 1nfUWVS,Eȁ8+'UȋB@MȋQAC PEPjQu}UȋBCH9C tyM]11 Eȋ@EЋUȋRŰE)Eu}RMQjuuBEEȋ@~8M̍ɋMЋDH;D u$QMQj urfe[^_PWVue[^_ø+e[^_ø+θ+ǍvUWVSÁ8+%@@"sQEPjSƃt e[^_fEPS~XZuUM)ʉUE܋UptsJSDžxDž|1щMA t}UUfBfEEE}+EEt u#E3 u#e[^_Ív+e[^_þ++fz CHP&L}EK ɍ HljE: Cp&E| xu=CpCH1v(NJtt !~ ~xDž|EPuxs\ƃ}uEufFCP fV uvuF+E@D VRPQ1E@ dC@PujuPRƃ GCEU)B)B MAufFƅdhDžlEPURjSƃhlE܉UUUEC@+E܉EWMQjSƃtpUƃlS KA BAPLPs sQƃ3fF+zS D;D}DžxDž|PURj Sƃ&EԋU؉x|ƅtpUƃSs 'KA }uUSBBHB C@CMfAuuUVuVj Sd+})} VjS%ƃhlU܉MMME}QuVjSƃ*@XifUVSu>+F@VFC;C|KE t+؍e[^ÍvaÅtjV؍e[^ËF^ C E t K S C xQD@PRB P* C C@CfAPujVÃumÅdF+<+2Q 눻+#vUWVSE UX\]uPTu>+aUB@e]SMuNECx|T PuDuFuɋDoSE؉+t e[^fN9tt BRP Nt AQP F t F E PtEF Ft FE PMEFFTt FTE P&EFTF$t F$E PEF$F0t PF,t PFHt PFHFLt PtiCHCu^tE PrEKt CE PLECC S+ Ve[^ÐUu +f-+w1UE@ÐUE@ ÐUUE 9tÐE9BrEtB MEB 1ÍvEÍvUWVSMy _AQU9w(9s$)ƋI9sCF;]vZ[^_ÍvUWVSu} EE9~w>D;F w5E~%1ۉ+NىV C;]uY[^_ÍvFE} E.+[[^_XfUWVSu} EE9~w:D;F w1E~#1ۉ+NىVC;]uX[^_ÐFE} E-+X[^_6XfUSME Ut9u9Qw ]D;Av G+]ÐQ؃QPuR1]ÐUSME Ut9u9Qw ]D;Av G+]Ð؃QSPRuO1]ÐUS]uC+C@RPjs]ÐUWVSE]tU9t e[^_fz ;} rxBEU9UUB)EmuFU)‰X9t+UBESPEUB9r}U EP UP1e[^_ËURUu 9wI9vEH+X؃ NK9rU9UTU EP 1e[^_É9r*)QSjVmF+UWS}j<Ã8E CECEC EC+ +tOC=+}tQ 1}Q5E S F+e[_ÍvC0+}ufCC+Cx WEueCE Pw EC$a F+e[_fC-+@F+e[_ÉCuP|CM tRWu PE$17PWjs!UEu pppp pp0oÐUujuuu ujh +IÍvUMU At Puh\@QRjb Ðuh]@QRjIUME Q9w;A vRPjQ1Ív)ЋI ÍvUWVS u} 9~w8UD;Fw,~D1C;]t:;PVt1e[^_QvWh/+S1e[^_øe[^_ÍvUME Q9w;A vRPjQ1҃Ð)ЉA҉fUME Q9w;A vRPjQ1҃Ð)ЉA҉fUS]u`Ct CE PECKt CE PEC S]fUWVS]Mt U;Et Ee[^_Åt;uB;Ct E e[^_ÉыR ;S u)lj}qC9ɉuЃe+u9r,vVuEXZVS9EuFE9p s1xUE@ t1Ð@Puju PRÐUE@ t!P;tRpju1ÐPBuju RPÐUSEt(A ~11ҋAC„9Y A1[fUEt8+tËU P8UP]fUWVSE8+UBH j`TÃPj`jS+ECxGLC(C0CUBHCu <C SKB$DC Bp(sB(CGdUB$D)Ɖu܉sr{(1U܍D1CK tI19v+t+ [^_Ð~}G,u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS uM ]EEUU>+t+ [^_Ð~}G0u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS E8+t+e[^_ÐM UBP$ 1} Q8Eu uM9tx] tM?tFj&S&DžtGj=S…tBPMARSQP$ƃt u`e[^_þF+"1ھG+1 UWVSTEPu1u Ep 1h@h]@tdƃRPhScPVhSkcj S%tj StuS*t&tEPS1uEpu9}u V[E uh]@u81e[^_à V[E 1e[^_Ë}Ujju uÐUEU v Ív=v9w=v5w=v1w=v,w=w@fÐÐø fUWVS u E@u: UBP£@MAWPjR=]1+D hÃRPhjS+ECC\1}щ $sEC uPY_j?s zU EEE@tPCPRs Vǃup} tu sjǃuRCX\ hEt*CE ut~MVG+F+Et"U e[^_Ív+e[^_Ð S?e[^_fF+e[^_Å @E CPhPR$EiCTEECPshQPRǃ8CTtRhsPC@P+ hLECXCPQhjPRǃCX8+t1+CPuPRUUCTу8EEcsf~8St +f~Lv +VEuNV`MЩFdt}tt D+fEuu}NA whCFLt FX~LNSN(M̋FLtUVXNU̍D C(Et7E9Ct/"+<+C+xЃ5먋CPsPRsF`tCU HN MtC(EЋVU܋FL,Mљ)9UaF+F1CVU~` HEEMeEE1AK st19| Q‰E`C$E؅u C@E؋s tvEQuuS\SJVjPRQ uDCEԋM9K v=C s1|*H1u@VXSdCP}~*Bdt$C$St1f`f@B 9SwKcE fU uuuuu ju%ÐUVS];+t+e[^fU t3EEEPh@jjjS- uŋEe[^PpPjS`uMC@du>S ȉ1A1w.2Pu 'dU lEu=PvиɐUUxU MQ;Br;Br1fPE 0"&U Bt߸ÐUWVS<ÉUЉM̋PBE;+FCBdEE̅Zr sIu؉VshPEMЅ(Cp( sFERshPCEEEUUuJvEȉEEEMЅt!}C$UDuuEԃE E9C u̅t}t C$UDuUȉUWRus0uCCH;EC$U mCPWjQPRT+F+e[^_fuuVus,ʑu݋C$UL>CPujQPR#+멍vKA+A1q хXC9JƉȃ:A9w.+e[^_ËU̅u1EЅu1B+8c u1c߃ WE1UEP,t;P҃H0t"H уutf111UE1UE1ɺUWVSlÉUM@P UP(UsPUā;+C<@@dEӃ { 1уOQQẼ uẺEEC0t P蹑%]@}fs u C0PuSѐǃhEEC0E PoEC0Eut uA]t u,Mt ue[^_fEEEC,t Pې7]@}̥fs u C,PuS?ǃuE PuE ujC CEEEEEUډUvRuhuCuuus0'ǃzEEċEtZEC$p}t @4PuhuuuVus,ǃuEE U9SMtEC$0}t @-CPuuVPR%+EZvuEG PXAuEEEEdF+EEDEdC,E PEC,?fSJuEPVRQ+E떍vuS败%uS蘥i\+e[^_ÿF+e[^_ËSXK(y sE;1uEvCu9vRus0ǃu>C)E}E)ƋM܋QU܋PujQPRǃtESX$CEK1EI1uEHvCu9vRus,cǃuCE)EUE)ƋM؋QU؋PujQPRǃtTCC-F+&Et uEt u1m1ffUEP,t H0t11Ƀx0UE1UE1ɺUEĭ@1ÐUḘ@E UVSu>+uP^X;+t +e[^ÐS t-Bu RPSuU SU V e[^Ív1߸+빐UVSEu ]M8+u=@X8+t +[^ÍvP tBM]u UH[^f1[^ø+̍vUE8+u*@X8+t+ËP t BUH1ø+ÐUWVSE8+usXX;+t +e[^_ÿI]@u uPEt;PjEPuƒE8uCt CS1e[^_øG+띸+떋S tB@$tWuu RЃpW]@u u-utQjEPu|ƒE8uSC1*fUWVSEEEEEEEE|xXGE#|H M|Q UEGWEUċ_VSuuEEptUMptVStp[EuC1ۃfU;Ur.MMEQuuw8It%EU;Us҃ we؍e[^_f_EEEE؋U+GWEU|B EMuuuuVÉ$xRSjPq̭@؋|y t؋_ sxPuuuukPSVÃ=$+m̭@E̋GWEЉUԋ|r _uRG_GEEd@EMMEjuuuuST t|_EЋU)EU܉RVuu:ZYxMẺEjuuuuS?Tà tK x EWU S`+n|I MK wW&Xxb+؍e[^_à w.&F+؍e[^_ىM1ۉ؍e[^_à xd^w%vUWVS<}E EԋUUЋEÉ?+WXU:+t+Ѝe[^_ÐEԉEEUBREUG EؙU܋]؋u܃EЙuuuuuuVSuuuuى‰…hEH ZAp LỦUEЉEUԉU Me[^_z+!UWVS EU Uu}8+uKXX;+t + [^_ÉUuS tB}uMM UH [^_+fUuȭ@%F+fUWVS<DžDž}?+uLGX8+tDž+e[^_ËGHG~$Dže[^_Dž+ËR@ P ‹@hRPPPhjR TDžw@Dž]jVSP @(Dž@Dž]jVSBP BRPP t BRP Bt P&GXE PEGXGt GE P~EG WdBRP `+ UWVSE j`NÃIPj`jS+$ $Eơ`@C 1}QECuPwsXC CCC1+ĭ@PF Pu uRǃuQ hjtjj5ȭ@96UB UB @P@E1e[^_fF+1V t BRP  V$e[^_ÍvF+e[^_ÐF+봐F V=@럿:+UE8+u'@X8+t+ËU t U 1ø+UWVSEӉΉƒE11fEt@At'B tB1 t>tB;G}܉Auڐ]u1҉Ѓ[^_ÉU뻋Mt!UEދMA @A BЃ[^_É}ڍvUWVSE׋EU EU}E]UZ ]J EșMȋ]eÉ_wjVSw11 t_@t*1ɋ]StVPQuuuuS҃ e[^_ÐE+ϐUR Uk]ۉ]EH XPuuw9Et %+1UWVS EUωӃE1 vFt>C ttc C t3jC1RPUEtEFuÐEe[^_Àc 뫍vUE8+uPX:+t+1\+ÐUWVS lj։ˋEU EUA <t'C C USF @F Ce[^_Ív1jA1RPvUWVS,u }E8+PXU؁:+tE+E܍e[^_f}EXEE~̋UUE7vPUr u3C E׈C UB MtEEPEXu]WVًU؋E뛹U؋EE܅;uuWVU؋EE܃E+uuWVU؋EE܃ UuuE 1RPuÍvUWVSE׋EU EUEUEP UEUB Mȋ]eÉ_wjVSwI11 th@uKE+11ҋE)UWPjRUBtQSVuuuuRЉÃ ؍e[^_f붋UډUMvPuuw9Etx Ɖ»$+넻$+v1UWVS,E UEȉŰU:+MIXMЁ9+t +e[^_Ã}huSEE4QMq 0uMEUE@ EԃEURUȋM̋E[u}>]ȋũEvE؃M9MtU؍DPډEZtuuuuȋUЋE"E؅eEȋUEfM܋\Ɖ׃RPًUЋE Ep u3UR UE܃M9MuEUEH1EŰE)EE1e[^_1ɋUЋEquuuuȋUЋER+HEfUuuE 1RPuÍvUWVSE8+umXX;+uUW]@u u/Et(WjEPuUщƒE8u SKy G+e[^_1v+e[^_ø+UVSE8+ugXX;+t+e[^ÍvƅuPjCE u sx%Puus9Et%+멾+뢋5@fUVS@ X1fCCc tE P苿EFue[^UWVSB Z1vCCc w |tEFu1e[^_øF+e[^_ÍvUWVS ]} ;+uSsX>+t+ [^_Ð9{ t+1ɉ4u{ ؃ [^_:f1 [^_ø+붍vUWVSu>+u3^X;+t+e[^_fFHF~1e[^_ÿ+1ɉډǃ sVx_LFXE P EFXFt FE PEF VȽX=@UWVSUc j`Ã5Pj`jS+$ƃ @C 1}QECuPsXC CCC hjV'+džvǃubE E t PsFx\Ee[^_fF+ S膼e[^_ÐF+t V_fF+e[^_Ë=@ο:+뷐UU%=@t3=t,=t1ÐBht!B;wv1z,ÐÐ1zÐUWVS$}] jEPEPEPSWtEG @`EuttpEtEWftE9G0tw~,1C9t#WE;BsPu躱C9ufEtPu蝱Ee[^_ÍvPu耱|w b_$fcyUVSE8+t [^ËPtX E 9tJU 9u1؅~ωt9t19}19t9t;U t9U rىfUu uvfUvUVS]Ku e[^u SUTًBI9M|zG _,EӐUvUWVS(ƉUMj謺Ã1߫+t{sECt*1w SF+e[^_Ív PDEtʉC u܅t9KNjuE1e[^_f |vF+e[^_ËK{ 1UVS]u K SCVuCBȍe[^ÐUvUE 11UE 11UEt Pu h\@ujW u h]@ujWÐUVSUu ]t1Ɋ11]@1A9u[^UWVSU] u}B@dtC"uB C1[^_ÍvCtEEEU¸EUC1EUu}USEU1fCt1[^_UWVSU] u}B@dtC"uB )C1[^_ÍvCtEEEU¸EUC1EU)u}USEU1fCt1[^_UWVSU} ]uB@dtG"uB G1[^_Ð_1f_t1[^_ÐUE U|#~@Ív=wRuPuÐUE@,ÐUEP,1;`s@t @ u_@Ëds@ÐUS]u }t @t'1]ÐKuStC, ]ËEu-}t'C,uuuu sh`@jS C,뙍vUSËuCt 1]Ív jjjRjSP @tǃ1]Ph`@jSC,뫍vUSËu 1]f jjjjjSP uǃ]ÍvUu1à jjjjRQP ÐUSÅt t1t 9PuAuIt1]à jjjjRSP ]fUWVSƉt31ۍv%   щ C9u҉[^_ÍvUu@1ÐUu@ÍvUVS SjQRPe[^fUWVSuE Ft0NT9sC9t1DtE [^_EVT9s}EuCVT9vЉ؉1Ut벍vUWVSÉ׋E puEjPWS֍e[^_fEjPWS֍e[^_UWVSÉ׉΋ RjQWS t'F=&t=uR jPSR e[^_C, WPha@jSC, UWVS,ÉUЉ΍E܉E󥋃 pu}jWuS֍e[^_fE܍vUVSEu XT9s'LuB fAuB9u[^ÍvUUE 9B r1B,U1ÐU1ÐUSPt#Hv9JsB Ëu[û[fUWVSÉ׉΋ RjQWS @t4F=&td=fu0W jRSP u e[^_Ðe[^_C, Wvhla@jSC, 뽃 Wh&h,a@jSFfك jVWSP@tF_UWVSƉ׉M໨ӍMډb@tUt9uMډe[^_Wha@jVF,e[^_fUSӋQUMT[UVSuy)E]ٺ0Eٺ0k[^USÀx]Ðjjjjj0PA u SXZjjjjj0S ]ÍvUEfUE@ÐUEfUEM0EEfUE@TÐUE@ ÐUEfUEfUWVS]CEUB) )щ )ȋUB<Mt/]11ۋEE1e}F;uuڍ W)ЍǍǍG90[^_ÍvUÍvUU EÍvUME @UEfUVSƋ@u.^u'%9F uFtv"HF1e[^fF,e[^Åx& VTRjjjhVP uFF 1뽋 5@Ph_@jVӸ UE1>fUE+vUEvUWVS Ɖϋ@u,Fu%ӁFt*9^ u@F1e[^_ÍvF,e[^_Ëux$ VTRjQShVP uF^ 1e[^_Ãt릋 5@Ph_@jVӸ zfUE1UE1UEfUEfUEfUVS@]u 9s sBuBEPs];uw<-tyEC 31e[^ËEt;C,e[^ËEuC, uVha@jS C, s Vha@jS C,fUWVS }mrtBJ1e[^_ËBG Zt*fB s$Zu؋_taW$~/11ۃjjjjG(PWF 9w$LJG$G(t P蔧G(@ jjjjhW {t RF P&LJ1e[^_ÃGTPjjjhWG Ph b@jWUWVSÉUMpt(%;C tEEe[^_fu}|VE;CT}NC$~#{(U9tiw 1 v M9tUB9uQh_@jSEEe[^_à sTuhHb@jSE Ee[^_ÅtWtv%BGE@C,E-U jjjjMPSRE C$~4@s( }襋C$HC$uC(t PUC(EPhlb@jSEUS]E P1sT1ɉ6]ÐUS]E P1sT ]fUS]E P1sT]fUVS]t SCt  PeCt PLCtv PbƃC(t PC(Э@t9uC9tDuPh jS$ڣe[^Éj1딺Э@fUVS@uuduFt+Shb@jV Ve[^Ðt'Rhb@jVɉv1e[^É` vEPjP6F@t! jjjjjVP @EPvuoE;uE;MPhc@jV 5@Phc@jVӃ Ph c@jV0 5@vPh|c@jVӃ 5@OPh_@jVӃ sPhPc@jV\UVSuЭ@u 1t't St۸e[^1e[^fUWVS } ]EPu@tE@, e[^_PhjBPfu h)tcށvWVPEp39tЋE 5@5$Vhc@juӸ e[^_1e[^_ÍvUWVSEEu UUMMEE܋U苊Y t}vC9s S 9r0[uAU܉UMMUUu MMe[^_9MM9vB)UM)щM)sPuVu藮]܅Mu1e[^_ËUUE uuEEPWu tlj uVhc@juEUB,@ e[^_É) uWuVu uE)E}<CS UE2vUWVS u}t%FuFt!F, e[^_Ív1e[^_P jM RVP uFtE SWuPF1봸u Wuv9tF, 5@ZYPWu hd@jVF, WfUWVS}u ] j3RWP u7Gt@RSPu裬Eu 1e[^_ÍvڋEe[^_ÍvVSuwE9tG,EG E 5@uPuSVh@d@jWUG,0vUWVSE֍EjPLÃ@ m&p$Eu}VjjUr@tIEE0QhSP萫_@ߥf uSUr;Etv S̜e[^_ÍvUP X0WhSP3Eu 1e[^_úh1溨XTv1닋UB,농vUWVS]tf} f]tXډ@t]؁}uߋUg@uлN؃,[^_û؃,[^_1ҐUWVSLÉUME1sT@ME1sT @U1} UUt$@}ЭuFUUu;fuVuUME‰ƅuJAPuVjuUMue[^_ɉ ƅtfE1sTtPh(l@jSe[^_1;:U+E1sTtUS]E P$U M@]ÍvUWVSƉӉϋRKM;HT1ECECEu'K U4@SC1vTM@t]EvS@t8S9CFuŋNutCK Sye[^_ÉűErSz@tCS^K S"ECEMAMK9NTv]S uVPCE;FTPhPl@jV6'Ce[^_F,1/Phpl@jVvUWVS,u] t@@Ve[^_ǃǃǃM܍~}䋓EЋuEЉ~e[^_Phl@jS؍vUWVSLEEEEljUMUEfMMEP^ƅ]UŰEH P/Eȉu]č]ỦUEt!uuuuuWU  V|M؋UiÅ_UxMEȍe[^_ËUJ Ru#EPtRhl@jWUEEȍe[^_à V|UՋEPu]ȃ V{TPhm@jWfUWVS]u11҉Ste[^_C VMU Ke[^_ÍvUWVS]8s@ߥExuptQuu udƃe[^_úEtރ SMU EwƋE UWVS|]}uCuCtC, e[^_à E PE1sT@C}U MMEPuEtUD29E>C,{,u }wC, uU M EPS}EIQuu uv.ExE1sTM@UEԉEfUԉUM@}u;}wӋUUEE܉uEEE&M-@ uVuURSP@tc1Et uxE1sT! uU MC,EE@tދtU@}@>PUEUE|M캨@UqE1EEEԉE3Ut9v=UU;ENjEEUUԉUMԉ@t:E9EvUP us SPEUUE}ԋE1sT@oEE܉uEEE&U@F uVuURSP@$ME1sT@C,@P jC @PSR K TU!)ʉUEȉC %Ps|C1|EES +UM@fUUE(MU@UUЋM MЋE E̋u `} 1wT*ŰEMЉHEe[^_u 5@薲Ph0m@jVӡ@@}W } M܉}@tMME :Åt5EM9ɉމu$ SnU 1ۋE Et+ Snu tVt Sin@@}WShXm@jWWhXm@jVE ǀ,QfUWVS,u;Åt ؍e[^_ÍvM-@uh(`@M1ۍ}9E=fE܋M RPPQhm@]܋M؉M t] RjWQV @ug؍e[^_ùG؍e[^_1PSShm@&Ã؍e[^_ÃPhm@؍e[^_ÐUWVS,Ɖ׋XTte[^_ÐM1ɺ@t ]uv~e[^_ÃWh?`@`]tf RjURSV @tm uuuuuuSWh,n@E؃0Mډ0@tNE؃U9tQPRhn@]ԉ]vAShn@E#Shn@]ԃ뼐UVSuFTt1ۍvډC9^Tw hH`@0e[^wvUWVS\]EwzBuMrOruSt@ uBtPuW5(@*5(@jjht@(@Ee[^_(@ V^ZSPZY5(@j UU @tEEPuu uf@%@UWVS}u ]}EEtaPSVutK P $ÃEt Pi]Et PV]tK؍e[^_Ð1ǃj=VjtjREPEPVEtdUtdƉd u؍e[^_ÃjEP.v1ۉ؍e[^_à V Ã81D11vUVSu]t~utbQjSuc t@u Pt- p Ãu u؍e[^f1ۅt؍e[^ÃjEPy1ۉ؍e[^ÐUVSUM ]u [^Ð:L(urB9tFFB1UWVS ׅu 1e[^_ÍvtXp9u9t݃Ws&iu؍e[^_ÐUWVS U} u 1ۉ؍e[^_ÐtBr9tfÃWphtЋ9uƍvUEuËM tu PUtt݃uphÅfUWVS EuEEe[^_ËE t}t um,EvU EXx9EE v9tIsuvguFU9P~׃jpuËvuFE9uutDUB(8Ru"EO@(U EE]t&E@ PE uEvUEt8L(t0YUS]tJCBSC BCt PXCt PX]]Xv]ÍvUS]j \ƒtL(XCBЋ]UWVS ]u e[^_Ãj=Seƅt߃ S ǃt)ލ0XP"t#'t S t*U :U1뜍XPSbtƃ WXjUjj_t‰B@BB f1҉fUWVS ]ue[^_ÍvM tuusE~t@u CEu SƃE~uWdt3 WWEFsEtMU tN1I uV14t@u S,U] V}sDž u GUW_S { CW:sMʉEtesEH WP GO =@u tEsK0MUw?EtO u #MAtMsV N FQ bEt uU WV W@Xu7UWVSL}tD39u:f9t0ƃEPsÓy S+O9uЍe[^_UVS] j j\ƃtWF@FF t;u9t1US]jgVƒtL(XBBB Ћ]ÍvUWVS Eue[^_ÍvE8L(uE tދEt׃ ً} 1QUً}1щ $UÃtptVu VV`Y_uSK`UBt PER}G t P/REpX 1I VR3& PQUVS]tHCBsC9t PC9uCt PQ]e[^Qe[^ÐUj4jmYt‰B@BB f1҉ÐU1ÐUEfUS]jCK1҉]fUWVS }u u 1ۉ؍e[^_Ðt9u$9Vs^uEtƒSWÃt@(t7E9tF(SFPR&^S,UtF,tPR^umC0EtF0tPu]uIEF,t7MV0t%VWt@(u PfU9E%Eu1EÅ@$ VC{G_;COF,uQF0uWUWVS Nj0t!v^ 67O4$/Oރue[^_UWVS u} tIt1 GPERÃtPWVSX;؍e[^_f1эy뼐1ۉ؍e[^_UjufUWVSƉjQÃt VtCe[^_à SUNUWVSXuƃ 1}I VƒZ1򮋅)=ẁz.uBt<.vSuh\@PY[URPExE%puU 9UtZUi=@^EPRÌ@E%p=@-U PsU V袑e[^_Àz,UWVSEEE@t1ۍvU(@Cu}uf]tGCEVWu3GX3L$LEuEuƋEEE]uEEe[^_UDH tu9s19w)@ÍvU1ÐUWVSׅ~GtAq 1 v t.1ȉƒ3w@ƒ3 w@Fu;KuC E̍S!MͿfBF!tA@DDt-ABF!uj&EPh=@Ep1e[^_ËEEƉ]EfUjE(Pht@EpM1ÐUS]( PSht@Ep1]fUS]jjh=@sjjht@s1]ÐUEP0x0tjRht@Ep1Ív1UEPxtjRht@Ep1Ív1US8j(EP]S5Sj(Sh=@EpR1]ÍvUWVSHE։R(t e[^_Ív}WV*tj%WSue[^_û=@fUVS]uj@Pht@sPC1s1e[^fUVS]sЉ9Ct e[^C9Su)C9uݍt-jPht@EpOMA111ϐUVSuEx$t+X$PF1jSht@v1e[^f1USMA, u ]Ë] C1;A w,U B@2<v#1jSht@]s1뾸뷀ydu1ۍQTMA1-ōYdfUVSu]{lt+Clj Pht@vHS F11e[^f1UWVS E׉ˀyxuJ1jPht@uSh1ɋEC\uJ7t@t C`te[^_ÍAx볍vjht@ht@ue[^_Ð V}%ut@E7돐UMA`u fUBU *1fUMA\tAduA`uUBU 1fUM`tA\tAduA`uUBU 1ÐUVSu]jh SPSt hSPSopnqwaEUPEPht@v6srPPht@v UF11e[^Ðjht@ht@v농vjht@ht@vgUWVS ljUM]1΃~EE;GvPwJtGEGjuu7"y=1e[^_Ð|wG tT;D3 wMA= 9}jWht@Ep1ow0q Ѓ?Ȁ)Pq ?Ȁ)Ѓ?Ȁ)OUVSƊtv\uF>tFue[^Ð P,utFUSÊu vCt P,u؋]ÍvUWS1эA;t$< GO;t GPA,u؍e[_ÐUWVSlEtJjEpdƃx1EPV'lxEU;BtBt V^e[^_Ãh@VdÃtՍPShP%0t*vw>PS)PPt1эQ\tNJq<#iw@Rj>PF:ƅ1@x>]j<6t5w@ ut G +PƃyPjVu V+j=H9ƅMF8"8t @w@u?Wjj ?A b SєUbEBiw@ucVjj'3G@j"PT8OW0 Wvw@u!Qjj?>A$1IQ`j V*UWVS\ME9@PU\EPujhƃWyEh@uE EEE9u }19]ttKtC8/us$s hx@uUC{s9twwhw@u)?9uPshx@u19]ux Ub u舒E9EtYo 1}уQ ,Ãt-Wuhx@P¾$SZYSu?d$(Et' ur(e[^_Ã=@1e[^_þe[^_ÃjuaxӋE%p= ` 1}уQK+E>Ruhw@PXumÃxyh@P^E_XhSd]UU RPhw@u腆6Et@5@ uRhPedUSjQRP!xPjEPSu]]Ð1]ÐUWVSd}EPW6euE%p= EEEEfEUEUEUUMQuݐEU9U|~EUe[^_Ð9EsvEUEUӉ1ډt ]u땐]u댋Eؙe[^_UE U|#~@)Ív=wRuPuW[ÐUW}1_ÐUVSjuVe4aeU3U11ډ$XXZjVneE3EÃt f觳Kue[^UWVS EUEuxZE~K]1 )1~PSVug[G1E91ËEF9ue[^_ËMvUWVS,]E t EЃugE1}ԍvECWEPvE%? fEfE%@fEXZSWF;u|e[^_e[^_fU EEPuWfUWVS, @=H@$@u (@uvjVc];$@FM; (@4o,@ @,@=,@GEEÉց@]űE teU ~[Lgfff)‰=(@)щ ,@C$@)׉=(@H@~W 5 @_X5,@5(@5$@@Ph\x@5 @訁5 @JY5 @΍؉1҉]f@fUfE%fEލUء@Ef@fEuRe[^_ËM,@EU$@(@@ @@=H@ j&_à hjh;x@XH@$_XZhVx@5H@X @ 5H@RH@Mf@@%?f@*@f%@?jh$@0a $@uKvUjuÍvUS]Ix ]X[f][[UU1ɊBu Au1UMU BBBABBABBAB BA B fAfBÐUWVS,]1t e[^_1 $C$RjjSQ6E jjC P>6fE jjCP*6fE jjCP6fEECECE jjEP5EuD{ED{EPjjEP5D7 Gu׃u V1e[^_f<-G%+v PuUSM] A Q Q ЉQA fCQA fCQA fCA C fAfC[ÐUVS։ˍURPzUE$EPEPEPEPEPPREPEPuSVc@e[^ÐUEU x@fUEU x@wvUEU x@_UVSuh@t;`@ Ct)PV(uU CM1e[^Rjhx@V7(u FCu5] S sM!e[^_à UPR Ph@u p뢁'vDI !@)ЍB)QRh@h@g: vkMn@=@!@ɍQ))à VQWh$@h@h@h@QvgE.X@=@n!@))à QRVh0@h@藦h@h@ų v))Ѹ=@3@R)QRVSh;@h@h@h@+@MIXM{@ߥi{@]ߥf@u jjhӁ@zU<RPh@u ine[^_à S Ph@u DnkSPhP@u -nMQPhy@u nVPh[@u m Sr Ph=@u mSqThɀ@u m UBXPh@u mM\fUf^f(WPh@u fmB@E EP̞ PhJ@u ;m S語E ]S蓞 Pha@u mwPPhC@u lERPh%@u lQPh@u lSPh~@u lWPhS~@u l,u jjh|@x P Ph@u GlE4u jjh|@xM`1ۨ8t|u j 0zu jjh|@Gx{u j jhb|@.xu j jh@xe[^_u j jho|@wu jjh|@w5!@@3@3@3@3@&3@u jjh|@wU`RPh@u j`u jjh|@JwCu jjh|@0wCM`fU5$@uÐUVSu@t3@ Ct!PVuU 1e[^Rjhr@Vu V~u e[^Pj EPRBƒ w݋E8uոU 1fUWVS(1}QE܃-uuU܊t~}܍v PGu11EPWMt UUE`uIE t6E!‹E t GtFu1ۃ u ؍e[^_ UE ̋E ⟉밊EÍv Pu<,t7Fu1}-t}^t}+t14fG'1GUȻ؍e[^_ûTfUS] @t#9@tB1 @B9t2 @ut(1ҐBuSRhz@h@B@ȋ]1ܐUUE ftFft,fHtRjjh@QtRjjh@=tRjjh@)tRjjh@tUVSu] t3Vjjh@stVj jh!@se[^ÍvVj jh@sUU|u @u1ÍvUS MY A A É]QA fEQA fEAQ fUA EfAfEEPEPEPEPEPEPPREPEPShx@u 蚝@]fUS]SZt {@]Ðh@S@]ÐUVSu(@t-1v,@tCPV&u؍e[^û؍e[^UWSE~;.@ 1Q ǃt SPe[_Ë(@UWV0EEu}EU E؉U܉M܅EƉ׋U؉UE܉Eu9v@ЋU1v;}vO11vMЉEԋEЋUԋMt؃ڃ0^_Ívu 1EƋE빐ǃEuE;}r;uw1f]؃U]EIvU؃3 +EEMM EMUM ЉE̋UMỦ9Ur;Ut 1EM9sO1UWVPEEEUEUUM u}EEEEu؉ủUԉU܉ΉMȅu-9MЉu؉UEUMEHv9v4UMUMUMfEt ]U]EUP^_fǃEu}9rM9MwE+EE܉uȋU܉UMȉMfU؅u 1u؉ẺűEuMfu}ރfڃE +EĉEЋU؊MM ‰UEEEԊMM Ћ}Mue9r:9t2)։MM ‰UMuEUMQ9s+EUUWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1U1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐU]Ít&'U]]u}CvMsuV tRP@ЃT@%=t&ftt]u}]A)믍t&X@\@֋~t11҃9Љw~N1)=h@l@A)AVF ޭޅttYPtOAtUt@fP +PA +A9R t@G`@d@]u}]ËVfQ맍v9 p@tQ9 t@t=tABAtA 1)x@|@A $ D$踠t@뷋Ap@륍'U0VS |@ x@@@@@9s։ D$ $ۉt11҃9ᆳމw1 AqA AAx@|@[^]Ív Ft&P|^~@@t&9t&wv|.~5@@t& @t&w0@@vwv|ލ~@@t&`@d@$&UWVSt&`@d@=EEEMtыp@! t@5p@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5t@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf1hfL QA UQEyACKGDGE1ҍYh@l@ڃt )ÃfCz[^_]ÉE}tETF^05p@E;11FKAA y]YEAGDGFEp@GG@ GG@GxUGPGMHGDGE1h@l@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0FCP X9<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x8 [^_]ÍP@ЃT@%=t ftuX@\@1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$to$V;E\$H)ʉ}9}EE{ƍ4Ct"$ju${u߉M tU :Uth}-@ [^_]Í<0Ct u1 [^_]Ít&$$)ƉfUWVS u} &}$gÍGE$T9u>uӃ 1[^_]Ð$5$( )É[^_]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$ tt$|$$5؋u]}]ÐU1M9t :u)]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]W&UWVS ]} &$u+1-1\@.tn|B< v5؍v؍ftt [^_]fƒ0P$%`@ٞw…u, t&z롍& \@ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$Bu<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$HAEEs{xC{$EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]t&]Eu}]t&FED$$W1 f?[D$E@D$U$uɍFD$ ED$E<$D$UȽ@FD$ ED$E<$D$@v'UUE @U];UW V@S1ۃED$D$$D$ED$E$t&߃ t;>t[@D$ED$$u˃1[^_]Í& tED$@D$$ E Ƚ@[^_]Ív'U5:$@@@:@&@ =@@uÐUWVS }1=v@t$$t&9{uᡌ@t$$$`ƍ [^_]UWVS }1 v9{t+@t$$ou [^_]t&@t$$g$ [^_]UVS@$ƋE@F@11&@;Fw@\$$̌uࡌ@\$t$$#E D$F$}^[^]ێ@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$.\$D$D$ E D$E$,+[]ÍUED$E D$ D$D$E$* UED$E D$ D$D$E$* UED$D$ED$ E D$E$r*U腍@`@@Ít&UWVS,EUMI=@G@@ Eu&)ċE\$#D$D$$oED$ED$C$E\$t$ |$D$$)t&1 &@\$$TtF;~uᡐ@\$$XE;u|;~t)&KV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$V\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1${$s]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEz@t`$É0E{C<$|$ƋE4$D$*s \$@$]u}]%t&뙐U 0]Ít&U j0]ÐUED$@$v1tÍv'UED$@$F1tBÉ'UWVS }1]v<$D$Zt&@t$$uԃ [^_]0$vC$k$c@t$$҆UWVS 1t&<$D$t.@t$$ru [^_]Ðt& [^_]É'UE1҅tPÐt&U$d@]]uu1ۉ؋u]]Ðt44$9E r݉4$t$$D$&$4$E $맍vUE]utoU1u ]u]ÍvE $e$:ƋE $M4$D$E D$WE tC$1s롸$tE$$E $$҉CthtdE$D$ED$$E $D$E D$C$@\$$b@1$C$$U]]u$9*\$D$$d@o4$؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&@eU@$}Ít&'UWVS,EEE EFEEE}&$EF$]]x;D$E$EED$D$EE$|$FD$]$EEEED$@$^lED$ ED$E܉D$E$EE,[^_]'UWVSRD$@$h@@$-u [^_]ÐD$ D$D$h@$EtЉ‹@ tljB9s&<$<$D$tt$<$x4$nUDNjB B9r[^_]ÐUU]Љ%   Ív'UE]fÍvUU]Љ%   Ív'UE]fÍvU1Uw$@]Ív'UWVS `@}t;l@1f t$D$<$uv `@[^_]f 1[^_]ÍUWVS @} tA@1t&D$E$aut)C<$D$Juuʃ 1[^_] @[^_] UEuE $wUÐ@Í&UE$OwU Ð&UWVS,@t)t# t$@uE$v@ty$D$á@$@@@E@@@@@@@@e[^_]ÍvUEeD$q@$T$7D$@E$HNjE$<$D$D$A<$A<$ BC)čt$|$ 4$\$D$D<$5@4$D$t@!1Et_f$4$u|$@$Uࣜ@UD$t@$迁uU@e1&UUuu}}]uLU $vÉ$-9r>t$\$<$$]u}]Í&@1f$p1@'fUSE$vD$$@ÉD$D$,@[]ÐUEt;8t6 @@1҃w$@T$ D$D$@(@$3Ív@@1҃w$@T$D$>@(@$3ÐU]:UU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@B@Bt\1ۅt.@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@]uu%@1[]Í&$ti@B$@D$~@1[]ÐUED$ D$$O1Ít&'UED$ D$$1Ít&'UD$D$$@D$ D$$@@t&д@=@u@ U=@]]uu}} G~&@&]u}]Ív tՅt4@@C@C @C @C1t@G@G@G  @G@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$@u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE]Ft&]Í&'UU ~ÍD$D$ D$D$E$1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3@\$$vu@ [^_]f@\$$u$ 8uȉ4$a 1[^_]Í&UWVS1ۃ}9~t3@\$$uu@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$(@\$ D$p@$,^ 1[^_]Ít&]F9tD$(@\$ D$4@$i,^1[^_]ËE cF[^_]ÍUWVS }@1 f9>tl@\$$`tu$>Ƹt>@t$$2v@>@F@FF t&F [^_]u@fU @tÍv@ @$$@$(@$Ðt&UVS@t519pt#@\$$_su[^]Ít&[^]bf&'U(Eu]}t;$5D$4$NjED$R6t.]Ћu}]f@ލ&Et$ D$D$E $6D$|$4$5څt떍t&U(Eu]}t;$+5D$4$NjED$5t.]Ћu}]f@ލ&Et$ D$D$E $8D$|$4$<5څt떍t&UE]uu}} #tEt$|$$4t]u}]Í&]u]}]<4t&@ÍUEt&D$ ED$D$E $05Í@Í&UE]u\tVD$ ED$D$E $X7t]u]Í$x2u@Ӎv@ UE]t&UVS u ]00 D$@$H:0$X2ft^ErtDaDED$$:t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$@$9@@됍&15D$@$H9uLvEwfvEwE+D$@$9v$ 1@UE D$RD$E$0ÐUS]D$@$8t$01[]f$ t$l 1[]@ːUS H@u@trL@B@L@:#@8@U::L@D$@D$(@$>%?[]Ð@E H@;] @}A@-t@3@[]QA@-L@ta7D$-U@3@$,tL@-1&?[]Ív@t&yL@D$E$x:t,@D@8u@L@[]Ív@8uh@9E@PE:@3@8:@DL@D$@D$(@$#?U D@@3@bC@U$ÍU]U@]ÍUE]uD$@$5t;D$ ED$D$E $1$-]u]Í&@ UE D$D$E$ ÐU]ÍU1]É'U@]ÍU@]ÍUE D$@D$E$1ÐU1]É'U1]É'U]ÍU]ÍU]ÍUE$?Z<É'U}׉$]ÉuD$4D$G!$v,D$D$$,$T,D$t$$G,G1G,w, O0tAG0G]G@u@G}1] US] D$@E$t[]v@[]Ít&'Uuu]}} D$@4$2t%$*]u}]Ðt&4$XtI$1XD$4D$<$GAGG@@G@농v'U(]]}} u$|$t]u}]Í&$D$@1tԋG G\$ D$D$$ .G0G$)두UE@1]ÐU1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG@\$$fu@ [^_]$@pTٍEt1~t01t&ȍ<$t&kt ~t&uދE tFU 1f@\$$,fnU;uݡ@\$$,f [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$eu$ D$_D$@$@1D$ WT3CC@\$$Ig[^]&'UWVSE}}Et[^_]1I&;8t @\$$duމ<$1ۍt&;>tV@\$$du1D$ D$D$@$@rSUFF[^_]f뿐UfD$@$@@ ÐU@]ÐUED$@D$@$@D$ S@UE D$D$E$TÍ&'UED$D$$OTÍ'U$3@>Q1Ív'UEu1}]$TtL$F$fw7D$F|$$1Ɔ<$蒻]u}]Ív‰'UE$?SɃÍU]RUWVS }<$4s/|X4t&B)E4$Ю v@UWVSRX1ɉ‰EE#E$VËE$+UStdfuC.C E\$$W11vD$xE$UtXC$蕼ƋCt+rǍ&CC뗐t&$@TƉ떍F$EE$oTuE#&tcu :F/<$蔭mED$E$Tt8_4$\$Y$ѻƋGu/볍&|E$UE[^_]Í&$E$SD$E$[T8$6@@E$xS\$D$E$UaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐUMSYt ЍCA[]É'UE]@Ðt&UE]@Ðt&USM] Q~BA8\t[]"[]Ðt&UWVS|U‰EЉMEuR <U$&UH]9uSUCu< ~<%uBEEz*'E1$7]B<E[t@ct;n]$fU$蛨utÉD$E$U]%t&D$U$1;E5Mt UȈUEttE$UuUą}Et ]EEEЋe]-EE]EEv$0@191E9kvэۍẼ9ff]̀|0X9$fۍt^1[vX]̀|09\A&ivÈ|0 9t&ED$ D$EЉ$&BEEvqEuE-}]Tt&]u]LEuEu=}u]Ѝvv]} t/}tU}tk}t&uYQuE]ЃCEЉECEЉE f뽃}]Ѓ]릉t&랍CECEKAÉD$E$Uv]EED$E؉$\$]&+]vvf]Аt&]Ѝt evet&'U@(EUED$@EED$E $@Ðt&UE D$ED$ @$Í'UE D$E$ÍUED$E D$E$Q Up@(EUED$@EED$E $@WÐt&UED$E D$E$ UEU hUM ]t&US]$tC[]ÐU(EE@EEEEED$E D$E$WÐt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$ҍUUE $T$ ÐU]]uu KSA9t BC]Ћu]Í CD$$臦t΋S뷍&U8uu]}u؋u]}]Í}}EE@$@t‰EEE@ED$E D$E܉$D$<$tE;Er EtD$E$躥E␍t&UED$E D$E$!ÐU@$h@D$ED$3ÍU @$Ít&'U]&US$$@]t$D$ $É[]Í&]ED$$?؃$[]fUWV1S }' @$st4$ t7 @$t7 [^_]f @$u @$t1fʍ&'US$$@]tE $D$ $É[]Ít&]ED$$>؃$[]fUS$@]U u$T$>؃[]Í\$D$ D$$ []Ít&US]$^\$$t$@t$ 2[]Ðt&D$t@$>ؐt&UVSD$@$v@ wD$ D$D$4$5 Ƅw @D$D$+@4$$ @D$ D$D$$D$@$@[ )wD$ D$D$4$ Ƅw$@ZD$D$@4$6$$@D$ D$D$@@$D$@$@ wD$ D$D$4$ Ƅw(@D$D$@4$(@D$ D$D$$$cĠ[^]Ð @$@@(@Ġ[^]Ít&D$@4$ (@vD$+@4$ @*D$@4$ $@U1]É'U]Ít&'UE@1] U]&US]U taҋCu@CC{%t't#9t$t&蓙1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$腦t$u\$ D$@F$wƉ]u}]Íu \$KS<$8C $8U|$T$$\$ D$D$@F$ƋC $8뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$芴4$딍US$]u$[]Í&Ct$ELED$ D$D$@C$ D$Ë@ D$E$C $S$KE뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$31҄u뱍vC!C$Δ뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$?$wt&tyvC!C$螓:vK9Crt$ED$ $sY&{Cft$ED$CC$¡sv'U]]u$yU $D$T$ D$^$T]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$ØtӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;H@v/D@EܣH@$2D@$2@@D@EED$ D$D$Ɉ@G$Ë@ <9}sE<D$@@D$E$豟C $$,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$#_utRu4ttG!9u܍f]v֍ovɍt͉$v3G!9uIvvE<$ED$ D$D$Ɉ@G$wË@<9}sE<D$C $ 1t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$远 )čt$<$襜9s@a<w%$@vЃ|+uf<$e9rE1ۉ$TUT$D$F$[E$0t$ D$҈@$D$1U$蔍w t Nun1ۉ<$|e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$]$2FU$T$$&ËFCFCF C FCFCFCFCF C F$C%C$$ǏD$ D$$D$C%4$Ov'UD$ۈ@$߈@Ít&UWVS] D$@E$~C$# D$@$N84$t$ D$D$<$uN(@D$D$ȉ@$q4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$G1[^_]á(@D$x@$@e(@D$H@$@<(@D$@$s4$ @ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$@4$2]$t$D$ D$D$$$7&f&'U$~ÍUL@tED$L@$ 21ÐS2L@u@É'UVS1ۃL@uu!&ЃL@\$$/uu[^]U(}}EU u1]]EUt\$t$ $T$4EU\$t$ $T$譄]u}]ÍUWVS,E ]E@E܋EuE@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$A~8$t 1҃[]f[]Ít&'UWVS$1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UE]P@ÍvUE]P@ÍvU]u5P@D$5qD$ Ӊ $\$]u P@]Í&'U]UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA +@ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$`@$Ðt&UED$`@$Ðt&U@]ÍU@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$X_D$$FFF D$D$$kta$jEԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$bEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$j\$UT$M܉ $$i\$E$FU F$E] UMV~HU1fC D$CD$EE$hMC K9}MƋVT$D$U$vhF D$$ 4$YUE ]u$tD$E$n$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx顄@t9t)ȉ vt̅u@@@뵋5@9|͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$NXk9@u,@9|Qu!@vWu1]u}]Í&tq $W뛐@ȍ&'U]]u1t#1tr$Wk9@t]u]Ít&@t@ݐt&@̍t&US]$xu][]7W&U$]]ueZۉƋEFtM u:3C9@t؋u]]Ít&@9E @܍t&U ؃t21빉'US]t$$YU PC9@t؃[]Í؃@[]ÐU$Y@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUMVuS] u t&8utu1҉[^]Í&C)萐UWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐUWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS@t1ېЋ@uX[Ungueltiger PPB! Usage: %s [-c max_mounts_count] [-e errors_behavior] [-g group] [-i interval[d|m|w]] [-j] [-J journal_options] [-l] [-m reserved_blocks_percent] [-o [^]mount_options[,...]] [-r reserved_blocks_count] [-u user] [-C mount_count] [-L volume_label] [-M last_mounted_dir] [-O [^]feature[,...]] [-E extended-option[,...]] [-T last_check_time] [-U UUID] [ -I new_inode_size ] device Invalid filesystem option set: %s Clearing filesystem feature '%s' not supported. Setting filesystem feature '%s' not supported. The has_journal feature may only be cleared when the filesystem is unmounted or mounted read-only. The needs_recovery flag is set. Please run e2fsck before clearing the has_journal flag. while trying to open external journalwhile reading journal superblockJournal superblock not found! Filesystem's UUID not found on journal device. while writing journal superblock.Clearing the flex_bg flag would cause the the filesystem to be inconsistent. The huge_file feature may only be cleared when the filesystem is unmounted or mounted read-only. The filesystem already has a journal. while trying to open journal on %s Creating journal on device %s: while adding filesystem to journal on %s while trying to create journal fileUsage: findfs LABEL= %s.oldg@f@f@f@f@f@3g@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@f@>g@f@f@f@f@f@3g@f@f@f@f@f@f@f@f@f@h@g@g@g@g@g@h@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@g@h@g@g@g@g@g@h@g@g@g@g@g@g@g@g@g@HASHALG_HASHALG_%dlegacyhalf_md4teaFilesystem volume name: %s Last mounted on: %s Filesystem UUID: %s Filesystem revision #: %d (original) (dynamic) (unknown) Filesystem features: (none)Filesystem flags: unsigned_directory_hash test_filesystem (none) Default mount options: Filesystem state: Errors behavior: Filesystem OS type: %s Inode count: %u Block count: %u Reserved block count: %u Free blocks: %u Free inodes: %u First block: %u Block size: %u Fragment size: %u Reserved GDT blocks: %u Blocks per group: %u Fragments per group: %u Inodes per group: %u Inode blocks per group: %u RAID stride: %u RAID stripe width: %u First meta block group: %u Flex block group size: %u Filesystem created: %sn/a Last mount time: %sLast write time: %sMount count: %u Maximum mount count: %d Last checked: %s%d month%s, %s%d week%s%s%d day%s%s%d:%02d:%02dNext check after: %sReserved blocks uid: (pwd.h not supported)Reserved blocks gid: (grp.h not supported)First inode: %d Inode size: %d Required extra isize: %d Desired extra isize: %d Journal UUID: %s Journal inode: %u First orphan inode: %u Default directory hash: %s Directory Hash Seed: %s Journal backup: inode blocks type %u Filesystem magic number: 0x%04X Check interval: %u (%s) Journal device: 0x%04x MNTOPT_MNTOPT_%ddebugbsdgroupsuser_xattracluid16journal_datajournal_data_orderedjournal_data_writebackContinueRemount read-onlyPanicUnknown (continue) not clean with errors(unknown os)LinuxHurdMasixFreeBSDLites A?CWDGET_ENVVtcpip:/dns/%s%s: %s tcphttpimapircUnbekannter RechnerDer gesuchte Name hat keine IP-AdresseEin DNS-Fehler ist aufgetretenZeitweiliger DNS-Fehler; erneut versuchen@@؃@@Warnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c lrtyndurwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert 1qay2wsx3edc4rfv5tgb6zhn7ujm8ik9ol0pIO_ULINKlwIO_LINK ..:/ @@@@@@@@@@@@@@@@@@@#@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@=@@@@@@I@"@@@J@@@@@@@4@@4@4@p@@@@@@@@@@4@4@4@4@4@4@4@`@`@`@`@`@`@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@`@`@`@`@`@`@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@@%s: errno=%d console:/stdinconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/create8@`@`@(@`@`@`@`@`@`@`@@`@`@`@`@`@H@`@`@`@`@@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZ@@@@@@@@@@@@@@s@s@@@@@@@@@@@@x@@@@@@- @@@@@@@@@@@@"@@/@/@@"@@@@@@- @- @@@@@- @@@- @@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @@ @ @ @ @ @ @ @ @ @ @@ @+@ @ @9@__PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 @u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@u@@u@u@a@u@u@u@V@@u@u@u@@u@u@u@u@@@@@u@w@u@[@u@u@u@u@u@u@u@I@7@u@/@@u@u@7@u@@u@u@@@u@@u@n@u@d@u@u@7@u@@i@m@q@v@z@~@@@@@@@@@@@z@@@@ƌ@Ќ@،@@@@@@@@@@@@@ @+@3@4@@;@@@P@b@b@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d wdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK REGDRV tcpip%02x:%02x:%02x:%02x:%02x:%02x%d.%d.%d.%dzR| AB E<AB E\'AB E|_AB E @?@$B{4z@filesystem BLKSIZEfilesystem MTIMEfilesystem UUID+^]@D@ķ@`@Ȱ@,@(@@h@@@+o]@@@`@d@(@P@ @@@d@@%@\@\@\@tu@ ~u@4:@u@u@`C@u@8u@$>@Su@8u@M@[u@8u@L@u@8u@>@t@8u@P>@u@4u@<@u@@4 u@<@u@@4 u@<@u@@4u@<@u@u@<@u@@u@p<@u@@u@Q@u@@u@ Q@u@Ru@F@u@Ru@F@u@6u@F@u@6u@F@u@6v@F@u@v@I@u@v@I@u@v@I@v@v@v@!v@v@$v@v@'v@*v@/v@+v@4v@4=@9v@?v@:@Hv@Lv@Qv@Xv@:@]v@bv@iv@ mv@@@iv@ sv@@@iv@ yv@@@iv@ v@@@iv@ v@@@iv@ v@@@iv@ v@@@v@ yv@X:@v@ v@X:@v@ v@;@v@`w@8@v@iw@8@v@`w@8@v@iw@8@v@qu@ R@v@ u@ R@v@ u@ R@.w@qu@B@v@\rw@v@v@v@v@v@ v@:@v@ t@A@v@ v@A@v@ v@A@v@ v@:@v@ t@A@v@ v@A@v@ v@A@v@? v@:@v@? t@A@v@? v@A@v@? v@A@v@ v@:@v@ t@A@v@ v@A@v@ v@A@v@ v@:@v@ t@A@v@ v@A@v@ v@A@t@ w@>@ w@w@;@ w@w@;@ w@w@;@ w@w@;@w@"w@ ;@)w@2w@)w@7w@.P@-@JВ@~@@`@@@@g@!Y0@M @6@ qЯ@y@P@}"@@]n$@;&@)q'@)@@+p@0`@1@72@n6@v7@0?8@9; @5=@d>@@B@ C@=J@|K0@LP@&Mp@ jW @Z@Q2]p@&a@@m@(o0@y0@z@[P@@@?v@@@j@0#@f#@%@S%@N&@  &@v&@'@*@A@.@/@KeP/@00@9l0@_j,g"do_findfs$main+journal_size+journal_flags,journal_device,program_name$,device_name6,new_labelH,new_last_mountedZ,new_UUIDl,io_options.=print_check_messageffigure_journal_sizeparse_journal_opts8check_mountproceed_questioncheck_plausibilityget_prognamehBinitialize_ext2_error_table_rBinitialize_ext2_error_tableet_ext2_error_tableRDjext2fs_set_alloc_block_callbackVext2fs_get_free_blocksext2fs_new_blockext2fs_alloc_blockAext2fs_new_inodeYext2fs_set_block_alloc_stats_callback/ext2fs_inode_alloc_stats2ext2fs_inode_alloc_statsext2fs_block_alloc_statsEml 6ext2fs_get_block_bitmap_rangeext2fs_get_inode_bitmap_rangeext2fs_set_block_bitmap_range7ext2fs_set_inode_bitmap_rangeext2fs_compare_inode_bitmapext2fs_compare_block_bitmapext2fs_resize_block_bitmapHext2fs_resize_inode_bitmapext2fs_clear_block_bitmapext2fs_clear_inode_bitmapext2fs_fudge_block_bitmap_end(ext2fs_fudge_inode_bitmap_endvext2fs_allocate_block_bitmapext2fs_allocate_inode_bitmapXext2fs_set_bitmap_paddingext2fs_copy_bitmapext2fs_free_block_bitmapext2fs_free_inode_bitmapAzext2fs_block_iterate2Qext2fs_block_iterate$Neext2fs_check_descext2fs_bg_has_super<ext2fs_super_and_bgd_locQext2fs_update_dynamic_rev<ext2fs_flushext2fs_closegext2fs_group_desc_csum_setdext2fs_set_gdt_csum]ext2fs_group_desc_csum_verify (|Xext2fs_extent_header_verifyext2fs_extent_get_infoaext2fs_extent_replaceext2fs_extent_getext2fs_extent_delete ext2fs_extent_gotoext2fs_extent_insert7ext2fs_extent_set_bmap~ext2fs_extent_freeYext2fs_extent_open+Cext2fs_find_block_devicemext2fs_free_dblistLext2fs_u32_list_freeext2fs_badblocks_list_free&ext2fs_freepext2fs_get_generic_bitmap_startext2fs_get_generic_bitmap_endext2fs_fudge_generic_bitmap_endext2fs_set_generic_bitmap_paddingGext2fs_unmark_block_bitmap_rangeext2fs_mark_block_bitmap_rangeext2fs_set_generic_bitmap_rangeext2fs_get_generic_bitmap_range_ext2fs_clear_generic_bitmapext2fs_resize_generic_bitmapext2fs_make_generic_bitmapext2fs_copy_generic_bitmapext2fs_allocate_generic_bitmap:ext2fs_warn_bitmap2ext2fs_test_generic_bitmapext2fs_test_block_bitmap_rangeext2fs_mark_generic_bitmapext2fs_unmark_generic_bitmapkext2fs_free_generic_bitmapext2fs_compare_generic_bitmapC!#+ext2fs_write_ind_blocksext2fs_read_ind_block2O!ext2fs_flush_icacheext2fs_set_inode_callback1ext2fs_inode_scan_flagsext2fs_inode_scan_goto_blockgroupzext2fs_get_next_inode_fullbext2fs_get_next_inodeext2fs_write_inode_fullext2fs_write_new_inodeext2fs_write_inodeext2fs_read_inode_fullext2fs_read_inodeFext2fs_check_directoryext2fs_get_blocks ext2fs_close_inode_scanext2fs_open_inode_scanx7TIio_channel_write_byteio_channel_read_blk64io_channel_write_blk64Wio_channel_set_optionsGZ#ext2fs_check_mount_pointext2fs_check_if_mounted1^#ext2fs_default_journal_sizeext2fs_zero_blockscext2fs_create_journal_superblockAext2fs_add_journal_inodedext2fs_add_journal_deviceTwOext2fs_get_data_ioext2fs_set_data_ioext2fs_rewrite_to_io ext2fs_descriptor_block_locext2fs_open2`ext2fs_open'#ijext2fs_read_bb_inodegEext2fs_write_bitmapsext2fs_write_block_bitmapext2fs_write_inode_bitmapext2fs_read_bitmapsext2fs_read_block_bitmap=ext2fs_read_inode_bitmap^W set_undo_io_backing_managerset_undo_io_backup_fileDundo_io_manager"Jubunix_io_manager0!ext2fs_inode_has_valid_blocks/KWext2fs_reserve_super_and_bgdR+Iext2fs_u32_list_findext2fs_u32_list_testext2fs_badblocks_list_test#ext2fs_u32_list_delzext2fs_badblocks_list_delext2fs_u32_list_iterateext2fs_badblocks_list_iterate9ext2fs_u32_list_countfext2fs_u32_list_equalext2fs_badblocks_equalext2fs_u32_list_iterate_end2ext2fs_badblocks_list_iterate_end\ext2fs_u32_list_iterate_beginext2fs_badblocks_list_iterate_beginext2fs_u32_list_addext2fs_badblocks_list_addext2fs_u32_copyBext2fs_badblocks_copyext2fs_badblocks_list_createext2fs_u32_list_create%ext2fs_warn_bitmapext2fs_crc16X+ext2fs_iblk_add_blocksext2fs_iblk_sub_blocksext2fs_iblk_set ext2fs_llseek6a ext2fs_tdb_error ext2fs_tdb_errorstrext2fs_tdb_increment_seqnum_nonblockext2fs_tdb_name<ext2fs_tdb_fdjext2fs_tdb_log_fnext2fs_tdb_get_seqnumext2fs_tdb_hash_sizeext2fs_tdb_map_size1ext2fs_tdb_get_flags_ext2fs_tdb_enable_seqnumext2fs_tdb_set_max_deadVext2fs_tdb_set_logging_functionext2fs_tdb_get_logging_privateext2fs_tdb_unlockall_readDext2fs_tdb_unlockallrext2fs_tdb_lockall_unmarkext2fs_tdb_lockall_read_nonblock'ext2fs_tdb_lockall_readUext2fs_tdb_lockall_nonblockext2fs_tdb_lockall_markext2fs_tdb_lockall<ext2fs_tdb_transaction_cancel$ext2fs_tdb_chainunlock_readaext2fs_tdb_chainunlockext2fs_tdb_chainlock_unmarkext2fs_tdb_close.ext2fs_tdb_reopenxext2fs_tdb_reopen_allAext2fs_tdb_transaction_recover>ext2fs_tdb_open_exext2fs_tdb_openi ext2fs_tdb_transaction_startr!ext2fs_tdb_lock_nonblock!ext2fs_tdb_chainlock_nonblock4#ext2fs_tdb_exists#ext2fs_tdb_parse_record$ext2fs_tdb_fetch(ext2fs_tdb_delete(ext2fs_tdb_firstkey)ext2fs_tdb_traverse_readQ*ext2fs_tdb_traverse,ext2fs_tdb_store.ext2fs_tdb_append/ext2fs_tdb_validate_freelistq0ext2fs_tdb_chainlock_read0ext2fs_tdb_chainlock_mark0ext2fs_tdb_chainlocku1ext2fs_tdb_nextkey1ext2fs_tdb_printfreelistU3ext2fs_tdb_dump_all4ext2fs_tdb_transaction_commit6tdb_null?het_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#3DPerror_table_namef%E_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hook<HoKblkid_get_devnameblkid_get_tag_valueKblkid_tag_nextblkid_find_tag_dev1blkid_dev_has_tagblkid_find_dev_with_tagJblkid_tag_iterate_endublkid_free_tagblkid_tag_iterate_beginKblkid_parse_tag_string2blkid_set_tag^T6fblkid_gc_cacheblkid_get_cachepblkid_put_cache#blkid_debug_maskY blkid_dev_devnameblkid_dev_iterate_end1blkid_dev_next~blkid_dev_iterate_beginblkid_dev_set_searchNblkid_free_devblkid_new_devL^Ublkid_probe_all_newblkid_probe_allblkid_get_dev`b`Iblkid_strndupblkid_strdupblkid__scan_dirblkid_devno_to_devname6ho6Ublkid_known_fstypeS/blkid_verify#"blkid_read_cache$blkid_flush_cache%Tblkid_get_dev_sizeblkid_llseekԯnuuid_clearq_ uuid__generate_randomuuid_generate_randomuuid__generate_timeuuid_generate_timeuuid_generateжnuuid_is_nullWuuid_packuuid_parsegYuuid_unpackM4huuid_unparseuuid_unparse_upperuuid_unparse_lowere2p_jrnl_string2featureLe2p_string2featuree2p_edit_feature2e2p_edit_feature]e2p_jrnl_feature2stringe2p_feature2string6e2p_string2hash e2p_hash2string- list_super2X list_superOe2p_string2mntoptae2p_edit_mntopts3e2p_mntopt2string"[dprint_fs_errors!dprint_fs_stateHJe2p_is_null_uuide2p_uuid_to_stre2p_uuid2str29{e2p_string2ose2p_os2string =__divdi3]G__moddi3__udivdi3 isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper?%errnoQinit_memory_managerfreeZmallocrealloccallocdstrtolostrncpydstrrchr-^strncasecmp strcasecmpomemmovedstrcatdstrchr}dstrcmp.dstrcpyostrdupostrlen~omemcpymemset9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoullibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*nsyscall_psyscall_vYagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars htonlhtons$ntohlQntohs~hstrerrorgetprotobynamegetservbyname3inet_ptoninet_atongethostbynameinet_ntop]inet_ntoaherrorh_errnorunlinkq7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill@=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreat}"oaccessRn$Plgetoptoptargoptindoptopt+opterr=optreset%&getppidgetpid0q'iolinkreadlink!symlinkK)fgetpagesizeisattyforkpipegethostnamei@+chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat0gettimeofday<1getuidgeteuidgetgidgetegidG2vwaitpid,waitXwait_child_addqinit_waitpidn6utimev7xstrerrorY?8=seekdiryrewinddirtelldirreaddir3closedir_opendir%;_vmktempmkstemp'5=Zrpcsend_message4> io_remove_linkio_create_linkBnyieldRC,io_split_filenameio_get_absolute_pathZio_split_dirnamed=Jget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"Knset_rpc_handler#Lyadd_intr_handlerQ&MD vfscanf vscanfIscanffscanfvsscanf@ sscanfJjWa)vfprintffprintffprintf_putsn+fprintf_putc;Zg]asprintf_putcvasprintfasprintf2]}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#&a Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6m_exit2abortGatexit{exitio 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf8y7srandsrandomrand random{z gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF[0vprintfcprintfprintf_putsnprintf_putc8sprintf_putcQvsprintfsprintfa_assert;v~]snprintf_putcvsnprintf!snprintfPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timerjdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namelio_seekWstring_to_ip)register_netcardmac_to_stringip_to_stringVcreate_shared_memoryopen_shared_memoryclose_shared_memory ysyscall_putsn!Nget_tick_countq mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6vnwait_for_rpcv_and_wait_for_rpccppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvlist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspnostrncmp(eQd__strtok_r strtokomemchr__umoddi3fQ@@q@h"intXI5Lf7e~t]+(e 'eoy.Z%1H id2# t3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzJsH}I3h}c-vl3d@@k@@q<b7IY+,{,3$t@-@h"intXI5Lf7e~t]+(e 'e)e0syo .Z% 1` id 2# t 3`# pid 4# . 5# 7# 8z# > 9z# :A# 4 ] 4l tm$ "   #3#  $3#  %3#  &3#  '3# z (3# I )3#  *3#  +3#  L S ,, 8e J3 bl s:    -#  -# 2 -# #  #  #  #  # #  # - - P. Q-# SG T-# OiM R U. ] ^# _# `# a#J b-# d"K e # f # g#g h# i# j-# \DT ci k C` D#< E# F-# G-#g H-#  I-# J-# K#a L#w M-# N-# K VG#$ W`#(A X-#d Y-#h Z-#l [-#p l"#t -p  ^ V -#cS -# -# -# o -# -#s -#? 8# -#  -#$ -#(, -#, -#0 #4 "#6Q #8^ #:^ #< #> -#@z -#D -#H -#L #P} #R) -#TG #X #Z -#\ -#` -#d ^ #ho n #xl !~ # "-#B ' # ( #o )# -^ # .-#X /-#M 0-# 1 # 2 # 3 # 4#2 5-# 6-# 7-#6 8 # 9-# :-#. ;-# <#5 =#z >-# ?#i @# AC# B-# C #" D #C E# F # n  ~  ? -  -  - B-QC- DCc E-HGN(s  7 7 # 9s# 3#= M S t$ VC # ?D# ?E # 8F # ,G # \,I' # -KL # +L # 'NL # K-Pl #$ /Q #( 'S #, 'U #0 @V #4/ 5 ` V" # -#B # ?$`# ]O%3# B,,` # x 3 # R43# |j53# @6 # ,7#X 8#\   2 <3# @=3# >l# ?l# ` $ 3z3 2  $ 3 z3  f s   3 $   $    $ 3  ' $ 3  L $ 3 -  l $ R  $   r  $ l3  $ l3  s _  _ V # io$ # |j3# t`# # ze# ^3# {  # ƨ# #$ 3#( #, #0 ?%=#4 W&X#8 +n#< %ϔ#@ ^$є#D B #H #L -#P #T ` ֠#X Z-#\ now؝#` @ܦ#d # K'# T$ # N# #p f[g p6 pY 7  7  X  C n ^   Dt -q       3xL  E DE# E# H # x-# -# , -# 7-# -# 08# -#$ -#( -#, ^ #0  -#@ -#D  -#H < -#L Њ#P Ӛ# > i +j-# k-# l-#O mH -+ K [ s \# ] # ^ # >(new%E &E D'E,H@ FE DGE!["fs ! v"fs  0N KME#$ "ptr%p$Qe"aPe"bPe$  &k-"ptr%pp$k3E&`!i& j $ ~3q&`!|& } $)C3&`!A& B $ 53&`!3& 4 13new2E yN2E#'" t@@28(blk! ^)K#E|%bmv$8')63@@*fs0 + 17,% 2 ,4 3 ,!43,5-ret73)T8 .g@@"$ <3&`!:& ; $%3A"fs$ "blk$ '3@.@N/fs 04 70% 30 @ )  z1$32@@3 34@ @343)5k,"fs 1 D1-  %ino##fs 6 `7jfs 7buf7jsb7i36 36-  6t36~B 8o# 9 M0@ @4(fsL + L`:sbNtv1 O)XP3Z)Qez2@!@+@Q3O;3<0=~>>2[@@,3j4@@@73O?,x39<>Ce>N=Yv@d>o<>x>@@AD@B@s@w@3O9 @ @(fs (1] )-  g-jfs 1~B Cerr @D[3"fs &3&*%i %j 1  1  1 ###D83"fs &*%buf`1-  %blk 1T %bmv8E[ FG@ ##FG@ F#GG@DH30"fsG 1- I %inoJ %blkK 1L`1 MD1NE[ F&G@ GG@D 3"fs &%i %blk 1-  13%je1 `1`1 `1`1 1j31W3E[ #FG@ FG@ FG@GG@DP "fs %blk %ino 1$e1JKe131m 3###571KE%tmpE%bmv8F#GG@' '3 @@g"(fs& @+T &`)- ( 1)3)**OE[ X;(1ZHo325@@A 333I5@@>@>@>2@@332q@@334@@H 32@4@YI@4@@@@2v@@rH* B@@O34H) 4@'@ 3I@'@@;@E3/3$_ @kAw@;3<@2#@:@A33B(@:@4H 332@@ o33I@@@ 2@@33;33<@ 4q@@H 3;[ V3j;8I 3 >< @=~>Z A@;] 3<@4@@P33I@@@ ;0M!3M3B<>Y >c @o@{> > >! @@>h @@A@2@@.!3I@@@2@@W!3I@@@;}!33< @ 2@$@!33I@$@@ ?833?PQ31T >` >lD >x 2@~@@""3O2E@)@E"Hd 3X43@E@H8 3,JCO@@ "+}N3K +h}N"k -devP` `5"&}3&h}"54S>#&}R3&h}R"%cT3%tmpU`$%grV>#%pwWD##,#D 5t#"str4`%ts6D\`3#&?_&~_#1- a 1b1c1 d`1d`B 5>$"fs= &=`%sb?#5b$"fsa &a%bufc`1#Yc`1Dc`%pc`%argc`%lend31Bd31e3###K3@-@ (+}3+h}"6)-  W-fs -sbP)~B ) B L@;"M%3"3";t#%3#H#K<>#># =#w@#>#W2@F@J@%HO;#J%3#3#<(@$4@@@FHO;$HN&H,$73!$<@8$>D$J@P$>\$O>f$+@r$>~$>$2@ @ !@v&HO2@4@A@~&3O4@@@3O2@@@&HOK;"('3"3"<`>#^>#|@!#@2#?J# H\#<0=h#2@C @G @zF'HO2@%@%@`'3O2@%@%@~'HO2@%@%@'HO,2@&&@*&@'HO?2@Z&@^&@'HOR2@&@&@ 'HOe2@'@''@G(HOx2@g'@s'@A2(HO2@'@'@7P(HO2@'@'@1n(HO2@#(@,(@^(HO'4@(@(@%HOEM D3 @MJD3$@MvD3(@MD3,@MD(0@3M& D34@MXD38@MD3<@M.+E3@@MdE3D@M E3H@M]E3,@ME(L@MQE3P@McE3T@Mj F3X@M G\@M H3`@M.I3d@M2I3h@M I3l@MoJp@M, Jt@MkKD*x@_ML\*@MLr*@M^MS@MN3@MO`@MP`@MQ3@MQ3@MR3@M R3@Mc S`@MTT@M<Y@Mb= hB@Mk v0@Me <@NO $`N '3Nb 7+wN 8+NntB NwB N_+O NI;Y3P1V3@P V3@P*)W`@P@(@PtA`@PB`@P B`@PB`@P C`@J$-@O2@ oh"intXI5Sf7l~t]+(l 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0( z  % %  S Z ,3 8l J: bs   # #2 # #  # # # # #  #   P Q# S T# OM R U ]O ^# _# `# a#J b# dK e# f# g#g h# i# j# \T c kO C D#< E# F# G#g H#  I# J# K#a L#w M# N# K V#$ W#(A X#d Y#h Z#l [#p l#t     V #cS # # # o # #s #? # #  #$ #(, #, #0 #4 #6Q #8^ #:^ #< #> #@z #D #H #L #P} #R) #TG #X #Z #\ #` #d  #ho  #xl ! # "#B '# (#o )# - # .#X /#M 0# 1 # 2# 3# 4#2 5# 6# 7#6 8/ # 9# :#. ;# <#5 =#z ># ?#i @# A# B# C#" D#C E# F? #   %  % ? /  ?  O  BQ C  Dc E   t ] V C#? D#? E #8 F # , G; #\, I` #- K #+ L #' N # K- P #$/ Q #(' S #,' U#0@ V#4 h n `  V "#- #{ #? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7#X 8#\  &  k  <:#@ =:# >s# ?s# ] :: k  ] : :    z   : ]   ]  ; ] : & ` ] : A  ] : f  ]    ]     ] s:  ] s:  z&  _1 7  _V #io ] #|j :#t #  J#z l#^ :#{ p # #  P#$ :#( #, #0?% v#4W& ̑#8+ ͧ#<% #@^$ #DB #H 3#L #P J#T` #XZ #\now #`@ #d #K' #T ] #N # 7# p f[ g p' -6 > D  p&O p Z V&O |& &O      q  &e  e 7&e : !-@-@Xffs&*l-@{.@k-:fs&:J |.@90@8!buf#YD5"pI"arg]!len::q Y<0@1@X:#_- 6 :T$O0@ HB1@1@t%bufC}&D P1@)2@XO"valQ:%sW@x7,2@O2@Ve6A!cp8'6c 'b7c' 8c'I;Y:'1 :' :'*)R$\P2@2@ h"intXf~t] #9]#3#oD#2#d P2@2@l< s < et end<  2@2@, gg,{F@Wxn@_F@fI$a\2@8@r oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd% tz t K V CS#? D^#? E #8 F # , G) #\, IN #- Ks #+ L #' Ns # K- P #$/ Q #(' S #,' U #0@ V #4 V \ `  V "S#- #i#? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\     Y  <:#@ =:# >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# 8#zV#^:#{ H#ƃ# >#$:#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԱ#P8#T` #XZױ#\nowx#`@#dv#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S '  {q S ==% =:4_S`!]  ^2e{`!c  d2-x`!v  w'k:`!i  j22@2@X fs ;  old   :V`!  2num: S3@3@ !fs "2!"}2;!!num:!!map "#ret^$b2u"%|3@3@&I&=&1'":3@5@"!fs  "!map ""$!H#$i#:S#$blk$2f#(&$2y#( $2#($2#(%:#)Sk4@z4@E&n&b%+4@4@C&F&: S5@5@#P!fs $"2!$!map $#ret^ $i2$%p5@z5@&& Sk-ptrv*ppvSptrv*pv fS5@6@%!fs 3%"2%"%#ret^ (- S!&( 2&$buf&+H6@,PHe&o&c-`.{/x}0new=X%O6@]6@&1O6@]6@.2!P:3fsN 3mapN 4$OH5iQ:5inoR'6 ~:`!|  }'MX:A`!V  W'  jS6@8@&c!fsg '!dirg'.'7 h:!mapi Z'#retic8k'$il'z'(ym'')z7@7@*9'&&1z7@7@:'.%{7@7@[9'&)7@7@H&&%$8@08@&4&(': $\8@G:@oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd% tz t K V CS#? D^#? E #8 F # , G) #\, IN #- Ks #+ L #' Ns # K- P #$/ Q #(' S #,' U #0@ V #4 V \ `  V "S#- #i#? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\     Y  <:#@ =:# >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# 8#zV#^:#{ H#ƃ# >#$:#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԱ#P8#T` #XZױ#\nowx#`@#dv#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S '  {q S ==% =:l.:Vfs- ino-'J:`!H  I'-Q:`!O  P'fs fs S8@8@()fsL >(;O%oldR)](%R8@9@}(fs (ino'( Va:( :+)!$:"+8@8@#I#>"V8@ 9@#u#i$!$'"c9@g9@1#%9@9@##59@9@W)V&fs4 &ino4'Va4:%:fs$ blk$2 5:`!3  42 <:`!:  ;2 fs  ':9@G:@)fs9 )blk92) Va9:!*!$;:"V9@9@;^#t#i"9@9@>|##" :@:@G#%4:@G:@@## 4 $E+\H:@e<@oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd%tz tK VCS#?D^#?E #8F # ,G) #\,IN #-Ks #+L #'Ns # K-P #$/Q #('S #,'U #0@V #4V \ ` V"S#-#i#?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\    Y <:#@=:#>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# C#zV#^:#{ H#ƃ# I#$:#( #, #0?%o#4W&̊#8+͠#<%#@^$#DB #H,#LԱ#PC#T` #XZױ#\nowx#`@#dv#K'#TK #N#0#e  p f [g  p &67=Si 'i2OS 'uS S '  {q S ==0 =:OSH:@f:@W** 2numVoutv ZSh:@:@** 'numVoutv S:@:@*7* 2numVinv S:@:@** 'numVinv S:@:@+bm1 bm2 xS:@;@3+bm1 bm2 HS;@#;@_+H~c~* yS$;@?;@+wcw*x s@;@I;@+`!r @nL;@U;@+`!m fSX;@x;@,(`!d ende2Jei,\Sx;@;@;,p`!Z end['J[p'IS;@;@g,fsF ,G^retHJ,endJ gJ p6S;@6<@,Rfs3 -4^ret5R 7end7 g7 /8<@A<@?-map. -*SD<@M<@k-src( `) $P<@Y<@-`!# !\<@e<@-`! $$\h<@I@-oh"intXf~t]+(V0dy% HO ,38VJ: b]sA v##2# #  ###v# # #    P Q# S T#OMRU ]2 ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck2 C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t    V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F"#   %  % ?   "  2 BQC Dc EHG(dz% ta VCi#?Dt#?E #8F$ # ,G? #\,Id #-K #+L$ #'N # K-P #$/Q #('S #,'U #0@V #4l r ` V"i#-##?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\ $ *  o <:#@=:#>]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* _5 ; _ Vi#ioa #|j:#t# N#zV#^:#{ S#ƃ# T#$:#( #,#0?%z#4W&̕#8+ͫ#<%#@^$#DB  #H7#LԱ#PN#T` #XZױ#\nowx#`@#dv#K'#Ta #N#;#p f [g  p+16BHit* 2t=Zi* 2i* i* 2  q i* HH;* H:%6 D7H# K8H# L9# k:#=R,;fs* #;d#x^#bL:#|j:#e i#!#"# ##$$v#(:d* t^=:v; ;# v#:* t:v ik-ptrvppvi3JKk-ptrvi]ptrvpv :h<@<@-!fs* "4 t"% ^"4 ="!:"vxlj#=:<@>@.$$;tG.$4 ;=f.$!<:.%ctx<.&ret>:/'C>:@,A@0k$mt0$4 =0$!:1%ctx41&ret:1'C:1&i:2'|j:T2':r2'?:2' t2(:)8t)4 =)!:*ctxإ+ret:,C:+i:,|j:,:,?:, t-1i,A@yI@ 3Q.fs&* L3.ino'2l3/|j(:3/)3/;/d 4/0vX40i2:40r3:40ret3:51 4~2- 5i53ctx627:64{dC@4m G@4tqC@5A@B@RO6667A@B@668 B@B@92j61kAD2% l^70blkm=~72Tm=70opn:n8joV:k+6666|;<8<9<{9< :<(:<r:<:73#G@6G@6F8#G@6G@R=i|I@I@N;!fs * !ino 2"|j :"  ";"v3xljpa$\I@K@Roh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd% tz t K V CS#? D^#? E #8 F # , G) #\, IN #- Ks #+ L #' Ns # K- P #$/ Q #(' S #,' U #0@ V #4 V \ `  V "S#- #i#? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\     Y  <:#@ =:# >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# 8#zV#^:#{ H#ƃ# >#$:#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԱ#P8#T` #XZױ#\nowx#`@#dv#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S '  {q S ==% =:62Vfs5 $5H?2fs> $>H)C:`!A  B2 5:`!3  42!SI@K@z;fs  ;*" tp - #S;!i$H<cN%2tX&2t\!blk'22<!b'2<!j(:<"td}K@#+?J@QJ@6$I$>%V`7$t$i#J@J@@$$#J@J@E$$#J@J@K $$#J@J@P+$$# K@K@aI$$&"K@.K@]$$$\K@nQ@oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd%tz tK VCS#?D^#?E #8F # ,G) #\,IN #-Ks #+L #'Ns # K-P #$/Q #('S #,'U #0@V #4V \ ` V"S#-#i#?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\    Y <:#@=:#>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# #zV#^:#{ H#ƃ# #$:#( #, #0?%B#4W&]#8+s#<%ϙ#@^$љ#DB  #Hӥ#LԱ#P#T` ֥#XZױ#\nowx#`@ܫ#dv#K'#TK #NB#^# p f [g  p6pnV :#num :#k- :#s d# r :#C ino'#blk2#% :#V $:#fs % #k- &'#JK ''#  (:#s )j#S< '<2"S] 'HSs cS 'y  {q H Bv#P C2# D:# E:# R F:#3E G#S< =<="^ =:Hn Gino K'# L#p62fs5 $5H:K@K@<a:=b:9=^$:K@L@b=<fs# =#:=C:L@M@=Kfs= =$>H>"?<:>@<f>A<>BK> D2td!&D2>! D2?!D2B?"EV"6EV!F2k?!F2?!hG:?#%L@ #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F# n no n? n n! nBQC Dc E(]d tz t K V CS#? D^#? E #8 F # , G) #\, IN #- Ks #+ L #' Ns # K- P #$/ Q #(' S #,' U #0@ V #4 V \ `  V "S#- #i#? $!#]O %3# B, , #x 3 #R 43#|j 53#@ 6 # , 7o#X 8o#\     Y  <3#@ =3# >V# ?V#S K |3od3SY S K |3 d3S  ] n S ^3 K  S K  S) K 3 SN K |3o/ Ss K |3 T S K ^^y S K    S K V3o S K V3  ] n_ % _ VS#ioK #|j3#t!# 8#zO#^3#{ H#|# >#$3#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԤ#P8#T` #XZפ#\nowq#`@#do#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S ' nq S ==% =3 ~3W`!|  }'9 pQ@ R@yCfs C$HCcrc!C">!D !?'3"PN R@NR@?DfsM kD#$MH$WI%`!U %V%2VH&iX'!X'!X''(d)fs *gSPR@S@D]fsf D+sbh8t`bgi>Dj3 EikHE,K!)u3!v3!w3-~./3E. (0(11gE0<2+R@ S@^/JzE/>E-I@.X3kC3S@T@EfsB E#$BHx7$m\T@n@oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' { %7 { !|"###k$#k%# ,-#.#70# 1#  7 *8#9#B:#h;#<#7|BQC Dc E(dc % s y  t J V CR #? D] #? E #8 F # , G( #\, IM #- Kr #+ L #' Nr # K- P #$/ Q #(' S #,' U #0@ V #4 U [ `  V "R #- #h #? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\     X  <:#@ =:# >]# ?]#R J :vk:R X R J : k:R   d { R ] : J  R J  R ( J : R M J :v. R r J : S R J ] ] x R J    R J ]:v R J ]:  d {_ $ _VR #ioJ #|j:#t# #zV#^:#{ G #ƃ# #$:#(#,#0?%A#4W&\#8+r#<%Ϙ#@^$ј#DB  #HӤ#LԱ#P#T` #XZױ#\nowx#`@#dv#K'9#TJ #N_#{#p f[g p6pmV :#num :#k- :#s # r :#C ino& #blk1 #% :#V $:#fs % #k- && #JK '& #  (:#s )#R ; & ;1 !R \ & GR r bR  & xL # # # '#T> #t% #xq #| #w # 9#R # #t #: 9# !# "#I ## $# %9#  {q 9H Bv#P C1 # D:# E:# R F:#3E G3#R Y < Y< ?{ < :e6 D7< # K8< # L9# k:#=R =ZV4R #fs5 #ino6& # 7# _8:#9:#::#t;#0f Ng:# h:# 9i:# _j:# k:# Yl:# m< # n< # o#( p#,m G3ino K& # L#  I {$'buf(#):#_*:#'+:# ,:#|j-:#.< #h/v# I R k-ptrvppvl.:.fs- ino-& R XptrvpvR T@CT@F ptrv/F!k-:ZF"B:R#:$eh %`R DT@ U@zF&^F&V_F'tatlZ(\R U@xU@Ga&?Gblk< '- R P)ix ]G%R xU@//6`@`@726a@sa@,$G U,U86a@Ga@/!/6.d@d@,U%R d@e@U7&*V&|j:wV&V,tV)ix Weh ,- R 8W4t6 e@%SR e@k@W~&QW&/R< X&|R< [X&|jR:X)ecTR X,- TR Y,KU:qZ,V:Z,W:Z,X:Z,Y:[,3Z< &[+t['\P']'V^Z4WDpg@4h@6Pj@j@+9Ik@fl@U[Y![:i:[;.k@k@/A6k@k@u#?- R {\?%:\:i:]:eh 3]4tLm@@//07;l@l@G//6l@l@1Q]=m@m@//6m@m@1}]$6 \n@q@ oh"intXI5Sf7l~t]+(l 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO> l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0 ! "Z#B## % DIR& % %?&#D'# ) Bn@n@]Ns AN]dpC]DC^ .n@ho@^?-D^s -Nm^dp/FO: AoMXMs MN N dirP&dpQ,tR2cpR@ S:stT pG s    %C~ho@q@^X}^s tptl!  _H_ !j_!_"w##"$_q@$_q@%I; Y:Z$ \q@Qt@!oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd%tz tK VCS#?D^#?E #8F # ,G) #\,IN #-Ks #+L #'Ns # K-P #$/Q #('S #,'U #0@V #4V \ ` V"S#-#i#?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\    Y <:#@=:#>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# !#zV#^:#{ H#ƃ# '#$:#( #, #0?%M#4W&h#8+~#<%Ϥ#@^$Ѥ#DB  #HӰ#LԱ#P!#T` ְ#XZױ#\nowx#`@ܶ#dv#K''#TK #NM#i# p f [g  p6pnV :#num :#k- :#s o# r :#j sC ino'#blk2#% :#!V $:#fs % #k- &'#JK ''#  (:#s )u#SG 'G2-Sh 'SS~ nS '  {q 'H Bv#P C2# D:# E:# R F:#3E G#SG =G=-i =:Sy Gino K'# L#{Sptrvpv dq@r@_Lc`q@q@i' q@q@!tx"r@r@n r@r@#x P r@wr@a`$bbOn`?r@_r@U ?r@_r@!tx"fr@rr@W fr@rr@#O [xr@r@`%bbZ & A&'K'@'()#()#))#* r@Qt@`$fs 'ar@r@"t r@r@!tts@$s@$ s@$s@!tt+s@Ks@& +s@Ks@!ttRs@rs@( Rs@rs@!tts@8t@6s@s@E8 s@s@!ttt@%t@Gc t@%t@!tt",t@8t@I ,t@8t@#">t@Jt@: >t@Jt@#_ $ \Tt@t|@#oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd% tz t K V CS#? D^#? E #8 F # , G) #\, IN #- Ks #+ L #' Ns # K- P #$/ Q #(' S #,' U #0@ V #4 V \ `  V "S#- #i#? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\     Y  <:#@ =:# >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# #zV#^:#{ H#ƃ# #$:#(Ƀ#,ʎ#0?%#4W&#8+$#<%J#@^$J#DB ҙ#HӰ#LԱ#P#T` V#XZױ#\nowx#`@\#dv#K'r#TK #N##e  <eVS#fs  #!#end!# g"#@!##`!$##%S#@&\# p f [g  p6S '2S 'S$ SD 'D*P l {q lS ==x =:"a#  {c Sk-ptrvppvSEptrvpv":xnrV #iӻ !":" ":STt@tt@ia#`!9 a$!tt@t@a%`! $!t@t@a%`! $ St@t@ bd#`!σ7b#VSVb&neqS'end'b#Jdb'!:nrV #iv!":(""t@u@c)map! 2c*i#]c*j#pc+jt@u@),,|-t@u@.c/!AnrV #iv!"AH("ku@u@c0`!ic0 j2d)numj:Qd*il:qd+Ku@au@t,*1 d-Ku@au@25/:"nrV #iv!"A(!]u@u@d0`![d0 \2e)num\:Ge*i^:ge+u@u@f,1ze-u@u@23"?Su@Sv@e0*; e0V<Se0=1f)num=Pf4in>v3#0STv@v@pf_0*, f0V-Sf0.g)num.3g4out/v5e#v@v@Sg#`! g9#:nrV #iv!":.!S"k-ptrvpv$b"Sv@x@g#VSg#ޱgh#cޱh#* h!- S6k-kh6T k i6#Ii7 ,,,88 .i9w@w@,,-w@w@.i$J#FSx@ty@j#VBS;j'fsB j#Cj'endCk#gC #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd%tz tK VCS#?D^#?E #8F # ,G) #\,IN #-Ks #+L #'Ns # K-P #$/Q #('S #,'U #0@V #4V \ ` V"S#-#i#?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\    Y <:#@=:#>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# 8#zV#^:#{ H#ƃ# >#$:#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԱ#P8#T` #XZױ#\nowx#`@#dv#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S '  {q S ==% =:#0St|@|@rsfs/ sblk/2buf/v $S|@|@Rsfs ~sblk2bufv- SsK!%$&\|@@(oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  #   #~-M  # # # # J#  K# # # g# # # T-%r s# < t# u# v# gw# x#  y# z# a{# w |# }# K #$ #( A#d #h #l #p #t %# &# 1$# &# %# /&# "$# \'#  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d  #h o  #x l ! # "# B'# (# o)# - # .# X/# M 0#  1 # 2# 3# 4# 2 5# 6# 7# 68 # 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F # { % { % {? { { { % {BQC Dc E(d? %O U  t& VC. #?D9 #?E #8F # ,G#\,I)#-KN#+L #'NN# K-Pn#$/Q#('S#,'U#0@V#41 7 ` V". #-#D #?$#]O%:# B,,b #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\    4 <:#@=:#>]#?]#. b & :vk:. 4 . & : k:.  h d { . 9 : &  . &  . & : . )& :v . N& : /. n& 9 9 T. &  t. & ]:v. & ]:  d {__V. #io& #|j:#t# #zV#^:#{ # #ƃ# #$:#(#,#0?%(#4W&C#8+Y#<%#@^$#DB #HӋ#LԱ#P#T` ֩#XZױ#\nowx#`@ܯ#dv#K' #T& #NF#b#p f[g p6pIV :#num :#k- :#s # r :# wC ino #blk #% :#V $:#fs %#k- & #JK ' #  (:#s )#. " " . C .. YI. y y_L֩ #  #  #  #T> #t% #xq  #|  #w # #R # #t #: # !# "#I ## $# %#  {q  H Bv#P C # D:# E:# R F:#3E G#. @ @ &b :LxtzL `V . #fs!#$" #&# # %$# #&% #D&& #&'# # '( # $)#$I *:#(ptr+#,%,:#0$-#4$1#8&2v#<'3:#@L$4:#D@5#HT Gino K # L#  {. h# v : { . Hk-ptrvppv. rptrvpv. JKk-ptrv <!i'<. |@&}@s"fs;s#i=:*t$ %(}@J}@=t1%hit&$&&v!?$:L}@w}@t%ht&R':%&:t':t(r&. x}@}@u%hgtx6H@@2[7@@>gtx9H@%@2[7@%@ g! %k. ,@@kH!"fsi%'i:&b%jH!?lh'- m. ':%n(g5 Y 202$3 <5r(  2228p@@202$7|@@4<6HI@Z@ 2[7I@Z@ g5@  202$3X 4<6H@ԍ@#!2[7@ԍ@4g݆9Hԍ@@2[7ԍ@@ gh[($'\@,@-oh"intXf~t]+(Vy%(d% t VC# ?D# ?E-# 8FC# ,G^# \,I# -K# +LC# 'N# K-P#$ /Q#( 'S#, 'U3#0 @V9#4 `8 V"# -## ?$# ]O%:# B,,# x 3# R4:# |j5:# @6# ,7v#X 8v#\ CI  <:# @=:# >]# ?]#   x : v k :    x :  k :  d  ' : '  C 3 ^  :I   x : vd   x :       8   ] : v 3  ] : dI'=@@,;?;xSJK<:,<}'I@@:,Gf G]ֈJKH:,Hv'Y@@׉W,W W]sJKX:4,XT' @,@t,- DMptrvargc)$?(\,@@#.oh"intXI5Sf7l~t]+(l 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0 ( z  % "(:fbuf cp6((ret: %'#,@l@X! !1("(": ($- %fd&:p (  w= :'Ql@@fP P*$)\@@o/oh"intXf~t]+(VH(V)V(V)V@*V +V=,:(-VK.V0dy%l4`9a#.b#c#d# 2ex#f#Gg#ui#k# ol#$m#(n#,>o#0  HO ,38VJ: b]sA ##2# #  #### # #   P Q# S T#OMRU ]X ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \TckX C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t     V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o  #x l ! # "# B'# (# o)# -# .# X/# M 0#  1( # 2# 3# 4# 2 5# 6# 7# 688 # 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# FH #   %  %( ? 8  H  X BQC Dc EHG( d %    t  V C #? D #? E4 #8 FJ # , Ge #\, I #- K #+ LJ #' N # K- P #$/ Q #(' S #,' U: #0@ V@ #4   ` ? V " #- # #? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\ J P     <:#@ =:# >]# ?]#  :vk:    : k:   d   .  :.    J  :  e  :P   :vk   :          ?     ]:v  :  ]:  dP _[ a _$V #io #|j:#t# t#zV#^:#{ y ## z#$:#(0#,;#0?%ˠ#4W&̻#8+#<%#@^$#DB F#H]#L#Pt#T` #XZ#\now#`@ #dv#K'#T #NE#a#*p f$[g$ pQW6hn  P X c  P X  P  P X   q  ?P n ?n %aP n :K d #x #  #, #7 # #0 #  #$ #( #, #0 #@ #D #H< #L Ц#P Ӷ#> i+ j# k# l#O md  +  gf)Ag&:#(:#c #(c # (:#buf#err͏ #  xk-ptrvppv ptrvpv%:fs$P blk$c fsP r(y:@@!2x"K( @@#fsP Վ#blkc #num:Y$($(%j:ݏ&JK:&-  'buf@:((:@y@B]#fsP n$4 њ$% ҄ )4 c )!:$vo*es]&Tc &- ُ "9)/ |@@5#fs,P a$k--$|j-:)(. &- 0 **jsb1+A 6,`,T- .l/ )^ 0fs\P 1yB\1k-]c 1|j]:2- _ *buf`*fda:2(a:*ibc 3t44.5^( AfsP Z)X k-c |j:buf6$y 6y endy iy 6y 6-  6 es7tn8844. ( @@SS9fsP !k-c !|j:ד:-  :Z)X ^;st<(Sv< :tpf:=fd:>tԗ@? ,,,,-8 @ѕ@ ...@(. A~A"HB-@C@@8,,?x o,- .D@@l,? @,3,(,,- .>@Ig@T.^@i—Br@+x ,-8 .EX , %d ) @@9fsP -!XP q;st:-  ;bufSwjsb6:=i6 Ep ,FI; Y:q.$)\@@2oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' { %7 {BQC Dc E(dt% t[ VCc#?Dn#?E #8F # ,G9 #\,I^ #-K #+L #'N # K-P #$/Q #('S #,'U #0@V #4f l ` V"c#-#y#?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\  $  i <:#@=:#>]#?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {_/ 5 _ Vc#io[ #|j:#t# H#zV#^:#{ X#ƃ# N#$:#(#,#0?%t#4W&̏#8+ͥ#<%#@^$#DB #H1#LԱ#PH#T` #XZױ#\nowx#`@#dv#K'#T[ #N7#S# p f [g  p%+6<Bcn$ 7nBTc$ 7zc$ c$ 7L # # # '#T> #t% #xq #| #w # Y#R # #t #: Y# !# "#I ## $# %Y#  {q  c1$ M1MS$ M:= i { ck-ptrvppv6Bfs5$ $5XQVaPVbPVc4JKk-ptrv Ofs$ !)Wc@ڞ@"fsV$ F#)V e!*acܞ@@"fs`$ #*`[ ϙ!)ic@7@ "fsh$ H#*h[ g$)!B8@͟@%fs $ ՚& B"%i Xf'bg":(h#:)($:*@@-++$)TcП@@Z&?PnЛ& Pn &|jQ:&O)Q:؜&]ORV@&-Ry,)SZ'fsU$ )- Vc^-iW!) Xp()Y:(Y:)w)Y:۟)ZB-blkZB2)`[E'cp[.*I @/i c++|0 1i&@N@m++|2=@N@3y1iˠ@@8++|2ؠ@@31i@@i++|2@@3Ѡ1i@&@++|2@&@3 4 +5A6J@u@++6{@@*+++7i@@++|2@@3_2U@y@8gd<N74u@y@C+C$ 9)@c@@,?=n,|j=:,O)=:,]O>V ,->y,)?Ze]1$*\@Ҧ@5oh"intXf~t]+(V0dy% HO ,38VJ: b]sA v##2# #  ###v# # #    P Q# S T#OMRU ]2 ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck2 C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t    V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F"#   %  % ?   "  2 BQC Dc EHG(dz% ta VCi#?Dt#?E #8F$ # ,G? #\,Id #-K #+L$ #'N # K-P #$/Q #('S #,'U #0@V #4l r ` V"i#-##?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\ $ *  o <:#@=:#>]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* _5 ; _ Vi#ioa #|j:#t# N#zV#^:#{ S#ƃ# T#$:#( #,#0?%z#4W&̕#8+ͫ#<%#@^$#DB  #H7#LԱ#PN#T` #XZױ#\nowx#`@#dv#K'#Ta #N#;#p f [g  p+16BHit* 2t=Zi* 2i* i* 2  q i* HH;* H:%@*j)* #erri#O*Ai@@֡fs@* )*@O- BiorbCAh D~E= 1*-:@Ҧ@עbfs(*  (t; % )^ 4 *= !+:,vs!rb.bAc3$B+\Ԧ@?@6oh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' { %7 {BQC Dc E(dt%  t [ V Cc#? Dn#? E #8 F # , G9 #\, I^ #- K #+ L #' N # K- P #$/ Q #(' S #,' U #0@ V #4 f l `  V "c#- #y#? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\  $   i  <:#@ =:# >]# ?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {_/ 5 _ Vc#io[ #|j:#t# H#zV#^:#{ X#ƃ# N#$:#(#,#0?%t#4W&̏#8+ͥ#<%#@^$#DB #H1#LԱ#PH#T` #XZױ#\nowx#`@#dv#K'#T[ #N7#S# p f [g  p%+6<Bcn$ 7nBTc$ 7zc$ c$ 7L # # # '#T> #t% #xq #| #w # #R # #t #: # !# "#I ## $# %#  {q  c1$ M1MS$ M:="sas#  {c  { ck-ptrvppv!:nrV #iv!":c'ptrvpv"+cԦ@@#fs$ $]+:$+:%i X1%j!Vi&5+":&+":!O+#V&- $c&%&{+%!++&:%blk'B'#+(Bt`&*)7V(*dЧ@(+bʧ@(d*y@)@4@7d**+)@4@,)_@u@?**+j@u@,- *. ,)@@Y**+@@/0g@u@*+g@u@,f+:&fs$ *:Efs$ 1+Pc@ԩ@2fsO$ ئ3]+Q:%3+R:N1+Ccԩ@@w4fsB$ 1*>c@@4fs=$ "+c@@ϧ#fs$ $]+:E$+:e%iX&*Ψ&*$%bufz&- c&5+:C&+:!++:&+:%cntV%blkBz'#+BtD&U+BF&*7&*75*!@5*@-L**.,60/m*.P,7@@#*+@@/@7@"@+*+@"@,7)@7@-*+)@7@,-p*8`.,)@@=*+@@,)O@c@n*8~+X@c@,7@@'*+@@/6*.,9@ï@*+@ï@,1+Hc@@2fsG$ 1{*9c@+@*=4fs8$ :*4c,@?@V4fs3$ S6$+\@@@t:oh"intXf~t]+(Vy%,>9?#e,@k#H,A, + % HO ,38VJ: b]   V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !.# "# B'# (# o)# -# .# X/# M 0#  1># 2# 3# 4# 2 5# 6# 7# 68N# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F^#%.%>?N^n(d$-A tfVCn#?D#?E#8F)# ,GD#\,Ii#-K#+L)#'N# K-P#$/Q#('S#,'U #0@V #4qw`V"n#-##?$#]O%:# B,,#x 3#R4:#|j5:#@6# ,7v#X 8v#\ )/ t<:#@=:#>]#?]#nfx:vk:ntnfx:k:nd n : fn)fnDf:/nifx:vJnfx:onfnfnf]:vn f]:d/ , : V;:#tdb< #=#-@f# b-B:#V-C:#?Fy# n k-xptrvppv,mn@@O@ -l:,LnP@`@ ,Ef FxJKG:,Hv k-Ik0-J:5Kn,n`@ǰ@گ ,f,:, S- n|/ W,nȰ@%@o ,fܰ xJK:bufv- n, E+n(@g@n ,f- nܲ, F-"nh@b@.K , fZO- ʳarg!- #n.,$ xtmp%xend&մ {-n !tdb "]O:#- n#,#,$7-nd@ @F %,fr% x%JK:&k-:'sz: &M,x3#-x&- n_&?y&, c(,ɴt(,ɴt#-ʮ&-x) @@ * * + @@, -K (.g η.\ /,r 0} t0 t ,n@,@#,fO?xk-:bufܸ, - n5QyO1-x1JKx-n,@@o,f xJK:bufa, - n̺,vn@·@4-u u,n",f!tdb #- n# #,#,#, #,f#]O:2[ nptrvpvp-nķ@C@! ,fM, - n34.P*E/ ,[0fw0qtw4|,4b45L@)@ɹ@*+@ɹ@4)ӹ@@*+ӹ@@4Ƽ6@@*+@@,7-R',Qf-WnD@@?V|jV:,V ioXf,Y J- Zn8*@3 X^* * /p, ) @@c* * +@@, 3 h'* * /4 ) \@i@A*)@@j*+@@,6@@*+@@,(&,V@(-dĭ@(eȭ@(-f:̭@H(k,hw@H(,id@H&(-j@9I; Y::c`@q9$.\@&@=oh"intXf~t]+(V."dH(V)V(V)V@*V +V=,:(-VK.V0dy%l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0 (d %$-A tVC#?D#?Et#8F# ,G#\,I#-K#+L#'N# K-P#$/Q0#('SU#,'Uz#0@V#4`V"#-##?$#]O%:# B,,#x 3>#R4:#|j5:#@6D# ,7#X 8#\  <:#@=:#>]#?]#   : k :  7  : 7 k : =  dT n  : nT  z   :   :    : 7     *  * U  ] : 6 z  ] : 7[d8/@bufA# B# .C:#DV# WEV#  .LYVM:#devN:#|jO:# .P:# ?Q#3ERY# S#iptrp k-ptrpp /@(@#,A*- ,#ؾ-S(@ż@,P#- Q]c.R3ET .Ttp+/T)iU:R.ȼ@Խ@pp,,# ]JK:"buf7Bk-vb5Q0-:- .\@2.Խ@M@Z,},~#.:3E- .tpi:?{/P@@]I ,,#-  C/p@@ ,n?,n#h3Eo o]Y/@(@` ,/ ]OJK:!buf7,#3E5.S- scpp.:V.(@E@ ", 7"JK:#buf7 }.H@d@gj ,,# ]JK:$bufD- |k-v5Q0-:N$.@.Ed@b@l2 ,C C]JKD:C!bufD{,F#3EG.G2 X- H(cpIgiJ:jJ:B .d@@ ", "JK:#buf F.@ @G ,sO-!arg,#Ttmp]rend/ @@ ,?Qk-:!buf7,#- "0-va e.:@@,9#3E;i<:%i@@E&|'@@(tt.&@]@,$,%#D- 'b3E(i):%)@@@1&&'4@@@(tpj/,`@@,+,+:W,-#- ..@@#,O,#- )iH@e@$&|'H@e@*)io@@&&|'o@@*%i@@'&|'@@+O/@&@9D?e|j:",nio,,#- /k:)st*@-&&.+-&&.+)@.@&&'@.@*<)i@@ &|'@@+%i@@ &|'@@+//s@@0I; Y:1n @;$/\(@@Aoh"intXf~t]y HO8VPQ#ST#O MR U ]?^}# _}# `}#a}#Jb# dKer#fr#g}#gh}#i}# j# \ Tc k? C D}#< E}#F# G#gH# I# J#K}#aL}#w M# N# KV#$W#(AX#dY#hZ#l[#pl#t   /:(@@h GY<$/\@o@Aoh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd% tz t K V CS#? D^#? E #8 F # , G) #\, IN #- Ks #+ L #' Ns # K- P #$/ Q #(' S #,' U #0@ V #4 V \ `  V "S#- #i#? $#]O %:# B, , #x 3 #R 4:#|j 5:#@ 6 # , 7v#X 8v#\     Y  <:#@ =:# >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# 8#zV#^:#{ H#ƃ# >#$:#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԱ#P8#T` #XZױ#\nowx#`@#dv#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S '  {q S ==% =: 5:W`!3  42/.:@o@fs+ $,H*- K&/2 /2/2j0:0: g&0:t`!+@@C"J">!+@.@G/"J">#+<@P@<"J">>$=1\p@0@Boh"intXf~t]y8VQCt(d p6p V:# num:# k-:# s _# r:#/q .2 qC V:# bbC# ptr:#j s;0tt  ptrk pk  k-m ptrk ppk .!"mk-m ptrk pk IJKmk-m ptrk0:p@@bbC?blktvlow::mid: 1:@@=bbCblkt1:@ @i#bb͘blk͂0:@d@zbbCblkt0:i:@L0d@m@^bbCblkt1:p@@1Nblk_bb CI1:@@91blkYg1E:@@*fbbDC02:@3@Vbb11Cbb21C}1?:4@=@bb1>bb2>2#@@a@&21"NRe\@a@(x \@a@0,d@m@}\1+1p@@bbCret!1N- ."#0N0@@Wbbret1l@@bbkCblkkt- mcin:jn:9!"om"Hv#`$qf0@@bbblk%/1"@@&k- :num :4&s  _Sret!'bb#C- $(&#(-3'\@y@ l@y@$)e@@Q@/x @@Q@C1P@@BsrcOC &`O5- Q`0\@ @|srcZ*`[|0G@ @retF|*k-F:+1? @0@ret>*k->:@$F2\0@o@Doh"intXf~t]y(d%O2G0@o@ eEu argEk @!F9A$w2\p@@#Eh"intXf~t]yHo2Ob2<vp@@{crc;vH;len;Ocp=   A k 2 ]@ A$2\@@Eoh"intXf~t]+(V0dy% HO ,38VJ: b] k##2# #  ###k# # # { {  P Q# S T#OMR~U ]' ^# _# `# a# Jb# d Ke# f# g# gh# i# j# \Tck' C D# < E# F# G# gH# I#  J# K# aL# w M# N# KV#$ W#( AX#d Y#h Z#l [#p l#t  {  V # cS# # # o# # s# ? # # #$ #( ,#, #0 #4 #6 Q#8 ^#: ^#< #> #@ z#D #H  #L  #P } #R )#T G #X #Z #\ #` #d #h o #x l !# "# B'# (# o)# -# .# X/# M 0#  1# 2# 3# 4# 2 5# 6# 7# 68# 9# :# . ;# <# 5=# z># ?# i@# A# B# C# "D# CE# F#  { % { % {?  {  { ' {BQC Dc E(dd%tz tK VCS#?D^#?E #8F # ,G) #\,IN #-Ks #+L #'Ns # K-P #$/Q #('S #,'U #0@V #4V \ ` V"S#-#i#?$#]O%:# B,, #x 3 #R4:#|j5:#@6 # ,7v#X 8v#\    Y <:#@=:#>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {_ % _ VS#ioK #|j:#t# 8#zV#^:#{ H#ƃ# >#$:#( #, #0?%d#4W&#8+͕#<%ϻ#@^$ѻ#DB  #H!#LԱ#P8#T` #XZױ#\nowx#`@#dv#K'#TK #N #%# p f [g  p6,2S^ '^2DS 'jS S '  {q S ==% =:2S@0@fs H sg&=b]t`21S0@@4fs/ ` /g&0=b2]t`2BS@@LfsA x AbA=?C$2\@K@Fh"intXf~t]yo$-:2{r@K@;fdz3?zrg 2z3 I;Y36C$c4\L@ @|Gh"intXf~t]+(O."] 'OH(O)O(O)O@*O +O=,3(-OK.O0]21yo6 ==!#7"#l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0 >' 6 ; 6 < 347Fz4G,#V>H,##4I#yfJ#:K|# 93 V66 > 5 = > = < 5 > |= < 9 F9; =3 6 4 3,>"9?"#e,@d#A,A + ?#=z# fd3#3v# >3#H63#:<#<3#$<D#(R:#,{M#0|jO#3#D#X# #logM#: 1#/k 3# 5 O#6 J#45 #X@3#33#3z#;3((z33!5@17OGG(F<v49#;z#~8O=O13D#3v#:v#;v# 58O#VO#5\u?\#ZO# 7O#$?ځ#(&@ہ#,5܁#0@o#4lllw> s 3#JKO#Z<O#@D# offO#]O#83# 6b># 9#t6#<# ?#;9>#3zv3b3vO3333>333dP605 >49#<<J#oC[ #i4C[ # @H3#8M3#>Pv#Y_>B R:C#P=C#y:,[ D-[ # -[ #?.#P/v# ,0"# 4>L@W@ tdb=7QX@@ tdbP>iRO^;9g3@ @|c tdbe ?e!8f3!V?f3-!Uf3Ylenfd"flh'reti3y=f3 @}@ tdbe!Z<e36x3@@ tdbw+rety3T923@@r tdb1off1r3O3@J@y tdbNoffN$iP7#JKQOUk>zL@@h bufz!k-OiO"p73@@ tdb$'5@@"% tdbPM33@@Nq tdbz!?dq $p6@y@ tdb!~6hO5%8@y@offO93|@@4 tdb!?dq (&offtp ?3@X@F tdbr!?rec 43X@@ tdb!?Brec a&rT$<@@+tdb!~6hO?!3@@@xtdb llen  U 3+4<3@@tdb: ?: 8;3 V?;3 U;3len;d43 @'@:tdb% ?R PvQ6 v(@f@8tdb d&el[ R#6vw:3h@?@tdboffrec 46 3@@@h>tdb off !D #> &i tp$;* 3@@Otdb( {!?( rec) '9+ tx13(= @@tdb ': tt$;2 @m@tdb1 B?\p@z@v<tdb[k:f3|@@jtdbe)9o@@tdbn:3@@tdb~':t|73@@&tdb3d@@R1tdb%<3@@~_tdb(:@@tdb:7O@@keyG#vO-iO@$!6@@Stdb fmt(5@@Vtdb 53(O;@@tdb 7=F<M?z@@tdbI@3@@tdb/!Z<3c)x<z?3@@DtdbC@3@@rtdbI43@@tdb^:3@@tdb1!Z<3pop3)x<zK73@@F'tdb2:3@@rUtdb;3@@tdb`<3@@tdbX:3@&@tdb<c3(@@"<tdbbNlenb!Ub3&std=73@@,tdbX*8@P@"el[ %u@@i3w43@@@$tdb!s 39!Z<3Xret3i3lckD)x<z8*3@@g@Satdb)key)(V9 3h@@tdbkey(73@@tdbkey(83@@(tdbi(9ret3Wn@ 3@@uxtdb&st =+6@3=3@@!7<3tdb>\?3@@z1tdb!k-!M>&buf1w,"n+3"ret,3B-l?=Z3@5@tdbXoffXbufXzlenYvcvY33el[[ S+@,#2_v 938@@>tdb offYbufylenv>3@@tdboff_bufzlenvcv31%@@retou83@@;tdb!73#<;)k-3ret3S+@8x3@@tdbw#I8y #5y,),z"pz"p'({Otl&rec|D,ofsOlenO .? /tdb0o;3>1X/ino"i< @@g!?!73+!?3!/k3g! !7= g!: &a tdb  &st =rev3 #<3" vp" ),7O2+s=&@37@A@T45(n#D;3 6 d@@7' 7 %d@@83" ?@@@  ? 73 ?3 /k3 >"@E@l mtdb !? lenv buf" @53H@@i  tdb key( !? lenv$!3%f!,z#,(#33%((z 8I @@tdbG ;keyG (d!]G O|rH ':J tl83@@i tdb,offdbuflenvSel[ s#<[ +|@5H8 #2v*D@a@R )~6O,x#,"%;O3@@N tdbNz+*@Z3-3@@ tdb+ k-+ M>,93@l@r!tdb!s 3S!Z<3rop3)O5Di3)x<z>3l@@9!tdb s 3 Z<3=3@@e!tdbkey(93@ @Y"tdb!s 3!Z<3ret33d  @@A"tdbb mkeyb (!]b O! b 3 recc )#:e OUr7 3@@4#tdb key (!] O&rec \6 3@@!#tdb key (M#] Oa> 3@n@t$tdb key ( 3 % , z#: &rec Xret 35#] OS6 (p@@f$tdb key (#: &rec T"ret (#] O76 3@@d%tdb5 E!?5 nrec5 ##97 #'7 + @+'W ]@+4} @5P%&l[ P#7\ d,&rF P0W5<3%/tdb;/off;"i=0>?I3%/tdbH/offH; 3@@&tdb !:  rec #> i 'm5 P3d%@@ p&4%4v%%@@8%6%@%@ 4%4%:$ 3@g@4'tdb# `!]# Ores% 3&rec& P#:' +A 4@,#D2 04 3j'/tdb 1] O"res 3): "rec -6H 3h@@/(tdbG [keyG (!]G O#:I &recJ LretK 3)9'W 49'4-',8E']8Q'{:]'7| 3@-@m(tdb{ key{ (#]} O8z 30@@(tdbx &!l7x Zrecy '?8{ 3tp+ @,0)!  z5T (@@2)tdbS "keyU (&recV Tf= 3@@; )tdb g fn  !, z tl  &key (t@',3 (t&rec Pret 3 'JK 3tH;out @=6% 3@@E!Q*tdb# q!fn$  ,$ z&tl& \ret' 3!4> 3@| @!*tdb< !fn=  ,= z&tl? \ret@ 3"05t 3+/tdbs /keys (1]s O1,3s ("recu ):v 0X= c+/tdb 1] O/r 1P v): 0%: ,/tdb 1P v/rec ): )> ): <  +: #> #3 v#)J: +2WD 2 08 x,/tdb 1P v1: /rec 1> )w8 ): 0=<3,/tdb;1k-;"rec=)?>2{=)=^f8 3| @X@F".tdb r"key (" ,3 ( !L 3"&rec L#] O$##: F#p #ret 3#2"2 >*H -4*4*7*,$4*,`:*8 +D$3+ @ @ .7J+$4@+44+4(+,x8V+$9c+4+4+4u+,8+%?+?+?+@,. @@, @>, .4S,4G,4;,7/,l%4#,, :_,8k,%9x,P 7,&&4,,:,?,@, @,?,2;/3X@@&x/tdb.&key.( (3.( ']0OtX#,31(&ret23:'+4PL@,)9>"b@- 3@@X'/!5, '!:, 'key. ('',. (l57 3@@'k0tdb6 '!96 k0^(#58 (&rec9 P#:: :))>: ret; 3Z)+n @3>%3@@)0tdb$key$(93@2@)0tdbkey(;34@^@)(1tdbkey('?A 3`@@*u1key@ (I*!,@ (]* ,@ z:m (@Z@q*1tdbl *!7?l (_+#:n O+"keyo (&recp Tkq "+m9 3\@@ ,g2tdb L,ret 3,# ]I-)? #: r-&rec P04 2/tdb 1] 31? "rec )@ )+; W8 3@@-U3tdb -i 3-': tp"top 9g2 42424y2,0:2L82&.82D.(: @E@d.3tdb .i 3.0=33/tdb1?/lend)JK3="tv02>s34/tdbq1?rq "elt[ )6uv),v""pv")6wJ"recx )`6y)<y)>z)V{O)+;{O0_?$34/tdb 16!41`6"q 1<#4"rec%)6&J)I8'v43H@ @.^6tdb/#6JR/#?/'(Otp>3X5434343,p830,?355"el2[ 934343,84X0840?48+4*185418A4$28M428Y4E38e438q4%48}4494h44444444,:4?4844n6l 'TD6`s@^6'<P s@'9@PHs@'u5Э@AI;Y3B; (@dG$_A@ @%@Toh"intXI5Sf7l~t]+(l 'ly.a%1?id2#t3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K(z  #9z#:#    % D#2#   l 6AQ: @ @]5 KA\: @ @5@?FargA @!@5ZA?5fn?+6tmp?I6fd:|j:):@a!@"@6et6el'7el2@a"@8#@70et7eloA:8#@J#@8ZA9AeL#@%@-8#daY8 ?f:tletg8 @hatpCAi:cpj?8!A$@"$@$@msg#%$% H3@ IE:ܭ@ .A0@ V&I; Y:'5ԭ@'@6ح@GI$A@%@U%@9Vo(7]D%intA>%@U%@9num,-9 chIL9 iI pu9% % ? A`t@ % buf@[ J$A@X%@&@V7B!0-B:oh"intXI5hf7~t]+( 'y.v%1Tid2# t3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`(  :B,    v  %"B2X%@d%@9 B0#0vfmt0Js1% %   %AE_d%@%@9_AD9xF9  AP_%@%@:xQI:B%@P&@\:B:#v:fmt:Js%+;A9P&@&@K;9B6#7vfmt8A:%w; 8F kA.@keK$CB&@[(@~Woh"intXf~t](V0dy%^C[B4FB&#B'#C(F#B)#C*#IB+:#TC,k# C-v#$C.V#(B/#,CC0#07CQWC lB]#zC^#B_v#C`v#BaV#uBb#D# #B>:.C?#?B@#%CA#BB#CC#QBEEhC?&@'@; 3E=F; #Y=< v>< dev@4= cAFtp tBtl vBth retC]= outc&@ %C'@[(@= 3EF= LC7> F{>^:> dev> c Ftt ret!&?CL$CB\(@/@zXh"intXf~t](O0]yo^C[B4FB&#B'#C(F#B)#C*#IB+3#TC,d# C-o#$C.O#(B/#,CC0#07CQWC lB]#zC^#B_o#C`o#BaO#uBb#gDD V3# dev# p*#*D*# *#B>.C?#?B@#%CA#BB#CC#QBE0 >. add+* ,* D-* ,X V* DW* 0e Kd* D.3\(@(@O?\1,{?_-\?v-\?tag/bhyDk(@(@?3EjF@_jbD@yNl@tmplpm*@EF(@I)@@1devE@_Eb-ApG*cA,)@A)@tmpMAADX3L)@)@AdevVA_VbBvWb8BtagYXBCN)@ +@BJ3EKFB_LbBvMbByNO CdevPACpriQ3aCpR*C]DS3CSDq**@m*@tmpcC+D>+@0+@Cu1= DD.0+@+@4Dtag-`D>+@H+@6 !C+@H+@f"D"D!H+@S+@7 !N+@S+@f"D"DD+@+@EK#dev0E$1D3+@k,@[E#YbE%D%D?EvFcp&tU,@9,@U,@cDl,@,@sF tagF EK2 addJ* yNJ* D3,@/@FdevF?bGvbG DGtGyNvHvalHDH'tβ.@ -@-@ % !-@-@L "*I  .@0.@V % !.@0.@L "^I"I! .@.@ % !.@.@L "I 32yN$oEB/@0@wZh"intXf~t]H(O)O(O)O@*O +O=,3(-OK.O0]yl4`9az#.b#c#d# 2ed#fo#Ggz#ui#k# ol#$m#(n#,>o#0o^C[B4aB&#B'#C(a#B)#C*#IB+3#TC,z# C-#$C.O#(B/#,CC0#07ClrC lB]#zC^#B_#C`#BaO#uBb#D# #B>U.C?#?B@#%CA#BB#CC#QBE`*E/@d/@I 3EaJ p;J EoJ st ./@T/@dev@&arg%TEO3d/@ 0@JM9ENM yBNJ3EPahadEx3pyNwwEt 0@0@TK# 3EsaKS(~d20@;0@devS@dK Q0@{0@tagUSX dK \0@h0@badUCE"3@O$: B0@3@[h"intXf~t](O0]yo^C[B4FB&#B'#C(F#B)#C*#IB+3#TC,d# C-o#$C.O#(B/#,CC0#07CQWC lB]#zC^#B_o#C`o#BaO#uBb#E;FVk3#3ElF#TFm#`Fn# poC#CDC# C#B>.C?#?B@#%CA#BB#CC#QBEI ,X VC DWC E90@0@K dev8 E0@0@L11AL E30@81@lLx1LExLdev Es81@u1@M3ErF0M1t  F3x1@x2@[M1MTFM`FME1F 0e1 KdCdEx3N yNwC"F x2@2@MdevN2@2@)$2@2@fUN~N1p*BN2@2@tag+E2@3@NdevNQ$FB3@5@]oh"intXf~t](V0dy%^C[B4IB&#B'#C(I#B)#C*#IB+:#TC,k# C-v#$C.V#(B/#,CC0#07CTZC lB]#zC^#B_v#C`v#BaV#uBb#D# # >. add+ , D- sFk:3@3@NU 3EjIO}Fj:RF:3@3@-O3EIret:mF: 3@F3@YO3EIret: EK addJ yNJF3H3@5@O3E2IOF2O|j2:@Pdev4`Ptmp4p5PE5 QF\bQ4@4@L4@4@L Q%. y\S$FB5@8@"^oh"intXI5Sf7l~t]+(l 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO> l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0 ! "Z#B## % DIR&  ? #D # ) R5@H5@QCs QCQdpSQDSR F%H5@5@$Rs$PRP$:Rret&R %F75@5@*Ss6?5@6@VS?>Ss >CSdp@F_6@h7@SAo]TXC],Ts ]CXTF^ dir`TdpaTtbw@ c:std    %Fh7@8@ U8XC9Us tptlFthdir8!   N F>@k6T$WB8@zU@_oh"intXI5Sf7l~t]+(l."z 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>$]4 l4 `9 a#. b# c# d# 2 e# f#G g#u i# k# o l#$ m#( n#,> o#0 SR , Z 8l bs sA^C   [B4 B &+#B '+#C (#B )#C *#IB +:#TC ,# C -#$C .l#(B /#,CC 0#07C   C  lB ]+#zC ^+#B _#C `#B al#uB b#IG gD  % D  TD T#  T# +H,e Su u Ufd:#3E#dev#X# G#buf#fW# SjP" : x # eMU%#"R&z#T'l#H(l# nW)#QU*# % 3!V 4#cS5#6#7# o8#9#s:#K;!#Q<1#8^=#: G>A#<?#\@#` A#dBe#hoCQ#xl Da#E#BF#G#oH#Iq#J#XK#M L# M#N# O#IP#2 Q# R# S#6T#U# V#. W#X#5Y#zZ#[#i\#]#^#_# 1 u SA u Q u %a u %q u?  u  u  u  u ]Ti -Oi #RV#H#V#*Iy #JVe# 4G #0K #lKIy #xT#uJ#N# Sy u  u  u % u Mtl bS#Q#S#J# X#cH#Kl #mT#,K| #.L #4Ll #@Oe#TTNQ#d | u  u S u H< Ue#J #hLe#Xe#$>G#4  u R Qi #K#J#P#]L#R#W#>V#2T#Q # @Xe#Pe#ELe#  u J  O #'Ty #Qe# S u kQa crcѾ#RҾ#2Ӿ#QQԾ# hO@ V #k-̾#|j;#Mξ# Kq#V # ?q#0  u JHP M۾#Uܾ#,Rݾ#We# HQ#]MP #,K# S` ut4LL#J #lV1# I# R#V#U1#U1#,US#U#9T#wQ#G#L# P#$dK#(RM#*S#,O#0Q#2T #4"S#@wRi #CU#GM #RN*#ZK1# S u   u  u S* u S: ucJvsI#G #X1# N# V #T #W 1#-W 1#R S#N#9P#BI#O#NW# P#$BOi #'R#+P #6Vv#>S1# S uxX 9?9#K# I# P#T #T!#[U"#HX##W$#GT%#k-&# I u M@;GAH<#X=#I>#G?# S@#*JA#iB#C#k-D# +GE#$XF#(VG#, MH#0UI#4xPJ#8UK#<G TIUi #XVi #KW#_X#"MY1# S u % uS\GQ]#X^a#0$P_1#pK`e#rWa1# S- u/wS`mKn #)To#Qp#Pqa#re# S u S uO8W@|J}#S~# xH#( % u % u % uXR`GS#~H#hIS#|jS#S#'H#( #HQ #P6R #X S u S uqM# P#P#Q#Q#VG#aQOK#DJ#TMS#Q#J#Q# L#$H#(VG#,L##0Q##@!W##P{Oa#`Wa#KTI#G#mK#  #$R#(zT#0"Q#8LJ#@!G#AU#DN#EhU#H#P  u  u  u O V#K#FK#lsn#5#N#V#|j#W#H#JL_#len#M#R# 6O# |j# M#)N#N#O 2V#Q# U#XH# @#N#id#OfK#1X#P#I# P# ?M#W#X#S#$O#V#X#V#"$P #$X f#%G #@FM #D]K #FT#J Q#NN#RW#TJ#XOL#\ W#|@U#~qL# v uRD# #_ #!# SX"# @##  X&Fk'#(#-S)#\W*# ST+#8N,#L/:0#,M1#L2#TP3# uL6R7#M8#vUP<5U=#Q>#PK?# R@# ( uTCKD#ZE#'VF#IG#@H# KOI#GJ#XK#NL#WM# xWN#$zO#(PKP#,QQ#0.PR#4SS#8WT#<HU#@WV#DTW#HOXL#PUY#pVZ#~J[#K\#N]#H@e(idg#Vh#Oi#Gj#_k#Qm(# 8 uP(:8@A8@YUX'Ulen':Uend)U S4K:D8@K8@UH΄ VGRL8@8@VdirJVJK:hVi:V WQ(:8@8@VU U&!id&!buf'"UI :8@8@WaI >W#id $Kl%buf&k-l#il#crcl',(!L6w@ ) N:8@2:@W UidWbufW(O:t@*X Wp!Xq4X(SZ DilGXblZX+I9@9@,-mX.I9@9@/0X/  %! u'R:4:@W:@XY! U!id!buf#dlY! \P:X:@:@X! U!id!buf#iso!*X"Y  Kb::@:@5Y" U_!id`!bufaGS::@:@aY|" UP!idQbufRY#csbT|"*XUY a GD::@ ;@Y" UA!idBbufC Z#rosE"*XFCZ  L7: ;@U;@aZH# U4!id5!buf6(SZ8 L1PX;@;@Z#devZSZZtag [2str#G %# u$(L:;@;@@[$ U!id!buf#osb$ -J:;@o<@l[n$ U !id buf[#jsn$*X[  4J:p<@<@[$U\!idbufN\#rs4$'X  T:<@2=@\Q% Uid\buf\#rsQ%'zl*X4]  nX:4=@t=@]]%U]!idbuf]#xs%*X] 1{Vt=@#>@^&&dev?^id^^buf^es&&^3X^ W:$>@N>@_& U!idbufD_#es&&Nz:P>@>@o_& Ux!idxbufy_#es{&&T`:>@>@_.' U^!id^buf__#esa&&Q:>@?@`'UI`!idbuf`4ovhG|4ovl~*a`L6?@@@` (pr4`off5 (alen5]a3>Q7}a59X8P:@@A@a(Uaidabufb4j:thbs:=b(M!tl#m( Ik:A@B@[b(Uhbidibbufjb#swsl(  NF:B@^C@bj) UC!idDbufEc#hfsGj)(QHp)[*SZI>c  %) uSg:`C@F@fc*Udc!idebuffc#nsh*#mfti*'Kj*(Qkp)W(Jk*~cpkc*Ml:d*Il:Gd*Rm:ed*Om:d'6Mm:inld*dXnld*Snld'\Xo:*Vp eoffq Xe*Hre#valr    %+ uV:F@I@e,Uf!idbuff#vs,#ms,#dir(:I@J@i4-U;>iid<^ibuf=i#ms?,O:J@K@i-Hi2f-t2buf-cp j7t  %- uO~I:K@XL@5j-nowaj(I @4ret:@@oG:XL@L@tjI.nowj8I@2ret:D@X7:L@M@j. U5!id5buf6j#es8&&H:M@lM@k. U!idbufAk#es&&9GPa:.,/-/l6///%/?0/_$$X0%valG: Q@Q@mO1U@m!idbuf`m#sbdO1*Xm@0Q@ Q@41-0m+07Q@>Q@-0m OWS:Q@ R@n1U3n!idbufSn#sbdO1*Xn@0Q@Q@1-0n+0Q@Q@-0n$_V2%valAL&q2%str$&~N$:%buf%&P%:#i':#j':#c(l4I\: R@zU@n5UY&o!idZbuf[^o(R]'^5*W_5okey`5o':Ia5sbdbj) p'WOcl']Ndl']Geloffflp*zglp' Thl*1Hilp*Mjlp'Pkl*oNll q'Oml*3Nnl>q*Kol\q'$Pplextq:zq'Gr*SZrq(Qsp)[(Xs5{@0cR@tR@=4,0@0R@R@W4,0@0R@R@q4,0@1R@R@4-2q@0R@R@4,0@0R@R@4,0@0R@S@4,0@1FS@LS@4,2@0S@S@|5,0@1S@S@}/5-2q@1S@S@~M5-2 r@0KT@RT@k5-0r@1YT@_T@5-22r>28,F2-:2Er,.2,"26P0R2gr/\2/f2 v  F ( %5u l6 u5(L6w@ -6 u(*K6 @ #O6 uV(BS?6@BI;Y:,X$pYB|U@OZ@eoh"intXI5Sf7l~t]+(l 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0^C   [B4 JB &#B '#C (J#B )#C *#IB +:#TC ,# C -#$C .l#(B /#,CC 0#07C U [ C lB ]#zC ^#B _#C `#B al#uB b#  D #  #   YE|U@U@r' cpDschF%Hs :Y>U@U@|sR cp=s ~YYV@OV@s5YXspZ)YX:3EWJJYWcpWdevYretZ: X:D3EJdevcpDtmpend?ret: dY:ocpDpZY:cpDPY1:3E0Jdev0cp0D?2v3ret4:Y:"?DvDcpDendX}PV@OZ@t3E|JGt~gtbuf_fd:twY:sttV@ hdevtendlu!"0u## $%u&h]### %u%Ov$!9# ## $!Hc### `% ~v%v$"%-w$8'oW@X@ӻ#(JJW@W@#[ %ejw )%*[Z$YBPZ@#]@goh"intXI5Sf7l~t]+(l 'lH(l)l(l)l@*l +l=,:(-lK.l0zy.a%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 l4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0^C   [B4 JB &#B '#C (J#B )#C *#IB +:#TC ,# C -#$C .l#(B /#,CC 0#07C U [ C lB ]#zC ^#B _#C `#B al#uB b#  D #  #  B >>.C ?#?B @#%C A#B B#C C#QB EI  dE x:l yN w Y: dev ptag.> Y::PZ@#]@w3E9Jwp;wtmp</xY=kxyB>x?xfd@:yret@:lystAt[@devyl|}y$[@7[@[@[@"z %I; Y:[$YB$]@X^@Iih"intXf~t]H(O)O(O)O@*O +O=,3(-OK.O0]yos:IGl4`9az#.b#c#d# 2ed#fo#Ggz#ui#k# ol#$m#(n#,>o#0Y>3$]@c]@!zfd=3Mz ?=vz ch?s YLd]@X^@zfdK3z YM3 YQV k-R SzlowS{ st^@L^@mid&{\$2BX^@^@hjh"intXf~t]yos:IGrY}X^@^@>{fd~3?~}j{2~3 I;Y3c]$YZ^@^@kh"intXf~t]yZ(^@^@{uu'|A[]$P[Z^@c@Rkoh"intXI5Sf([6e7w~uZ8t]+(w 'w@*w=,:021y.l%1id2#t3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 6 =!#7"# H , S  SZ 2=[ 3l#Z 4Z#Z 5Z#[ 6Z#~ 7=# HM ~[:^@_@4|tvhi:`|Z_@_@s| buf|+:|i:|n:|fd:tpq[:}cp }Z S e  ZP_@*`@?}outO k}numO}bufQ\uuRLiS:}nS:tP :;[g,`@J`@}outf numh:t|e[:i[ bZ6:[4XZ4[5num5 tv<![[@~!ZA"SD#[7:,@#8$@#[9:H@#Z:; @#[;Z@ l Z1[:$fd:PZ L`@Ac@ ~out num7~uu P%[ lc~&0'%'' '(P)1`*<v~*H~+T#i[ A@#lZ :@[:op:out num~Z$Dc@Yc@~out# [v\c@c@;outu ,  SQ ,I; Y:`$[Zc@c@!mh"intXf~t]y['3c@c@nuu&cp(Ri)3Q AS`$[Zc@c@_mh"intXI5Lf([6^7p~t]ySZ2[3e#Z4S#Z5S#[6S#~7# A  ['c@c@A uu&A ptr&P tmp(e out)PGSZLZa$c\Zd@Xe@mh"intXI5Lf([6^7p~t]oySZ2[3e#Z4S#Z5S#[6S#~7# A  [+3d@Xe@e in*e% uu*p SZ,Xi-3Zcp.ebuf/vikL URb$[ZXe@e@nh"intXI5Lf([6^7p~t]ySZ2[3e#Z4S#Z5S#[6S#~7# A  ['Xe@e@< in&< uu&G ptr(M tmp)e BL  SA0c$a\Ze@if@5ooh"intXI5Sf([6e7w~t]y%SZ2[3l#Z4Z#Z5Z#[6Z#~7# H  (\4e@'f@R uu3Rۀ out3 fmt3]  SZ5`XSc%7\J(f@:f@*uuIRoutID\E9#:H#4<#A=P#! % HO>]4V %| |  SZ ,38lJ: bs  V #cS # # # o # #s #? # #  #$ #(, #, #0 #4 #6Q #8^ #:^ #< #> #@z #D #H #L #P} #R) #TG #X #Z #\ #` #d #ho #xl !# "#B '# (#o )# -# .#X /#M 0# 1# 2# 3# 4#2 5# 6# 7#6 8# 9# :#. ;# <#5 =#z ># ?#i @# A# B# C#" D#C E# F#  | % | % |?  |  |  |]h`sg`fgfij:jj:]j:jklmk  a ^s`ff]: ^}s|`f|fi:]:jm)^?DD]>lhrA:minA:numA:buf@l@tmp@H @ J%9^quidZffD^*gid)Zf)f]dl@x@H sb`ҋff:bufH strJBtmUK%.7Ì@K>VzrtH۸` a  < !Oq@q@ g\!qq@q@- ~"v@-v@#DZ %X |O$]Dx@x@ %sC`&b7fh$P^}\x@Q{@toh"intXf~t]y%8V^jV#b# % }^4:x@ry@ʏ b3r j3C f5#o V]6rnum7:VE]NrEcpMrYUracpTr l^a:ty@z@-str` `->ok`{ cpbrƑbufbr Dbr negc: jdVb rce:)y@y@n:Ehz@z@oV{ Z^%z@Q{@Β j$Vf&# [](:Fbuf'@%xx^@i$`}\T{@{@toh"intXI5Sf7l~t]+(l 'ly.a%1?id2#t3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  ^T{@{@d f ^Z Vj$J+}\{@|@uoh"intXI5Sf7l~t]+(l 'ly.a%1?id2#t3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  ^{@|@M fy sZ VF0k$T[}\|@+}@fvv?w@v֚&0HLB8PWbmtx 6V  @@'X@2@p$t_,_4@[@Qxint~]ohf"_%_,_X_t____ __a_low`#`#  s llv _ _M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww Y_km1km0k__4@[@Ȝn^d^p`A7-LWbmExѝ t`@@B؁@[@kgq```@E@x@`4AAc3AintP`9Adc8A` AcAh`*Ac)A`HAcGAX`MAcLAd`@n@vH`%Ap@~@c$A@@; Ax`/A@ɂ@wec.A%Ђ@@7H@@ϠZ8`>A@>@ c=A'`CA@@o@F cBArp@@@@3``RA@@ cQA @ƒ@Sv 1 Hȃ@@S  `WA@@4 cVA``\A@%@ c[Ap`aA0@E@ʢ c`A;>r``H@H@pyI;7@intnra`P@@yh"intXf7Z~t ayZ]+(Z~aI J#DK#IbLh#k-Mh# Nh#. OM#`OM YM#DZM# [#V\Z# k-]h#a^h#.bs3az3 \a s cO nz i3  pa ptrIb3 b Ib3 ~ Dad s1 s2d nz`kbk.x`xjqoZ a s c3 nz i3`P@U@7`@@AptrmminMmaj-rShS@@`ʄ@Є@m@ @~@ @5X@x@%bh[bh օ@@!a@@HZ"k-ht#sth maj \@@$%m~$٤&`>@@'a=z.`?3N%b@apArSBh'majCminDM`EMk-Fz+`·@ڇ@ZS@@P`و@ۈ@`%@0@p`rSDhѨ`@@L@@rSh&}@F@pD'k-zptrminM`a z0rS.hS@#@0`@@E@m( Hqs.$$`7BMЪX`Ӌ@؋@i`@(@^&a P@@'h"intXI5Lf7e~t]+(e 'ed0Zzo y , ?-# j.#   d/Jdk@f@cjZ&f-jZ,jil3<f;qZZ frZupdep@@mddAjdA1dF4@f@4fdEjE_dGdiHZ0wHZNdd9p@@l^i:Zd6@e4@  sq1@  :d2@0~drd@?@^h"intXf7Z~t]+(Z'~(#k-)o#de*zo  d&1%'# e(O#  "ea@@2 e`O/eb2ic3 dO @@y eNO./eP2iQ3pd,O@?@ 1%+7+Oid-Od52/e<2i=3 e#@e$O@<Keo^,;~v3kf&=eO@Y@ppid|Tf;1KeoQ,;qvOkf߉'eL`@@cJ| fJO:KeKoZ,KzkfMeNz(f3O@)e:*2f.@0ff@!@h"intXf~t]of@ @f @!@|ρ:g0@}@h"intXf7Z~t]+(Z 'Z3pid4O# f5O#Ke6o#,7z# e8 o   '~(#k-)o# d e*y(V?)#v*#qg+1 g0@V@w3G#g͙ V f`@@gw3#ghgC@@?BiD3#gE g@w@3d?_i3#g @@@?#gge@-@#`dOk-dovh jg30@@_?v'0g3_#g`@@1F *g3@ק@tf3Qg#3@@str"'sep$G f.oe?/Dg3@@ Xg\@@!pidZ| fZO"f-Zo",[z #kf]zud#f^ouh#f_oulzg_o$i`3up#ga g6@}@.Up=|Z@u@fAUm @u@>C@?KvL #g-l@ %I;Y3gIi@@wh"intXI5Lf7e~t]+(e 'eyh"3oF(ih&Z i' h(# h 6 i!6# h"<# g#3# p$3# i%<#  6 Lh) H*6# i+<# i.3# g06# si 4 56# g6<# h73#W:iDhgTh.Z %1~ id2# t36# pid4# .5# 7# 8z# >9z# :A# 4] 4i@5?3$@ g)@@rh(h.S@@ $^h-S5g3@@TQh2g8S@@~)h7S@@g< @z@5?;ai=3 i-@@-? h%i 3g Bh3@9@h3srcdst#i 0if3@@X@heipeh`@h@?)i3IXiɸpnt6ifѾJKҒgp6i h@ h@!ipZ@ i@  Z "#gp@@Gh3$srcG$dst6Tk-#iNres6 M% T& ihhp6@?@iporesr6 !bufq@'iT@@@$strSI(X@f@V)*@@X)"+"6+ "65+,|i %Ȭ@,{h %Ь@,h %ج@"B{+,hk@,2h.%@"+,h0`@- i&3@@. 8.I; Y3JiIi@ɯ@_h"intXf~t]yoi'3@ɯ@yB'kjIiЯ@I@h"intXI5Lf7e~t] 'ey j#A jj   3 j j#j#yj3#0jjioi3Я@@sis k3 Nj3 @i@Ois{ k3*j&3p@@i% k%3 j>3@@U^ =3i=k=s'i?3ijos@@^jnsidpZ@j3 @E@ismj3P@u@,isi3@@Xi43j3@ʳ@csig3jcoldr ij fjг@'@R k3~jjXjH30@@ kG3j[bjg@Ĵ@j{д@@< kz3Ijk3@I@w pidjz kj3$G!6j+w@!Aj,@!j-@d"I;Y39kIiP@2@7B!0-B:oh"intXI5hf7~t]+(." '@*=,Oy.v%1uid2# t3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * k k k &k ' ~ (# k- )# d e *xk'8 k(8#fd)O# Ek+O# k,O# dupOP@d@OkfdO@kOp@@{fdOkO8O@ @fdO_kiO :kO@@3fdO_cmdO_kiOg@Ķ@sap%argOж@@ap%argOkPO @޷@kO8_k\9i]OLNk:@+@_ k~80@@7fd}O!_kiOk@<@ fdO5bufU"JKu"?#8#kret  $rk@@@2ZfdO^buf~"JK"?#8#kret2Y@d@[fd~O"?~"2~O#8A9fp@@j fdeOHek-e#g8%o>H@A@fdGO"HG "k-Gd#I8#%Qkk8P@\@%fdO&  ':?O`@@yB<|jO(.klkfdO#%8)af 8FH@`@|f8d*f8+:,-$I:O@2@yB9 9(k0@ (k3O@.68.b78. 88.I; YOkIi@@@xh"intXI5Lf7e~t]+(e 'eyo.Z%1?id2#t3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K k&3@@@ t%$ %3f)qdir-  V dI;Y3LlIi@ۿ@Ooh"intXI5Sf7l~t]+(l 'ly.a%1?id2#t3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % lC:@ۿ@ l@: 'lA) lBay oliE?D?@  ? 8 VO 4?D@ 1:@-l2:L@l0:@k3:H@ƌ;lIi@ @Wh"intXf~t] 'OyoDl1d@@4l'd@ @*e oIi@@h"intXI5Lf7e~t]+(e."s 'eyo.Z%1Jid2#t3J#pid4#.5# 7#8z#>9z#:A#4]4V  xn+3@$@V Ul* *  LlK0@@tJbufJJ %JzlenLN a ]l:3@@ [ Ul9 9I;Y3belIi@d@h"intXf~t]+(O 'Oyll'3@@6xl03@@b/3~U8o@@lA3 @4@  @ 3lJ3@@d@K bufIK lenIdQo I;Y3lIip@Y@h"intXI5Lf7e~t]+(e 'eH(e)e(e)e@*e +e=,3(-eK.e0syl4`9a#.b#c#d# 2e#f#Gg#ui#k# ol#$m#(n#,>o#0o.Z%1p id2#t3p# pid4#.5# 7#8z#>9z#:A#4]4|  l43p@w@ yB3 3  lC3@@> B3 B l3@@jN yB ޾ l3@@ yB  X Z@@ j l3@@ t ̾lR3@@DfQDFlQJdposSs   l3@@3lJfD# ly3@@A yBxmlxJlz3{D%P@@dir C | l3@Y@lyBlJ3fD#@Y@buf}l(@I; Y3 mIi`@w@zh"intXf~t]0]21|y6 =!f#7"q#l"3`@w@A tv! tz!d lIi@@ےh"intXf~t]H(O)Oyl#d@@ml)d@@ m/o@@m5o@@ mIi@@<h"intXf7Z~t]+(Z 'Z'~(#k-)o#d e*o y 'm )  pid*|#m+ #l,3#d imBCCpidA|iC3'mDC Kmnvpidm|io3'mpC}m|@@&pid|Il&3'mC@@#."7I@@Va@j 3m|@@^Xl&ZmT@@pidS|'mVCoutfw@@$@V#(.72m@_@qpid}|+ f}Of-}ox,~z'mC @K#X.7!x#.7"xm9`@@#Am0@ $I;Y3ߒmIi@@Yh"intXf~t]0]ym!m"d#m#d#m*3@@3yB)H)  o  mv I;Y3mIi@@h"intXf~t]oydi*r@@_#)3A+@d ?  mIi@@$h"intXI5Lf7e~uZ8wt]+(e 'e0~y.Zm/A%1Yid2#t3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> ! "S#B## _  DIR&l%"?&"#_'#k-(l#i)#*# +# _2 n-nt@@sdirss?s~ mi@3@dirhsm]~@@V@dir\smC'`@@'dirBs;mD-[mJymP' w 2'n53@ @_dir4s n*s@@?) _[47nIi @@2h"intXf~t]+(OyHn, @>@#On+Olen/di03numB30n.3@ o@n^3@@@?On]-fd_3o len`dP bufa? N NI;Y3V/}f@4@ϖh"2>intXf7e~t]orpc"@@pid!Z #ZP Xn2>@4@Dpid0Z f;0Z/ f0ZOlen1Zo ,1z 33P en:Th ZT Do@@@;h"intXI5Lf7e~t]+(eo 'ey.Z%1?id2#t3?#pid4#.5# 7#8z#>9z#:A#4]4K  Zn[#n\#R^z#?_#  ao`dcnd#Rfz#?g#  anh n3@@@n3>9# :]# 4<# A=p#! : ]O>]4vxr%  O r&   :r'rq#posO#  :rJ=K=#posLO# r?Obuf=jk-=OPr=r>s>9>Oeof>G@OiAOcBOqCO Oq?ptrvk-Orp r?1rErK o  Vr Op@@s(s ret OR q$O@@Gs#s%rgO@@s sfsh  r@@Ss c:s!qO@@7"fmtc"ap%z#Pr}#r#q)#s$retOu%1rOu&lenO%k-Ou&cO %cbjup'v $bufP(Ar)q)@)q@)jr#@*!+9 O ,eofOg -x! ,ptr9 .!:///0@@10j@p@120@@12@@1%-!lpuendu38rOu@3rOuDptrjuH4r5C"-////u/j/_/T*8"6 16E 7uL-p"C,ptrBn ."C///0/@9@ 10@@120]@m@212m@}@1%-"mptrjju3qkOu*",iKO ptrLju8:9:8:;<qpO@@  =fo==fmto=apo%3sqp<qO@@ I=fmt=ap%<qO@*@. =fmt>ap%retOP<q|O0@Q@Z =f{==fmt{>ap}%ret~OP<r-O`@@ @ q,=fmt,=ap,%3s.p<r:O@@  q9=fmt9>ap;%ret<OPq^@@  s] c]: s_ ,f`=)qPO@@<6 sOhsQ fR=,cSO?6=]b(sr @@7B!0-B:oh"intXI5hf7~t]+( 'y.v%1Tid2# t3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`}s  O :ss  O  O  :s   jsv# s#arg#Bs##fp$## ks4O @[@fp3#Q3ap3%Js5 t2s6h s<O`@@fp;#Q;ap=%- >OPOs/O@@%arg.%*b.Jn.O  ]s(O@@arg'%c':csr@a@h"intXf~t]+(O7B!|-Bo}s3 o ss3 o 3 s   js# s# argo# s &W H'W# s(d# )d#s-3@y@arg,c,M s>3@;@H=Q=ap=qJs? `s@T- A3%Wse3@@a@CHdQdapfq- g3Psrp@:@h"intXI5Lf7e~t]+(e 'ey.Z%18id2#t38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K s3 sp@@o]nYo@@q3@@k ds3@@,c3@@cs>u{t8 @@U`8pos3c3o"es3@@c3k@@cs>u{Ws3@\@U nestrYAu3`@@7strY1s/@:@g~t0t1~~k-2z>V>Vs)@@$ @b%$@ &(@I;Y3 mtr@@@h"intXI5Lf7e~t]o+(e 'ey.Z%1?id2#t3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z# f5Z#Ke6#,7# e8a 7id8#z9#wL:#t;Z# "t<?Iid@#zA#wLB#tCZ# ,DI# AX -uEOyidP#uuQcUidV#tW Kd  zt& zres {K#Zu |#%uk Vlt2%k-1t3Ek%@@G@c8P@U@u3`@q@Hk~_3@@tyB^u3@q@_kH?0 3fk- t_u ?out8@ uR3@@kQuM3@@kLHL?k-LFuG3@@kFHF?@ @"srcNzmwLkf-utuf@@,$  A  XSu3@@77kck-u3@@uk typ!t3@@"kE#Z{uhs@@kg tnposfw' UtN3 @@EdkMq?Ms2M3$u@@ku@6@+,WzwwLkf-1@u83@@@p:%str7k7'u%3@@c$3k$&ch&zu{q3@E@c3kIuE!fuP@@ "`"z"wL'"k_#t t\'# f k- ((#)'@# f*Wk-,up@H@*i3+uEtF3@@ kE,cGzt]?@@ u `\?I P\3 k\ ,i^3 ,c^3 !MuK@@  "yBJ'!" JG!-tL?up.msgR +KSE*iW3!#f~!#k!/`#+t_ z 0u @<@"ttl3@@ @;" Ulkg"k" Hm _tnCto,srcq",dstx"/x#P# A 1!dt@@&#M "tR#" r#")%Y&ret#38>*@@w&ret?3w>*@ @&retC3>* @9@&retE3>)%&ret-3>)%&ret3R?,@@&ret)3?*@@ &ret^3?)%: "v:@)(&T "vVG@* @ @r &retS3@`&&retY3@)x& &c{"A&&ret3@A, @* @+retc3P2{ 3 45{6 B3wr0@@h"intXf~t]ow(w'On0@=@A| wK@@M@A wJO n&L w23P@@A rnd33BZA]@@!Bw 3P@ mr@J@Kh"intXI5Lf7e~t]+(e 'e0sytm$".#3#$3#%3#&3# '3#z(3#I)3# *3#+3# o.Z%1 id25#t3# pid4#.55# 7#8z#>9z#:A#4@]4 )  x w &x x 2x y x y x Ux y Bx Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec y y x x Gx w x Sun Mon Tue! Wed" Thu# Fri$ Sat% lx& 7x' x( AM) PM* Lx+ x,w|@[@MBx{yB{ByxB~x3Bx3Cx}&@  x``@@Cx__)ybu|%yo@@JC xn+x@@vC6xx@@Cbyxb htmi@@Cxԋx@@Cx݅xz@@&DstrRD!xzDwDtmbEi. Fc.3Fk-z\FnzFxFxHZxi .3..yxD@J@GtCEGEutbxG G  3& tm"`@y%L@x&L@r,wx3@b,k)srP@ @D7B!0-B:oh"intXf~t]y}sO :ssO O : s  js# s# arg#w<OP@@GcQ;ap;%3s=l sCO@@GQBapD%- EOPPs,O@@Harg+b+KHn+OHlen-O^s%O@ @Harg$c$:Hsr@@7B!0-B:o}sLRggn:int ss{gng : s  jsA# sp# argn# s  H!# " #:~s&g@0@IKarg%Kc%:?y-g0@@.IH,ZIQ,Iap,%IJs.l/y/`- 0gIs<g@@IH;Q;ap=%- >gPĮSyr@@9oh"intXI5Sf7l~t]+(l 'ly.a%1?id2#t3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K \y'@@J dy%0J %[J 5Y%:J Hy&:J  %  8 Vztyr@@h"intXf~t]+(O7B!|-Bo}s3 o ss3 o 3 s   js# s# argo# xy "W H#W# s$d# %d#y)3@T@Jarg(Jc(3K nyC3`@@uK!HBWKk-BdKQBKapBqLJsD dsEX- F37LoyU3@@JLHTWk-TdQTapVq- W3Pyr@@oh"intXI5Sf7l~uZ8~t]+(l 'l0y.am/H%1`id2#t3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %?&#_'#k-(s#i)#*# +# %  n-y$!!Ao#' l -%y*:Pk)!@ @vLnyC@@@LAoB'LkDLd w2@@I@ MDyPP@@8M?AoO'dMdirQ!MV@i@Q)e2o@|@Sy>:@@Mk=!?=2=:y0@@Mk/!M50N df@@h"intXf7Z~t]oz!@@NN e O7 OTkz@+#@h"intXI5Lf7e~t]+(e 'eo 3 pid4Z# f5Z# Ke6z# ,7# e8y {HJE ?KE# _L3#@ zMz#D ?{NU#H U? Ad1z3@a@zNpBres3NkfNz3p@@Ndevk-zLz@ @OSJsؒ/Oh}SOO}zoOpos3Oz3@}@OJsOj`P}3uppos3Pd^z@@*PJs}3VPsupret3h} %zC@7@iPQ?Bzl@@!@P;cmdkP#k3Qpidm/Qzpzuhrzq;6{rul?zzcQ-{zvQeJ&tQzYdirQ&)zzQzh J Y h wzzX!@9"@RW3zYmsgZz1@"@"@;R?0z2msg3 {N#@+#@gRpidM2^{0#@#@jh"intXI5Lf7e~uZ8wt]+(e 'ey.Z%1Cid2#t3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#?Jl#2K3# {Ld Vd U{.0#@#@R k-R ?-lS 2-3 H{/dԴ{#@y%@.h"intXI5Lf7e~uZ8wt]{ -.Z#mac/l#o  y |.Z#@$@BS ip-nS {/l{1ASA){t $@$@S{{sZmacsl |uh Hz{T {Y$@%%@SmacXl Zux{M0%@y%@TipLZ Nu|>|f%@%@ײh"intXf7Z~t]c|%zoN|O%@%@/Tk-O idO[T|z%@%@nT idO #ioT *|%@%@T idOy|f%@%@gh"intXf~t]otdk|3%@%@TnOsn|f&@ &@h"intXf7Z~uZ8lt]o|!a&@ &@Ueax"O1Uedx"ORi|f&@&@h"intXf7Z~t ayZ] }$hc|%o&}'#|(z#|) }! k- O |j O ptr" &@Q&@DU.  h|1`&@~&@pUk-0O|j0O ptr2('2@'p|7&@&@Uk-6Op6O|j6O ptr8|G3&@&@U3|Fk-FOHOUd|U&@&@V|Tk-TO&}f&@&@شh"intXf~t]o;}&@&@3V5} &@&@_Vm}'@*@h"intXI5Lf~t]+(Z:~)3 'Zo }$ *~ O~ U} ) _*# v+z# len,o# }/& num0o# 1&#5 }4z ppb5z# H}6o# }7o# }8o# }QoldP"PoT PonewRA}>b?5}Y'@l'@VYppbzVoW?o$WlenoMW~oWi3Qd}3p'@'@WppbzWoXi3R}3!X~'@:(@4X+ppbz`XoXh}+}3 i3Qarg 3X~b3b`_`valenao }co wd3newe!"""!#$u}3bshm3 k-opi3 93 ?z K_}3@(@*@X9h}9Xb,Yshm3UYp9Y%X'&p'#%1'"a"V"K"B&''lY#w#(y)@)@k"""&'#)'"&(##'Y'Y'Z'&Z#?D~*@*@FZ*Ţh}9rZshm3ZretȇZ+I;Y3~~*@1.@yh"intXf~t]+(O'~(#k-)d#d(D##v$o# e*q ~N*@+@Z s MZd  ~Vd+@1+@[7 s U/[ e~@+@+@q[ s [ w3R! [n3&\ v~o+@+@O\ s {\ w3\~ݿ\~o+@,@\Hs \w30]v of]~&0(~(] ~o,@,@] s ]~vo%^~B-@)-@C^ s Ao^ 00-@-@^' s ^ w3^ vo4_'-@-@~v_ ~h-@.@_n s g_ vgo`om 26.@1.@"`s 7[~+@~,3@~-@wKb@.@.@h"intXf~t]+(O<&zyC%d@.@.@N`s$z`U$`s1*` bit+o tbl,Lidx-3`  o o;]b/@K/@h"intXf~t]+(Og%3/@K/@`s1#as2#Man$daoMobP/@"0@mh"intXf~t]2P/@/@as1a~1:b1~bx3btok3bc43csc43c @ o   `0@"0@.c s_~_a@b00@i0@͸h"intXf~t]+(O)00@i0@Zcs&cc'3cn(ddH(p+R    A$t_,_l0@1@'int~]ohf"_%_,_X_t____ __a_low`#`#  s llv _ _M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww Y_km1km0kSl0@1@duRKdvRdwT`(VA7-x(LWbtPm,exkeee:fnff0@0@f<1@1@ff% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  I&I : ;  : ; I8 : ; I8  : ;   : ;  I!I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II&< ' : ;I : ; !I/.: ; ' : ; I : ; I!.? : ;' ": ;I# $.? : ;' I %4: ;I&: ;I'.: ;' I@(: ;I)4: ;I*: ;I +: ;I,: ;I -4: ;I..: ; ' @/: ; I 0: ; I 14: ;I21X Y3141X Y5.: ;' 64: ; I74: ; I8 : ; 9.: ;' @:4: ;I ;1UX Y< U=41 >41?1UX Y@41A 1B1X Y C : ;D.: ;' I E : ;F G H1I J.? : ;' @K.? : ;' I@L : ;M4: ; I N4: ; I? < O&IP4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II&< ' .? : ;' @: ;I .? : ; ' I@: ; I: ; I4: ; I .? : ; ' @!4: ; I"4: ; I#: ; I $ : ; %4: ; I &4: ; I'4: ; I? < % $ > $ >  : ;  : ; I8  I&I&I .? : ; ' @ : ; I 4: ; I .? : ; ' @ I!I/ $ > 4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' : ;I.? : ;' I .? : ;' @: ;I: ;I : ;I .? : ; ' I@!: ; I": ; I#: ; I $4: ; I%1X Y &1'.: ; ' I@(4: ; I)1X Y *4: ;I+ : ; ,1UX Y - U.41/ U04: ; I 1 2.: ; ' I 3: ; I4: ; I54: ; I6 7: ; I 84: ; I91:41% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.? : ;' .? : ; ' @: ; I: ; I : ; I!4: ; I"1X Y #1$ U%1X Y &: ; I '.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I : ; I .? : ; ' @: ; I4: ; I4: ; I 4: ; I!.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I.? : ;' I : ;I: ;I4: ;I 41 .: ;' I@!: ;I ": ;I #.: ; ' I@$: ; I%: ; I&4: ; I'4: ; I(.: ; ' I ): ; I*: ; I+4: ; I,4: ; I-.? : ;' I@.: ;I/: ;I04: ;I14: ;I 24: ;I34: ;I 4 : ;51X Y6171X Y8 9 U:1UX Y; U<41=.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I .? : ; ' I@: ; I4: ; I 4: ; I!4: ; I" : ; #1X Y $1%1UX Y &1X Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.: ; ' I@: ; I.? : ; ' I@: ; I 4: ; I !4: ; I"4: ; I#1X Y $1%.? : ; ' @&4: ; I '.: ; ' I (: ; I): ; I*4: ; I+ : ;, U-4: ;I.1X Y/ 04111UX Y2 U3414.? : ;' I@5: ;I% $ > $ > : ; I  : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; I&I' II& : ; I8 < ' .? : ;' I : ;I.: ; ' I@: ; I: ; I4: ; I4: ; I U!4: ; I".? : ; ' @#: ; I $.: ; ' I %: ; I&4: ; I' (.? : ;' ): ;I*.? : ; ' I@+4: ; I , U-1UX Y .1/104114121X Y 3.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I.? : ; ' I@ : ; I!: ; I"4: ; I #4: ; I$4: ; I%.? : ;' I@&: ;I'4: ;I (.: ;' I@)4: ;I*: ;I +4: ;I,4: ;I- : ;.1UX Y/10 U1412 3: ;I4 : ;51X Y6 74181X Y9.? : ; ' @:4: ; I;1X Y <41 =1X Y >: ; I ?4: ; I@1UX Y % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I&I.: ; ' @: ; I4: ; I4: ; I4: ; I.: ; ' I : ; I4: ; I : ; !I/.? : ; ' I@4: ; I 1UX Y 11 U!41"41 #41$ 1%4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I4: ;I.? : ; ' @: ; I1X Y 1 !41 "1X Y #41$: ; I%: ; I &.: ; ' ': ; I( ) *.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$.? : ; ' I@%: ; I &: ; I ': ; I(.? : ;' @): ;I*4: ;I+1X Y,1- .41/.? : ; ' 0: ;I112413.? : ;' I@4: ;I 5.? : ; ' @64: ; I71UX Y 8 U91X Y :1X Y ;41 <.? : ;' I@=1X Y% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I .? : ; ' I@4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I  41!.? : ; ' I@": ; I#4: ; I$.? : ; ' @%: ; I&: ; I '4: ; I(.: ; ' I@).? : ;' I@*: ;I +.: ;' I ,4: ;I-: ;I.: ;I /4: ;I0 : ;11UX Y213 U44151UX Y 61X Y 7 81X Y91X Y :1;: ;I<4: ;I =4: ;I>41 ?4: ; I% $ > $ > : ; I  I$ > &I  : ;  : ; I8 ' I I &I!I/ .? : ; ' I@: ; I.? : ; ' I@4: ; I4: ; I4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > &I .: ; ' I : ; I4: ; I4: ; II!I/.? : ;' I@: ;I: ;I 4: ;I4: ;I1UX Y1 U4141 41.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 $ > I !I/  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; !I/.? : ;' I : ;I: ;I4: ;I.? : ;'  .? : ;' I@!: ;I".? : ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I (.: ; ' I@): ; I *4: ; I+1UX Y ,1- U.41/.: ; ' I 0: ; I1: ; I24: ; I3 : ; 4 5.: ;' I 64: ;I7 : ;8 9: ;I:4: ;I;4: ;I <4: ;I =4: ;I> : ;?1UX Y@41A41 B 1C1X YD1X YE1UX YF4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I 41 .? : ;' !.? : ;' I@": ;I#: ;I$.? : ; ' I@%: ; I&: ; I'4: ; I(4: ; I)4: ; I*1X Y +1,: ; I -4: ; I. : ;/1UX Y 0 U11X Y 2 34141UX Y5161X Y71X Y84: ;I9.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I .: ; ' I@ : ; I !4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I ( : ; )1X Y *1+ ,41-1UX Y . U/4101X Y 1.? : ;' I@2: ;I34: ;I4: ;I 5 : ;61UX Y71X Y8191X Y:.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 < &I $ >  : ; : ;I8 I!I/ ' II& : ; I8 .? : ;' I : ;I: ;I4: ;I.? : ; ' I@: ; I .: ;' I@: ;I : ;I4: ;I: ;I4: ;I .: ; ' I !: ; I": ; I#4: ; I$.: ; ' I@%: ; I&4: ; I'4: ; I(4: ; I )1X Y*1+ ,41-1UX Y.1/ U041 14: ;I2 : ; 31UX Y4415 161X Y7.: ;' 8 : ;94: ; I? < :4: ; I?  % $ > $ > : ; I  I : ;  : ; I8 $ > &I ' I I &I!I/  : ; I8  : ; I 8 .? : ;' I : ;I4: ;I: ;I.: ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I4: ;I 4: ;I: ; I : ; .: ;' @!: ;I": ;I #: ;I $ : ; %1X Y&1' (41 )1X Y*41+41,4: ;I-1UX Y. U/4: ; I 04: ; I? < 14: ; I?  % $ > $ > : ; I$ >  : ; : ;I8  : ; : ;I  : ; I !I/  I.? : ; ' I@: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I !1X Y "1#1X Y % $ > $ >  : ; I$ >  I : ;  : ; I8 : ; I8 .? : ;' I  : ;I 4: ;I: ;I 41.? : ; ' I@: ; I4: ; I4: ; I: ; I .? : ; ' @.? : ;' I@: ;I: ;I 4: ;I: ;I : ;I.? : ;' @1X Y1 !4: ; I"1UX Y # U$41%.: ; ' I@&: ; I'4: ; I(1UX Y )1X Y *: ; I +.? : ; ' I@% $ > $ > $ > : ; I I&I.? : ; ' @ : ; I : ; I : ; I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I & &I I !I/ $ > 4: ; I % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I .? : ; ' I@% $ > $ > : ; I$ > .? : ; ' I@: ; I : ; I : ; I 4: ; I? < % $ > $ > : ; I  I : ;  : ; I8  : ;  (  : ;   : ;  : ; I8  : ;I8  : ;I8 ' II' &II!I/ $ > &&I : ;.? : ;' I@: ;I : ;I4: ;I.: ;' I@ : ;I !: ;I"4: ;I#4: ;I$.: ;' @% &4: ;I '4: ;I (.? : ;' @)4: ;I* + : ;, U-!I/..: ;' /: ;I0.: ;' I 1: ;I2 : ;31X Y415 U61X Y7184191UX Y:41 ; : ;< : ;= >1UX Y?41@ 1A4: ; I? < B4: ;I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I : ;  &I.? : ; ' I@4: ; I% $ > $ > : ; I I : ;  : ; I8  : ;I8 : ;I8 .: ; '  : ; I : ; I .? : ;' I@: ;I4: ;I&I.: ; ' I@: ; I4: ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ;I4: ;I : ;.? : ;' @.? : ; ' @1X Y  1!1X Y "1#: ;I$4: ;I%: ; I & : ;' : ; % $ > $ > : ; I : ;  : ; I8  I.? : ; ' @ : ; I 4: ; I 4: ; I 4: ; I 4: ; I.: ; ' I : ; I&I.? : ; ' I@: ; I 4: ; I1UX Y 1: ; I1UX Y  14: ; I?  % $ > $ > : ; I I : ;  : ; I8  : ; I8 .: ; '  : ; I .? : ; ' I@ : ; I &I.? : ; ' @: ; I4: ; I4: ; I .: ; ' I : ; I1X Y 11X Y 11UX Y  .? : ; ' I@4: ; I% $ > $ > : ; I I$ >  : ;  : ; I8 .: ; '  : ; I : ; I .: ;' I@ : ;I: ;I .? : ;' I@4: ;I .? : ; ' I@: ; I4: ; I4: ; I4: ; I U1X Y 11&II!I/ 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;   : ;  I !I/ $ > : ; I.: ; ' @: ; I4: ; I4: ; I.? : ; ' I@: ; I&I: ; I 4: ; I.? : ; ' @: ; I 4: ; I 4: ; I4: ; I !I/ U% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  < I !I/ $ > ' II&I : ;  : ;I8  : ; : ; : ;I8 !I/.: ; ' I@: ; I: ; I4: ; I.: ;' I@: ;I: ;I4: ;I : ;I !: ;I ".? : ;' I@#4: ;I$.: ;' I %: ;I&: ;I'4: ;I(4: ;I )&*4: ;I+1X Y,1-1. /410411.: ; ' @24: ; I 34: ; I44: ;I 54: ; I6 U74: ; I84: ; I 9.: ; ' I :: ; I;: ; I< : ;= : ;>1UX Y?41 @1X YA.: ;' B4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > .: ; ' I@ : ; I4: ; I: ; I4: ; I.: ;' I : ;I: ;I4: ;I.: ; ' I : ; I: ; I4: ; I4: ;I.? : ;' @: ;I4: ;I4: ;I 4: ;I : ; U!1UX Y"1#1$41%41&1UX Y'1X Y (1X Y )I*!I/% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  .: ; ' I  : ; I : ; I4: ; I .? : ; ' I@: ; I4: ; I4: ; I4: ; I  : ;  U1UX Y 1 U41 414: ; I&I4: ; I? < % $ > $ > : ; I : ;  : ; I8 .: ; ' I@: ; I : ; I 4: ; I .? : ; ' I@ 4: ; I 4: ; I4: ; I U &I% $ > $ > : ; I.? : ; ' I@: ; I : ; I: ; I 4: ; I? < % $ > $ > $ > .? : ; ' @: ; I I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > I !I/ .: ; ' I@4: ; I 4: ; I.: ; ' @: ; I: ; I4: ; I4: ; I.? : ;' @: ;I4: ;I 4: ;I: ;I .: ; ' I : ; I.: ;' I : ;I: ;I 4: ;I!4: ;I" : ;#4: ;I $: ; I%4: ;I&1UX Y'1( U)41 *41+ 1,4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I 4: ; I I&I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' I@ : ; I : ; I 4: ; I 4: ; I4: ; I4: ; I  I&II% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ >  I$ > : ; I&I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I.: ; ' I : ; I.? : ;' I@: ;I: ;I4: ;I4: ;I4: ;I1X Y11UX Y: ;I : ;I 4: ; I I!I/ 4: ; I % $ > $ >  I$ >  : ;  : ; I8  : ; I8 &I .? : ; ' I@ : ; I 4: ; I 4: ; I: ; I4: ; I4: ; I I!I/ 4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I I !I/ $ >  : ; : ;I8 .: ; ' : ; I4: ; I4: ; I.: ; ' I : ; I4: ; I &I.? : ; ' @: ; I4: ; I1UX Y 1 U411UX Y1 41!1X Y" #4: ;I$.? : ;' @%: ;I &4: ; I? < % $ > $ >  I$ > : ; I : ;  : ; I8 &I .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I.: ; ' I : ; I: ; I1X Y 11X Y 4: ; I I!I/ 4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' @ : ; I : ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' @ : ; I : ; I% $ > $ >   I: ; I$ >  : ;  : ; I8 I !I/ .? : ; ' I@ : ; I4: ; I.: ; ' : ; I.? : ; ' @: ; I 4: ; I 1X Y 1 414: ; I &II% $ > $ >  I$ > .? : ; ' I@: ; I4: ; I 4: ; I &I : ; I I !I/ 4: ; I % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I4: ;I 1UX Y1 U414141  % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I4: ;I1UX Y11 U4141 41  % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I $ >  : ; (  : ;  : ; I8  I  : ;  : ; I8 .? : ; ' I : ; I4 &I.? : ; ' I@: ; I.1@1.? : ;' I@: ;I4: ;I: ; I 4: ; I: ; I 4: ; I U4: ; I U 4: ; I !4: ; I "I#!I$: ; I%&&&I'.? : ; ' @(1X Y )1*1X Y +!I/ ,4: ;I -4: ; I?  .4: ; I? < % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I$ > .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I &I: ; I: ; I 4: ; I4: ; I4: ; I? < % $ > $ > : ; I.? : ; ' I@.? : ; ' I@: ; I  I : ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ >  : ; I : ;  : ; I8 .? : ; ' I@ : ; I  I% $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ > : ; I : ;  : ; I8 .? : ; ' I@: ; I  I &I &I 4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I 4: ; I 4: ; I I !I$ > 4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I '  : ; : ;I8  : ;I8 &I.: ; ' I : ; I: ; I4: ; I4: ; I.: ; '   .: ;' I@: ;I4: ;I4: ;I : ;I .: ;' @ : ;I!.: ; ' I@": ; I#: ; I$4: ; I %4: ; I &4: ; I'4: ; I( : ;) : ;* U+4: ;I,4: ;I- U.1UX Y/10 1412 34: ;I 44: ;I51UX Y641741 8I9!I/ :$ > ;!I<.? : ;' I@=: ;I >?4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > $ > .? : ; ' : ; I.1@1 .? : ; ' @ : ; I 1UX Y 1 .? : ; ' I@4: ; I.? : ; ' I@4: ; I % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I@ : ; I 4: ; I 4: ; II!I/ .? : ; ' @: ; I : ; I .? : ; ' I@% $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3,  ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/ettune2fs.cbitops.hext2fs.hkernel-list.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.htime.hext2_types.hext2_fs.hcom_err.hext2_io.hjfs_compat.hkernel-jbd.hgetopt.hext2_err.herrno.ht@\wY@x.6DyuK|xyg?!XhJZ}zxJzX ztJxX vz<=.>w~/~Sz.wKz<~=xfuX=/ufw~tgt=w tvYMB!x6~b~<!zد&gxf#(gtJjfdֻ+zy ughgx?. <1zxtfug"!x1.H<XrgJ~X}uZw=‘ "Y.x0Kuf&^#MׯJv/ϟ}<J ܟu<Jz;"K}==K=vK}!ȑ ȟ/ f۟!|<J=w<wt Ȼ>hg gg|K/ie.<yf`t!~tKuLm]/|<JyX<L |J0jwpw䟟c~Yf0kn䟟w g~7Jl \/w/t g>Y~ w}J}<J}<J}<J}<JR}<J7g}<!}<}<JxX}<J!"4 <|<h>{iּY}<Jx(uu1rwwu<x f f}uw~xuw<vKxYgtKx[/w=>0v><i}w? Q /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/ext2fsutil.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hcom_err.hext2_types.hext2_fs.hext2fs.hext2_io.herrno.hutil.h-@g+\<yK//kY<z>v%ȕv!ng=vK=Pl/x=^<$ tQ fL>T䢟z t Jmf!=r<x"t>=u=I  f!PX潜WM=O! ext2_err.cP2@! sX1zug/xXogo ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h2@g*uVXZlK= <yf<~x!t zn~"cit .}7}kfKg>~x!=sJ Zj|h x Xtxh f!wpzxXZȕcKNUI}~v!=X~vvl\d ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc_stats.cext2fs.hbitops.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h8@g*uX u}uNY>x fvJw}tg/? v J~Y fvJ  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etbitmaps.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.hH:@g[jJg[Og[jJg[sJgMtXgMuXg0vz>wgxq.hxg. vXvk(^t w.w?"kJ>z>y>z>! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etblock.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hh<@-|XOY<֠C<Cu6<u\h t==tK0u>et. =w= fh!OY>C>Au8<"u\h t=K0u>ct.J?= ffJ~zx tggggw!yg Ȣȉ#~zz~g><ί` /uuu>gZp gvhX)/~XUJY qȏggZK~JC>u֭ux.<~"~u tKgp'<ZxMgsK"u>zigh ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etcheck_desc.cext2fs.hbitops.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hI@ @=E/ws   ug }~uJ~~uA~ ~{uL .v! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etclosefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.hK@MZ4zX^[=]E7X vf 5> huuuYuap#u=hwuuiJ~hnY  hiZ0u+Xu gl~ "w7It-qliXJftww._!XyJ5 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etextent.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hext3_extents.hcom_err.hext2_io.hext2fsP.he2image.hT@kv) <iʑu2gguqy]u "uxtw=XYhifYg f[t%t]t|t  ~g ~v'J0gvAg=t @uv~,w//uM=tx=t׫?zuv=wLׯMȣaX 0h t~u!#"!  gutg tl)x!uv).~<8!=&@u!6Xp<g~+twAg它w guwȟuYuwuw֢\xȻxf=hwjYgigw#=-MfYvxfuu^uhxtu g /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysfinddev.cstdint.hstddef.htypes.htypes.hio_struct.hstat.hdirent.herrno.hn@=ygcّvxYzAFxu00=g36׻zgot.Dfjt ( /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etfreefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.hq@ yftguwufwUdbtguwtwi>#_KK tguv tguv tguv tguvuuuvu fYuwtguwtw fwA ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etgen_bitmap.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hTt@9=E.C>=>0u=ghgXvuwuQvuYxJf=uug= 3$g=uftg=\=u~Jh <0v.urLJg0|<?wftuw f.w.uutvw<JwXfYc{J!uظ- X˭%L,1!Ԡ !qlo&@1=$&mJhilm"Dt[uguguh+`M$yXmfg0~< "gOky1st=oXmfp=Yz>Yxo=n5uKhaYKu0  J׼iJ2̑{fik~"w-uvhptwXye (-t~h|fxKki~wguguv x$guKK,ՇuLxw.Kxw<zgKufzt't|t֒zt ftz~j2(</&!tbtyJ Z%1ȫYV*Xi=. ,tyb  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etopenfs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.he2image.h@hKz.^9hF\:hy._}<Zo" u  qJ* wiuf=w<岼=vˑ>K>lޱ+u <% tugG<w?Jw#><wJx0hu=gU</ufȑw7)<xgxtb>xXyXihhiv>r< gtXtYQivhr< gtXdxtxtxJ+gImfguzfgu  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include../../lib/ext2fs../../lib/etundo_io.cext2fs.htdb.hstddef.hext2_types.hext2_fs.hcom_err.hext2_io.herrno.h@@@X=X= vuuhhvF=pu#9I2xJj=*u;2x.`@= b!w!Xattw|. J>ݓ9gxZw</&.x1K+ Ruvuugvgl<) ]X <@?<u.Nבλgo _MqnXex= yLuMqv.}gJ# pJl}&ZɣZ%X/guytguw"yfy.y<J=y<=uuuvh{Q: tvwuy<yXyY  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/et../../lib/ext2fsunix_io.cext2fs.hstddef.htypes.htypes.hstat.hcom_err.hext2_io.herrno.h@k=*ux.`.>rkvtu0q Xx Ȝ Mpu <JiKLiZttj=*2S X|<gggzg'b \svf gw<!Y=mfsgK{Xu%R!inFJQ4U=v<fzz"u/M$VLr"gKX=!w/g}vtXoKt=t$p t|uuvKfYuyyf f^tuuvJs?y. v X=tZ=uNpxt .pa=pl|"tguztguz~ zfzz<J=z<=uuuvg#g@6t XXzv[KtkzX@Y{P ../../lib/ext2fsvalid_blk.cext2_types.hext2_fs.h(@k4r tYxti=Wy>w /u<>]:[?(Axtg=uvuf XtxXx?~&\>4KU`>p^fgwttt Ww > wguf  vD/vwX<_Ou[~nxX`t {[xuLthu+YL夔f t={ yfK~Ȼ $f~vu~>$i8~fɠJ=&0x'*f&Luh$~XZY1 $'~guk.'vu& .@0 /=r Yugfj u. Jv<<x/r@Mvw(<u!G#>"u2a=e< < f!bք<{=0<t  "5h2'u<Y$  f !uEf5CuivJ<{YeX_'yfK"yfJ"u Kx Zvju".֟y?,ufcf#@ ޮ = uKZP\f"<<y r=?=Mh~f-Bv>iot> <=gn (_$fN^> %kv@  y=/>Б <wx>Ⱥm}tz] Juf<@g=gu8/Ktt@w<xt tX  X*k=jft% th"g=gwZlz$ʻ <i Xf<#.DuAtmf$Zgl tJlX f ]֓w !O#s hOw.gY[hv|\ttJgn.P>S,<N2XqunfpttY~f8u.P/.j=gl"eAm3!!tbef$fb]_?nfuXch.YpY<>.uyX#%<;Z'e!iɟewv۳z@u<fs rX y .$ȭl?/g"r .~fyv+Kguggg̑.#iBY.~uY~gg>(Z  f!~+Y Au0Q~/fD fqEOfz .lX~Au~f  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeerror_message.cstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.herror_table.herrno.h @D[BXxdtu!gtWt/gOu2]ftgYK{6p.J%ktMpt"mtUwguhYpXltXzt'.X=~th0 f "=`-wK!t Jy K- et_name.ccom_err.h%@ tKY]> /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.hX%@1=g.gZKk90=YG.uKhNK1=sxXu&~=  Jw[uuNrtJ$/] 1gFEDO&Kz0Nt J1  ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/systag.clist.htypes.hblkid.hblkidP.h\(@ggQYxXNYY~M .sM"RJM6uM1* P[w.w*J'tyT{'?4gxf f=oJ{ycXfg,h}X7JsX= .sf=_.uu=Iug=itJYf?vYgΑwYv=> X~i#Yyf5fJ\wYlك] uKXsY g<c<=Y=.׼tc=g=t&sdOv<c<=Y=turq ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syscache.clist.htypes.htypes.hstat.hblkid.hblkidP.h/@M\[xtMYB򄼄nXt3 3xw3 0[Y.guF@tz g//}#Y!ׁ2u@i3i=Y=h ."iz$KL=hu歠בh-z0>zxo -s|!Y!=!=!=gAr )qiEgk.iEg8.tYeJkl<tffYjJf7 hnJ gguu tuuK?S |<t|[u|<tw>K?S?"\{{<{< ufA{XNMvX X]"{tf[ /|) >Y24?{<t{tf~֭/Yx.<~Z!pX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidread.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.h|U@wY!_u fk<[vVYC{>-[1'H}?h(ױ>Tf-fO= Y=1tKuhKKS<K+ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidsave.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hblkid.hblkidP.hlist.herrno.hPZ@9 P#Nt6.vt1خ,X|Ku僭 u0X</ɭuzH f(^. /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/blkidgetsize.ctypes.htypes.hblkid_types.hblkid.hstat.h$]@=wa3l .D .v$pJ ../../lib/blkid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cblkid_types.hblkid.herrno.hX^@vAyX5 clear.c^@'uu /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysgen_uuid.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.htime.huuid.huuidP.herrno.h^@ !W??K/xJKucJ/W ftx< v .gwJ~+'hlYhK!,<KK~Xv~ɻg/Juf<'f*X?9v=;: isnull.cc@&<]s+1k /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includepack.cstdint.huuidP.hc@&/====>ZK>hK>hK>hl /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeparse.cstdint.huuidP.hd@*Yb1$==>Lgguu=g(Mm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.hXe@&=uuun /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.he@3B gzJgzg8A ../../lib/ext2fsfeature.cext2_types.hlf@u dtMYgt 億p ֱu dtMYgt 億p ֗uuPJ/m+.Lurt6 +RK J_#R_37]f.;X.u tuuRt;g=~.oXoX JfoXoX JS  hashstr.c|k@/.utR[xt^Ȣs /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fsls.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hext2_types.hext2_fs.hdl@*M/iuYx<~cen!g<KZKan//KYYYYY[=YY/M@uu~fv>~~< $ q~)u>KLL/LL=3z<AMtv""zfcv"uM/rgq%=%ccyt)\KMJAWwtC' ../../lib/ext2fsuuid.cext2_types.h|@fkx+1Xk=uuuAwdZG ostype.c,}@,]dux A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h}@M#~K/giLNXtgfuw~K= Q<0ML A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hP@"gi~fhg[Lt=u. J==u=  g~uu9<ׄZ> K/r.MA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h4@}Y/g?LNf~= uZ!LM  ctype.c`@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.hP@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDZ: ../../includestrncpy.cstddef.hp@)Xg[ye_< rindex.cЎ@*xG=v,02K ../../includestrcasecmp.cstddef.hbsdtypes.h@3=L=]d$Z3zi=e"[91eu;K8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V 9 strcat.c@"?; index.c@*8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h0@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf  ../../../include/arch/i386../../../include../../include/sys../../include/netinet../../includenet.cstdint.hstddef.htypes.hsocket.hin.hnetdb.hio_struct.hstdio.herrno.h@(<>ʯʯA7yy5ZV>1b v< .SA7k~Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.hP@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~ ../../../include/arch/i386../../../include../../includelink.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@*$T0i9i-/3;/[x.jgzP ../../../includemisc.cstddef.htypes.herrno.h@&"V0",0#U/#U/gp ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.hp@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]D ../../include/systime.ctypes.htime.h`@!<=gw]9 ../../../includeuser.ctypes.h@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h@i+G ../../../includemktemp.cstddef.herrno.h @+?82Y t2,I,Ii.i. >绾;/w X hC ../../../include/arch/i386rpc.cstdint.h@!X@Kxx< [T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ 3 sleep.c@=xM ../../includelost_path.ccollections.hstddef.h@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c0@=gP ../../../include/arch/i386add_intr_handler.cstdint.hP@ = ../../../include../../../include/arch/i386../../includescanf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hp@$Tj=jr~JD<X~o~t~fJ~t }Y .%S\=;u=YtgfA\fA\&zX\>:v>YzfA\iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h0@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io ../../../include/arch/i386../../../include../../include/sys../../includetime.cstdint.hstddef.htypes.htypes.htime.hio_struct.hstdio.h@Bz< \T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.hP@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.h@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'\ ../../include/arch/i386../includenetwork.cstdint.hnetwork.h#@-==t{o>i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h%@?Dx ?Dx =3 puts.c%@>(eN ../../../include/arch/i386get_tick_count.cstdint.h&@ >{ ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h&@ ic?9 fi='=% wait_for_rpc.c&@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h'@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.h*@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@.@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h/@$>9LV2z \ strtok.cP/@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h00@(JgKwp@A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hl0@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@+AB 4@AB A4@(AB T.4@JAB EL.440@VAB IN. .. r.. Y.$4 @AB E`.v. ^.,4 @\AB IM..W.t. V. 4@AB Fi.4@D  F AB Dh.. n..n.n.T..K.R.Y.d.n.J..y.f..j.[.j.E.i.. e.E.V..G.E.`.E.g.E.V...\.| $-@3AB f. $-@AB FP. $|.@AB FP.$<0@AB DH.$1@AB L. $1@AB DH.b.V.$,2@#AB DF.| P2@cAB Dl.2@AB H.| l2@1AB  l3@AB Fw.$l3@;AB FD. Y.$l5@AB Fd.t. l5@AB FT.(l6@AB F.o.M.| \8@1AB  \8@AB Fe.\9@AB N. \9@AB Fe.| H:@AB T. h:@AB T. :@AB T. :@AB T. :@AB S.:@AB S.;@AB Q.$;@AB Q.@;@ AB A.L;@ AB A.X;@ AB V. x;@ AB V. ;@VAB DB. ;@FAB y. 8<@ AB A.D<@ AB A.P<@ AB A.\<@ AB A.| h<@AB AS.0<@OAB F. S.m. B.. (>@XAB F. V.. H,A@MAB Ir.$. @.z. 6.. g.. g.. |I@2AB h. |  I@AB Ft.| 0K@@AB E0K@QAB  0L@AB F@.0M@&AB $0M@AB F.C.0Q@^AB Df.|  pQ@AB Fn. R@.AB D PR@oAB F. S@AAB D|  T@?AB  DT@AB F U@lAB Ba. xU@AB B, AB A(}@"AB L}@+AB x}@AB F}@ AB (~@AB Fs.i.X.Ā@AB Q.(@AB FQ..g.$@AB I|.~. ԅ@vAB Fa.L@AB Q.(h@AB F$.H.@AB Q.@AB Ea. 0@AB Ie.̋@^AB D_. ,@mAB Fb.|  @IAB Cn.$@AB Fr.^.$@AB Fr.^.  @ AB FJ.|  ,@@AB IG.l@AB M.| @vAB  @AB Fd.(@eAB Fn.. K. |@}AB FX.(@AB IV.. . @AB IJ.| @2AB ܞ@,AB @/AB  8@AB FR. П@AB FW.@!AB W. |  @AB H. a.@JAB n.|  Ԧ@AB FG. @LAB  ԩ@AB  @AB  @AB FU. @/AB  @AB  ,@AB | @@AB P@AB `@gAB Bt. Ȱ@]AB BG.(@?AB n. h@AB FF.4d@AB I.O.J.|. o.g. X.(@AB F.x.G. ,@rAB F`.@"AB F.(ķ@AB I.o. t.(D@AB FP.. K.| @<AB (@AB F(ȼ@ AB Fn.w. D. Խ@yAB FI.P@/AB  @eAB FR.,@@AB F{.s.\.U.^.(@AB S. (H@AB Fe.S. q.0d@AB Fc.t.h.._.d@AB S. @AB Fy.  @AB BH.@dAB Et. @eAB Fn.`@qAB F(@AB FX.N.O.,@~AB FP..o.G.I.| d(@[AB | $@AB FV. f.| p@zAB B@AB F.@ AB A.@TAB BZ.d@ AB A.p@NAB A@ AB A.@ AB @[AB E4@ AB A.@@!AB Y.d@ AB A.p@VAB DP.@ AB A. @ AB F.@ AB A. @AB FJ.@7AB BS.@ AB A.@AB H. @AB H.| L0@?AB [. W.| p@4AB B| @AB F0@AB F@FAB C| (@GAB y.| XL@ AB XX@+AB X@AB Dg. X @qAB Dp. c.X@IAB Di. X@+AB `. X@RAB D@. XL@IAB CX@AB X@AB X@&AB BX. X@AB F$X|@TAB Fc.T.J.$X@AB F[. k.b. $XX@YAB Fs.T.X@AAB BX@ AB X@AB X @AB X(@>AB A(Xh@AB F[. i.v. C. X@@nAB FH.X@$AB DX@DAB E X@UAB D_. P.R. Xp@ AB X|@ AB X@AB X@"AB X@ AB X@ AB X@AB X@AB X@AB FX@AB X@AB X@AB X@AB  X@AB Bj. k.X@AB X@AB X@AB $X@AB Fs. y.X@AB X@AB X@AB X@AB X@AB $X(@AB E^.X.W. 8X@AB FF.W. m.o. J.U.R. ].(X@AB F.l. . X@@'AB DG.O. Xh@*AB DG.R. X@*AB DG.R. X@AB BQ..,X@AB Ef.B.f.N. W.X@NAB Bh.$X@AB I}.d. ,X@AB Fq.r.G. .$X8@AB FJ.m. (X@AB FV.z._.D. $X@-AB FR..<X@AB FM. o.l. w.q.K.M..h. k.pX@|AB FM.v.R.l. v..d. f..f. S.r. Z.e. t.S. S..m. S.}.Z.P. _.S. X@ AB V. ,X@AB FS._. n.Q. [.(XH@AB F|. I.Q. X@AB F.(X@+AB F.\. F.8X@AB B\..]. _.t. V.a. J.U.X@"AB N.(X@AB FN. h.. Xl@AB Q.X@*AB DG.$X@VAB FI.t. $X @tAB Fj.f. X@;AB DM.X.X@)AB DG. X@AB EG.f.$Xp@AB FJ.N.<X@AB F.U.V. `.u. \.h.d. W.(X@$AB FQ. V.Z. ^.X@AB F0Xh@AB F.].g.a.n.f.X@)AB DG.(X0@AB Fn.p.o. X@AB F.0X@AB F. R.P.W.G.P.$X@aAB Fz.L.(X@AB Fj.\.].J.hX| @AB Ft.U.n...K.T.W.X.x..Z..a.D.~..O.a.`.`.a.4XX@BAB FS.Y.\.a. ].I.o.[.X@8AB Dg. ,X@ AB F]. ^.t.Q.W. X@'AB DG.O. X@*AB DG.R. X4@*AB DG.R.X`@"AB B8X@AB Fn.a..y.w.i.U.^.Q.4X\@_AB FH.~. A.y.Q.].Q.,X@CAB Ff.l. d.0X.]. X@EAB Bf.U.XH@rAB FY.C.`. S.. P.a.r. N.r.|. `.K.j. L.G.C.|. I.X.R.G.x.V.S.V.S.}.P.T.R.W.s.| - @AB - @AB (- @AB DY.\.j.W.X. -!@AB BV. -"@AB DB.N.u.-8#@AB J. -L#@AB F.| .%@9AB A| .X%@ AB G..d%@$AB .%@AB (.%@AB F].].O..P&@8AB ].|  /&@5AB Ft./'@AB EX.| /\(@PAB B /(@OAB Fp. /(@MAB Fp./L)@ZAB _.,/)@eAB Fm.X.@.{.e./+@ AB X. /0+@]AB Dg.b./+@0AB DE. /+@AB FZ./l,@2AB G.,/,@fAB Fg..U.u..|  t1/@\AB Fg.(t1d/@AB BJ.e.\.p.X.$t1 0@AB FO..| 20@ AB 20@ AB X. 20@\AB FA.281@=AB DE. 2x1@AB FE. 2x2@[AB B_.k.22@2AB G.| 23@AB 23@AB  2 3@&AB DE.P.(2H3@AB Fx.).Z.|  35@@AB FS. 3H5@hAB FU.35@AB H. 35@LAB FF.(36@XAB IC..T.$3h7@AB FS.}.| t48@)AB t4D8@AB t4L8@`AB Ct48@AB t48@HAB Be. t48@6AB F.t44:@#AB W.t4X:@2AB D_.t4:@3AB DO.t4:@0AB ].t4:@0AB ].t4 ;@5AB DO. t4X;@ZAB FH. t4;@:AB BW.P. t4;@AB BW.S.t4p<@@AB Bg. t4<@AB DI.f. t44=@@AB BZ.M.(t4t=@AB FZ.M.G.q.t4$>@*AB t4P>@:AB t4>@CAB $t4>@AB HS..^. t4?@AB Fe.$t4@@AB Fk.. (t4A@AB FJ..b. t4B@AB F_. t4`C@(AB If.4t4F@dAB FI.. U..H.U. t4I@AB F. t4J@fAB FM.t4K@`AB E.o.t4XL@`AB E.o.t4L@aAB Dt4M@PAB D$t4lM@AB IP.q.t4 Q@AB DA.t4Q@AB DA. t4 R@nAB Ik.| 9|U@LAB Bn.9U@5AB D[.9V@OAB Bu.<9PV@AB IR..E.U.C.L.T.a.b.|  P:PZ@AB Fx.| :$]@?AB DG.$:d]@AB FH.Y.| :X^@GAB y.| ;^@AB A| (D;^@dAB EF.E.\.a.$D;_@AB Fs.^. D;_@AB Fx.D;,`@AB Q.4D;L`@AB F}.!. N..h..X.D;Dc@AB H.D;\c@+AB DR.| `<c@ AB | <c@VAB |  <d@XAB Fa.| <Xe@nAB A|  =e@_AB EI..@ =(f@AB  =|k@AB Ec.t> l@WAB D|.| 8>dl@N AB F@.. R.]. R.h. R.>x@AB L.| 4?x@AB Ec. 4?ty@rAB FP.4?z@iAB DJ.| ?T{@lAB c.| ?{@XAB BV.| @|@!AB @<|@AB D.@ @|@;AB DD.^.| @,}@LAB Bd.@x}@QAB B_.| @}@AB E| AP@AB E| AB A| LEP@-AB A| |E@JAB FI| EВ@AD | E@AB F| F@AB F| DF`@9AB DF@AG FDF0@hAB BDF@AB DF@ AB DF@AB FDF@ AB DF@ AB DF @oAB FDF@#AB DF@!AB |  G@vAB FIFGp@AB  G@AB AFFGp@>AB |  H@dAB F H @oAB F H@AB E| H@:AB DHП@1AB H@1AB HP@0AB H@AB H@IAB FH@AB AH@AB ONH@YAB XH@YAB X H`@AB IFF| I@ AB I@AB | J0@&AB J`@'AB J@AB FJ@gAB AGJ@AB J@AB MFJ0@_AB LJ@GAB FFJ@AB LJ@AB J@AB FJ@AB F| K@&AB K@ AB K@&AB K@ AB K@AD K @ZAB FK@qAB FK@9AB K@@AB K`@AB F Kp@AB IFFK@?AB DK@@vAB | L@ AB | (MЯ@IAB D(M @IAB D(Mp@IAB D(M@AB E(M@_AB D(M @%AB (MP@%AB (M@aAB  (M@AB MFF(Mг@WAB D(M0@qAB D(M@AB (Mд@"AB (M@IAG | NP@AG Np@AG N@yAB CN@ AB CN @AB FN@KAB N0@RAB AFN@AB ON@@AB ON@tAB LFNp@IAB N@AB LNP@ AB N`@AB EN@"AB | |P@@]AB D| P@;AB D| P@AB P@ AB |  Q@AG  Q0@qAB L Q@"AB | Q@ AG Q@AD Q@AG Q @AG Q@@$AB | Rp@AD R@AD R@ AG R@ AG R@ AG R@AB  R@AB FHER@EAB DR@AB FI R@AB IFF| 8S`@AB | dS@AD dS@AD dS@AD dS@AD | S@AB CS@#AB S@AB ES@AB FS`@&AB | |T@AG | T@0AB | T@"AB T@#AB T@@AB T`@AB IHT@AB T@ AB | U @AB FU@@AB F| U@AD U@DAB E|  V@@dAB F V@+AB JI| tV@ AB | V@7AB CV0@AB FV@AB FV@AB F| 4W@ AB 4W@AB 4W@!AB D4W@ AB 4W @ AB | W0@AB | WP@AB | Xp@'AG DX@ AB X@ AB X@+AB AX@AB FX@;AG X@#AB X@AB X0@!AB X`@;AG X@!AB X@AB X@#AB D| |Y @;AB |Y`@!AB |Y@JAB IF|Y@"AB | Y@iAB FFY@AB FIY@@!AB | dZp@$AB dZ@AB dZ@ AB dZ@NAB DdZ @AB BFdZ@NAB DdZ@\AB DdZ`@kAB DdZ@jAB H| p[@@AD p[P@AB p[`@AB p[@ AB p[@AB Dp[@+AB p[@-AB p[@.AB p[@AB FKp[@xAB Dp[@aAB Dp[@AB FFp[@AB Dp[ @zAB Dp[@#AB  p[@fAB IFFp[@@RAB FFp[@EAB Dp[@UAB FFp[P@UAB Fp[@RAB Dp[@AB IIp[@6AB Cp[ @AB p[@@AB Ip[@AB F| d^@bAB Ed^p@AB d^@GAB d^@HAB B|  ^0@dAB FLG^@AB F^`@'AB ^@AB F^0@EAB A^@0AB F^@uAB C| _0@ AB _@@ AB _P@RAB I_@ AB | P`@AB FP``@'AB P`@AB P`@AB P`@ AG P`@ AG P`@AD P`@AB AGP`@AB E| TaP@6AB Ta@AB Ta@@AB FFTa@AB | a@ AB Da0@OAB Ga@!AB | 4b@?AB |  `b@dAB FGG`b`@[AB H`b@(AB | b@AB b@0AB b@@ AB bP@0AB b@ AB b@`AB FF| |c@AB | c@QAB Acp@*AB c@mAB Fc@mAB BCc@rAB FIc@7AB Dc@@DAB Fc!@AB Dc@"@AB PFc#@+AB | d0#@fAB D| e#@rAB Ee $@AB De$@uAB De0%@IAB | e%@AB e%@AB e%@AB | e%@AB | f&@ AB | Hf&@AAB LFHf`&@AB Hf&@AB Hf&@AB Hf&@AB | f&@ AB f&@ AB |  g'@lAB C gp'@VAB C g'@jAB F g@(@`AB F g*@HAB L| g*@AG g+@!AB g@+@yAB HFg+@AB  g+@AB FFFg,@lAB FFg-@)AB Dg0-@AB MFg-@OAB Dg.@!AB | i@.@AD F| 8i/@KAB DD| liP/@AB BDli0@"AB | i00@9AB A| il0@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdouts_mmp_intervalext2_inode_scanh_i_fsizes_journal_inumi_gidi_mtimes_startnew_labelext2fs_struct_generic_bitmapi_file_aclhurd1hurd2__s32bytes_writtentm_ydayi_sizeext2fs_fast_test_block_bitmaps_jnl_blocksdo_findfslinux1linux2get_move_bitmapremove_journal_inodestruct_ext2_filsysbg_inode_bitmaps_mmp_blocks_free_blocks_countext2_ino_tundo_io_managerremove_journal_deviceext2_group_descs_mnt_counts_algorithm_usage_bitmapprocess_blockfree_blk_move_listl_i_reserved2type_erri_links_countno_valid_journaljournal_superblock_ss_dynsuperstruct_io_channell_i_gid_highext2_image_hdrtm_mdayretry_opens_lastcheckprogram_namebg_flagsi_dir_aclprevupdate_mntoptsref_offset__list_dels_sequencehash_algh_i_fragimage_ios_flagM_flagreserved_ratios_checkintervalparse_extended_optss_prealloc_dir_blockss_maxlenext2fs_group_of_blktm_monext2fs_mark_bb_dirtys_feature_incompatstride_setbg_checksumh_i_gid_highGNU C 4.2.2s_errnomove_blocks_reserved_padrefcountext2fs_block_bitmaps_free_inodes_countL_flagl_i_blocks_hinew_ino_blks_per_grptmp_nametdb_fileext2_dblists_min_extra_isizepriv_datanum_fieldss_rev_levels_headernew_UUIDf_flags_blocks_count_hiext2fs_test_block_bitmaps_prealloc_blocksnew_blktune2fs_setup_tdbunix_io_managerio_ptr/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/misc__u16i_faddrfeatures_cmdh_i_mode_highh_sequences_first_data_blocks_usersu_flagblk64_terrcode_tbg_inode_tablei_generationget_alloc_blockfragsizeh_i_uid_highcommit_remove_journalpasswdadd_journals_raid_striderelease_blocks_proctransalate_blocks_def_resuidend_blks_frags_per_groupblock_bufs_wtimeexpand_inode_tablenew_ino_sizes_first_inos_want_extra_isizee2_blkcnt_tnew_inode_sizeT_flagold_itable_sizetm_yeartune2fs.cs_creator_ostmp_new_itablebytes_readr_usages_log_groups_per_flex__u32block_mapplease_fscktime_tnew_locopen_flagstderrl_i_file_acl_highc_flagi_flagretvalref_blockjournal_header_sjournal_header_timage_headergroup_freewrite_errori_modeoptindr_flagbg_itable_unused__s16old_featuress_paddingbg_free_blocks_countext2fs_fast_test_inode_bitmapjournal_pathi_dtimes_nr_userss_max_transactionreserved_blocksi_uidbadblocksext2_struct_inode_scanextended_cmdext2fs_inode_bitmapdev_nameext2fs_get_memstruct_io_managerh_blocktypeupdate_feature_seti_atimejournal_flagss_feature_ro_compatext2_super_blockstripe_width_sets_hash_seedblockcnts_free_blocks_his_log_frag_sizeoptargs_inodes_countclear_ok_featuresi_blocks__u64last_check_timeprint_labelparse_timeio_ptr_origresize_inodeblock_nri_flagsext2_badblocks_lists_jnl_backup_types_first_meta_bgstart_blkbg_free_inodes_counts_firstblocknrs_max_trans_datas_last_orphanerr_outdgrp_tI_flagext2_inode_cacheext2_inodestruct_io_statss_inodes_per_groupblk_moveneeded_blocksio_optionsold_ino_sizenew_last_mounteds_mkfs_timeapp_datatmp_old_itablemount_flagss_minor_rev_levels_default_mount_optss_inode_sizenew_sizejournal_blockss_last_mountedgroup_desc_count__u8h_i_authorl_i_uid_highext2fs_unmark_block_bitmapext2fs_mark_block_bitmaps_max_mnt_counts_r_blocks_count_his_blocks_per_grouptm_minn_msgss_reserved_char_padext2_struct_u32_listosd1ext2fs_calculate_summary_statss_volume_names_def_resgidinode_maps_desc_sizes_def_hash_versionl_i_versiontotal_free__s64bg_used_dirs_countinode_blocks_per_groupmntopts_cmdlist_headmask_errjournal_superblock_tmax_mount_count__list_addtm_wdayblk_tnew_itable_sizei_ctimes_reserved_gdt_blockss_block_group_nrtm_hourosd2s_journal_uuidold_locbg_block_bitmaptm_secinode_scan_and_fixparse_e2label_optionsmaing_flagbg_reservedtm_isdsts_r_blocks_counts_mtimeparse_tune2fs_optionsC_flagU_flagl_flaget_ext2_error_tables_log_block_sizeorig_supers_raid_stripe_widthext2fs_mark_super_dirtytdb_dirext2fs_div_ceilext2_struct_dblists_feature_compath_i_translatorext2fs_free_memj_blocksst_blksizefigure_journal_sizest_blocksproceed_questioncheck_mountargv_zerost_mtimeget_prognamest_gidstdinst_modest_nlinkutil.cprint_check_messagest_atimedev_tforcegid_tcheck_plausibilityparse_journal_optsst_ctimeshort_yesjournal_usagenlink_tblksize_tst_uidst_devmode_tst_rdevabort_mke2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/ext2fs_et_listinitialize_ext2_error_tableinitialize_ext2_error_table_rext2_err.cold_desc_blocksext2fs_new_blockext2fs_get_free_blocksext2fs_fast_unmark_inode_bitmapext2fs_test_inode_bitmapext2fs_alloc_blockstart_inodeext2fs_fast_test_block_bitmap_rangeext2fs_set_alloc_block_callbackgoalext2fs_fast_unmark_block_bitmapdir_groupcheck_block_uninitext2fs_new_inodefailcheck_inode_uninitext2fs_fast_mark_block_bitmapext2fs_inode_alloc_stats2ext2fs_group_of_inoisdirext2fs_block_alloc_statsext2fs_mark_inode_bitmapext2fs_mark_ib_dirtyfirst_unused_inodeext2fs_inode_alloc_statsalloc_stats.cext2fs_set_block_alloc_stats_callbackext2fs_unmark_inode_bitmapext2fs_resize_block_bitmapnew_real_endext2fs_allocate_inode_bitmapext2fs_set_block_bitmap_rangeext2fs_free_inode_bitmapext2fs_set_inode_bitmap_rangeext2fs_set_bitmap_paddingext2fs_resize_inode_bitmapext2fs_generic_bitmapext2fs_copy_bitmapext2fs_clear_inode_bitmapext2fs_get_inode_bitmap_rangeext2fs_compare_block_bitmapdescrext2fs_fudge_block_bitmap_endnew_endext2fs_allocate_block_bitmapext2fs_compare_inode_bitmapext2fs_clear_block_bitmapext2fs_free_block_bitmapext2fs_fudge_inode_bitmap_endoendext2fs_get_block_bitmap_rangedind_blockbcountlimittind_bufblock_contextxlate_funcext2fs_get_arrayblock_iterate_indblock_iterate_tindxlatedind_bufext2_extent_handle_text2fs_block_iterate2ext2fs_extentblock_iterate_dindtind_blockchangede_lblkext2_extent_handleerrcodeextent_erroutabort_exitreal_privateext2fs_block_iteratecheck_desc.cext2fs_group_first_blockext2fs_check_descext2fs_group_last_blockgroup_shadowret_old_desc_blkgroup_blockret_super_blkext2fs_flushwrite_backup_superbuffer_blkwrite_idxwrite_primary_superblockcheck_idxret_new_desc_blkret_meta_bgtest_rootsuper_shadowsgrpclosefs.cgroup_ptrcache_sizeext2_inode_cache_entext2fs_super_and_bgd_locwrite_primary_superblock_onlynew_supermeta_bg_sizeext2_db_entryext2fs_closeext2fs_bg_has_superbadblocks_flagssortedcache_lastext2fs_update_dynamic_revnumblocksold_superinodes_per_grpext2fs_set_gdt_csumold_unusedcsum.cend_inofind_last_inode_ingrpold_flagsstart_inoold_csumgrp_noext2fs_group_desc_csumext2fs_group_desc_csum_setext2fs_group_desc_csum_verifyext2fs_extent_insertextent_pathext2fs_extent_header_verifyoffset_supermax_lblkimage_inodeextent_node_splitei_leafoffset_inodenew_uniniteh_entriesext2fs_extent_deleteimage_reservedext2fs_extent_freeupdate_patheh_depthfs_device_nameeh_generationext3_extentorig_heightnewextentnewpathmax_uninit_lenorig_opext2fs_extent_replacefs_netaddrorig_lengthext2fs_extent_get_infomagic_numberei_unusedeh_magicorig_lblknew_node_pblkmappedimage_devicemax_entriesee_start_hifs_blocksizefs_reservedext2fs_extent_gotomax_depthmax_lenoffset_blockmapext2fs_extent_openleaf_levelext2_extent_infoext3_extent_headernew_node_lengthdonelog_flexfs_devicenew_node_startfs_netaddr_typecurr_entrygo_downtocopycurrextent.cext2fs_extent_getee_blockgoal_blkmagic_descriptormax_pblkentry_sizefs_hostnameext2fs_extent_fix_parentsret_handleext3_extent_idxee_lenfs_uuidnew_rootext2fs_extent_set_bmaplogicalei_leaf_hieh_maxoffset_inodemapbytes_availnewehee_startimage_timevisit_numcurr_levelei_blockextent_uninitretryoffset_reservedadd_to_dirlistdirentdir_listext2fs_find_block_devicenew_listd_reclenret_pathskip_to_nextcurrentfree_dirlistfinddev.cdirlensuccessext2fs_badblocks_list_freeext2_u32_listext2fs_u32_list_freeext2fs_freefreefs.cext2fs_free_inode_cacheext2fs_free_dblistgen_bitmap.cext2fs_compare_generic_bitmapext2fs_fudge_generic_bitmap_endext2fs_fast_clear_bitext2fs_resize_memdescriptionext2fs_free_generic_bitmapext2fs_allocate_generic_bitmapext2fs_mark_block_bitmap_rangeext2fs_set_bitext2fs_get_generic_bitmap_startext2fs_mark_generic_bitmapext2fs_get_generic_bitmap_endcheck_magicext2fs_unmark_block_bitmap_rangeext2fs_fast_set_bitext2fs_warn_bitmap2ext2fs_resize_generic_bitmapext2fs_set_generic_bitmap_rangeold_sizeinit_mapADDR__dummy_hext2fs_set_generic_bitmap_paddingoldbitext2fs_test_bitext2fs_test_generic_bitmapbitnoext2fs_test_block_bitmap_rangeext2fs_clear_bitext2fs_make_generic_bitmapext2fs_clear_generic_bitmapbase_error_codeext2fs_copy_generic_bitmapext2fs_unmark_generic_bitmapext2fs_get_generic_bitmap_rangeext2fs_write_ind_blockind_block.cext2fs_read_ind_blocki_crtime_extrai_ctime_extraext2fs_inode_scan_flagsext2fs_write_inodeext2fs_get_next_inode_fulltemp_buffercheck_for_inode_bad_blocksext2fs_read_inode_fullinode_bufferdone_groupcurrent_inodeget_next_blocksforce_new_groupext2fs_open_inode_scanext2fs_set_inode_callbacksave_get_blocksext2fs_write_inode_fullret_scanext2fs_write_new_inodeextra_bytescurrent_groupext2fs_get_next_inodei_extra_isizei_atime_extraext2_inode_largeext2fs_read_inodebytes_leftbufsizegroups_leftcurrent_blockinodes_per_blocki_crtimelarge_inodeblocks_leftext2fs_check_directorynum_blocksget_next_blockgroupi_pad1ext2fs_inode_scan_goto_blockgroupclear_flagsdone_group_dataext2fs_get_blocksinode.ctemp_inodei_mtime_extrainodes_leftinode_buffer_blocksbad_block_ptrext2fs_close_inode_scancreate_icacheset_flagsi_version_hiext2fs_flush_icacheio_channel_read_blk64io_channel_set_optionsio_channel_write_byteio_channel_write_blk64io_manager.cext2fs_check_if_mountedext2fs_check_mount_pointst_bufmtlenis_swap_devicemtptfile_devismounted.cext2fs_zero_blockswrite_journal_inodeext2fs_default_journal_sizejfilemkjournal_proczero_countret_jsbext2fs_add_journal_inoderet_sizeblk_to_zeroret_blknewblocksret_countmkjournal.cwrite_journal_fileext2fs_add_journal_deviceext2fs_create_journal_superblockjournal_inomkjournal_structio_flagsgroups_per_blockold_ioext2fs_open2ext2fs_get_data_ioopenfs.cret_fsext2fs_openext2fs_rewrite_to_ioext2fs_descriptor_block_locext2fs_set_data_ionew_ioread_bb.cbb_listmark_bad_blockread_bb_recordext2fs_read_bb_inodeskip_this_inode_bitmapext2fs_read_block_bitmapext2fs_read_inode_bitmapsuccess_cleanupino_itrext2fs_test_bb_dirtyext2fs_write_inode_bitmapino_cntskip_block_bitmapext2fs_write_bitmapsblk_itrcsum_flagblock_nbytesrw_bitmaps.cnbitsblk_cntdo_inodeext2fs_test_ib_dirtyinode_bufext2fs_write_block_bitmapdo_imageskip_this_block_bitmapinode_nbytesdo_blockext2fs_read_bitmapsundo_flushundo_io.ctdb_contextundo_write_byteblksize_keystruct_undo_managerundo_io_read_errorblock_numundo_read_blkdsizemtime_keywrite_file_system_identityset_undo_io_backup_fileTDB_DATAundo_channeltdb_dataundo_private_dataundo_set_blksizetdb_keyTDB_CONTEXTset_undo_io_backing_managerundo_openext2_loff_tactualundo_write_tdbundo_set_optiontdb_writtentdb_data_sizeundo_closewrite_block_sizeundo_err_handler_initrealbacking_blk_numuuid_keyfile_nameactual_sizeend_blockread_ptrundo_write_blkfind_cached_blockaccess_timeerror_outunix_private_dataflush_cached_blocksunix_set_optionunix_write_blkfree_cachewritethroughraw_read_blkalloc_cacheinvalidateunix_io.celdestretval2reusessize_tunix_read_blk64unused_cacheunix_closeraw_write_blkunix_read_blkunix_get_statsunix_write_byteoldest_cacheunix_cachereuse_cacheunix_openunix_write_blk64unix_set_blksizeunix_flushstruct_unix_managervalid_blk.cext2fs_inode_has_valid_blocksalloc_sb.cext2fs_reserve_super_and_bgdext2_badblocks_iterateext2fs_u32_list_delext2fs_badblocks_list_iterate_beginext2_u32_iterateext2fs_badblocks_list_delext2fs_badblocks_list_addremlocext2fs_u32_list_findext2fs_badblocks_list_createext2fs_u32_list_equalext2fs_badblocks_list_iterate_endext2fs_badblocks_copyext2fs_u32_list_iterateext2fs_u32_copymake_u32_listbadblocks.cext2fs_badblocks_list_iterateext2fs_u32_list_countext2fs_badblocks_equalext2fs_u32_list_addext2fs_u32_list_testext2fs_u32_list_iterate_beginiterext2fs_badblocks_list_testext2fs_u32_list_createext2fs_u32_list_iterate_endext2_struct_u32_iteratebitops.cext2fs_warn_bitmapext2fs_crc16crc16_tcrc16.ccrc16_tableext2fs_iblk_sub_blocksext2fs_iblk_seti_block.cext2fs_iblk_add_blocksoriginllseek.cext2fs_llseeksuseconds_tpartialtdb_log_funchave_transaction_locknew_dbuflist_structTDB_DEBUG_FATALtdb_ofs_readtransaction_expand_filetdb_unlock_recordTDB_DEBUG_TRACEext2fs_tdb_map_sizeF_UNLCKmax_dead_recordsparsertravlocksrec_lentdb_find_lock_hashext2fs_tdb_reopen_allTDB_DEBUG_WARNINGtdb_rec_writel_starttransaction_brlockhash_headsext2fs_tdb_lockall_unmarktdb.celements_lasttdb_unlockfailedl_typetransaction_syncext2fs_tdb_traverseext2fs_tdb_transaction_commitupdatetdb_dump_recordtdb_count_deadext2fs_tdb_errornum_locksmem_tdbtdb_headertdb_mmaptdb_transactiontdb_parse_datanew_lcktdb_write_lock_recordlastrectdbsext2fs_tdb_firstkeyTDB_ERR_CORRUPTsequence_numberrecovery_eofext2fs_tdb_set_max_deadTDB_ERR_NOLOCKtdb_update_hashext2fs_tdb_validate_freelistext2fs_tdb_existsnull_log_fntdb_delete_hashext2fs_tdb_traverse_readTDB_ERRORrecovery_offsettdb_next_hash_chaintdb_methodsremove_from_freelisttimevalTDB_DEBUG_ERRORtdb_transaction_unlockF_SETLKext2fs_tdb_fetchtdb_recovery_sizeF_RDLCKext2fs_tdb_errorstrparent_longlivedvertestflockdefault_tdb_hashext2fs_tdb_lockall_read_nonblocktlocktdb_exists_hashext2fs_tdb_deletetv_usecext2fs_tdb_chainlock_unmarkext2fs_tdb_hash_sizeleftsizetdb_freetdb_munmapext2fs_tdb_transaction_cancelrw_typetdb_findext2fs_tdb_chainunlock_readfull_hashwant_nextrecovery_headtdb_dump_chainext2fs_tdb_storenewrectdb_len_ttransaction_writetdb_next_locknestingext2fs_tdb_transaction_recovertdb_allocate_ofsext2fs_tdb_closelock_rwtdb_new_databasetdb_writeTDB_ERR_RDONLYrightext2fs_tdb_log_fntdb_brlocktdb_debug_levelext2fs_tdb_chainunlockext2fs_tdb_printfreelist_tdb_locktdb_ofs_writetotalsizetdb_lock_recordnew_dptrtransaction_methodspnum_entriesboolext2fs_tdb_chainlock_markl_pidkey_lenext2fs_tdb_get_seqnumtdb_allocateext2fs_tdb_lockall_readbestfitecodeext2fs_tdb_lockallext2fs_tdb_fdtdb_transaction_elext2fs_tdb_dump_alltdb_rec_free_readhash_fnnewrec_ptrtdb_purge_deadext2fs_tdb_enable_seqnumoldhashext2fs_tdb_nextkeyext2fs_tdb_lockall_nonblockupdate_tailerext2fs_tdb_appendsave_errnoext2fs_tdb_set_logging_functiontdb_already_opentdb_traverse_funcext2fs_tdb_transaction_startlog_privateext2fs_tdb_chainlockdata_lentdb_nullF_WRLCKtdb_do_deletetdb_increment_seqnumF_SETLKWTDB_ERR_EXISTSext2fs_tdb_get_flagsglobal_locktdb_logging_contextltypeext2fs_tdb_lockall_markmark_lockext2fs_tdb_open_exlockedio_methodsrecovery_max_sizetransaction_next_hash_chainTDB_ERR_EINVALtdb_oobnum_lockrecsnewdbbest_elTDB_ERR_IOext2fs_tdb_increment_seqnum_nonblocklog_ctxtransaction_readestringtdb_find_deadtdb_traverse_internalTDB_ERR_NOEXISTtdb_brlock_upgradeext2fs_tdb_chainlock_nonblocktdb_transaction_locktv_sectdb_off_tTDB_ERR_OOMtdb_expandnew_map_ptrold_map_sizeread_onlyTDB_ERR_LOCK_TIMEOUTtransaction_setup_recoveryadditionl_whencetdb_errnametdb_converttdb_lock_typeext2fs_tdb_lock_nonblocklast_ptrext2fs_tdb_chainlock_readtdb_readTDB_SUCCESSTDB_ERR_LOCKext2fs_tdb_parse_recordtdb_alloc_readtdb_rec_readtransaction_oobtdb_key_compareoldkeytdb_write_unlock_recordlck_typetdb_recovery_allocatemagic_foodmagic_offsettdb_flagsrwlockstdb_io_initext2fs_tdb_nameext2fs_tdb_unlockall_readtdb_expand_fileext2fs_tdb_openext2fs_tdb_get_logging_privatetransaction_errorrecovery_starttdb_hash_funcext2fs_tdb_unlockallpage_sizeseen_insertext2fs_tdb_reopentailer_ofstdb_traverse_lock_et_dynamic_listtable_numadd_error_tableremove_error_tablesafe_getenv/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etdebug_fet_list_lockstartedet_list_unlockdstrerror_message.cadd_to_error_tableinit_debugerror_messageoopsnew_tablechar_setet_name.cerror_table_namecom_errnew_procreset_com_err_hookcom_err.cpvardefault_com_err_procerrfwhoamicom_err_va__builtin_va_listbit_namesbid_priblkid_tagblkid_struct_devbic_devsbic_filenameblkid_struct_tagbid_namebid_tagsbid_devsbic_flagsbic_timebid_labelbit_val/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/blkidbit_devbit_namebit_tagsblkid_cachebid_uuidtagnamebid_devnoblkid_devblkid_get_devnamebic_tagsbid_typeblkid_get_tag_valuebid_timebid_flagsbid_cacheblkid_struct_cachebic_ftimeresolve.cblkid_find_dev_with_tagtag.cret_typevlengthblkid_tag_iterate_beginblkid_tag_iterate_endblkid_dev_has_tagtry_againprobe_newblkid_tag_iterateblkid_find_head_cacheblkid_tag_nextblkid_struct_tag_iterateblkid_set_tagdev_varblkid_new_tagblkid_free_tagret_valblkid_parse_tag_stringlist_add_tailblkid_find_tag_devblkid_gc_cacheret_cacheblkid_debug_maskblkid_get_cachelist_emptycache.cblkid_put_cachepnextblkid_dev_devnameblkid_dev_iterateblkid_dev_iterate_beginblkid_dev_nextnew_typeret_devblkid_dev_iterate_endblkid_new_devblkid_dev_set_searchblkid_free_devnew_valueblkid_struct_dev_iteratesearch_typesearch_valueblkid_probe_allonly_if_newdev2blkid_probe_all_newblkid_get_devdevname.cdevdirsblkid__scan_dirblkid_devno_to_devnameblkid_strndupdevno.cblkid_strdups_dummy5modify_datereserved1nr_disksxs_dummy2rs4_dummy2blkid_loff_t__pad1embed_first_blocksystem_supports_ext4patch_versionoem_idprobe_cramfsleaf_offsb_validprobe_gfsvd_typeprobe_romfsms_sysidvs_hiddenoffset_xlvol_bkupocfs_volume_headerbytes_allocatedbuf_mftvolume_idext_block_startmd_magicswap_id_blockos9_folderrs_orig_journal_sizedl_idvd_idnext_cnidbim_lensws_volumexs_dblockssb_bsize_shiftfs_nameuuid_tsect_countprobe_ext4devreiser4_super_blocklvm2_pv_label_headerfat_entry_offatrbtime_creatxs_dummy1probe_hfsplusms_headsxs_dummy3blkid_known_fstypevd_versionms_ignoredsystem_supports_ext4devprobe_swap1sectors_per_clusterminor_versionlast_checkjumpret_uuidlast_mount_versvs_cluster_sizes_reserved_word_padjs_sizers_journal_blockset_uuid0probe_reiserfs4no_addrcluster_per_mft_recordmsdos_super_blockxs_ifreecat_fileromfs_super_blockfile_attributedir_countbuf_sizesb_multihost_formatrs4_dummynext_sect_offlabel_strvs_sysidprobe_jfsusa_ofsprobe_swap0vol_idleaf_blockudf_magiccheck_for_modulesusa_counttotal_blockswr_cntvs_flagsbios_parameter_blocksws_badpgjs_versionvs_pmagicattrlvm2_calc_crcno_formal_inoxs_fnamentfs_super_blockattr_filesignaturers_dummy2rs_dummy3rs_dummy4no_namevs_ignoredcrctabprobe_ocfs2vfat_super_blockjs_loguuidblkid_verifyjs_l2bsizers4_uuidembed_blockcountprobe_luksrs_magichfsplus_catalog_keyvs_total_sectget_bufferunicode_16be_to_utf8unicode_lensb_master_dirsb_bsizehfsplus_extentnot_persistentvs_magicmount_lenparent_idattr_lenvbm_stvol_seq_numvs_versionsws_padblkid_magicgfs2_meta_headernon_residentreiserfs_super_blockinstanceext_block_countisosbfuturemdp_superblock_sfound_typebytes_per_sectorsws_versionms_fat_lengthprobe_lvm2checked_datevalue_lenleaf_node_sizeprobe_fat_nomagicrs_labelalloc_first_blockleaf_node_headout_lenprobe_hfsnum_root_dirsstart_filelink_countosx_foldervalue_offsetvs_dummy2ms_cluster_sizecluster_countprobe_ext2xs_fdblocksmaster_file_table_recordclp_sizexs_magicname_offsetms_sernocreate_datealloc_block_sizecramfs_super_blocksb_lockprotoros_magicms_hiddenhfs_mdbfs_proc_checkleaf_node_countrs_uuidcrc_xlvs_insfo_sectormaxloophfs_finder_infoattr_offin_lenmh_magicdate_creatfigure_label_lennext_allocms_secs_trackcheck_mdraidunicodeprobe_iso9660blkid_probe_tset_uuid2nm_flsls_Modprobe_udfroot_startjs_labelopen_errmh_typevs_fat32_lengthset_uuidms_unknownms_magicjs_bsizerecord_countjs_magicct_clump_sizeuuid_strmft_mirror_cluster_locationret_readdisk_lockfilesprobe_zfsgfs2_inumcramfs_infovs_headsprobe_ocfsros_volumemh_formatstart_apppv_uuid__pad0__pad2space_sizers_free_blockssb_fs_formatvs_backup_bootjs_dummy2jfs_super_blocknumber_of_sectorsbim_kboffsws_nrbadescape_sequencessearch_fat_labeliso_volume_descriptornext_offvs_sernoextentsname_lenjs_l2bfactorstart_blockms_labelms_mediavs_reservedprobe_oracleasmmft_record_size__s8editionhfsplus_bnode_descriptorsystem_idms_pmagicvs_unknownleaf_countvol_sernotype_arraysb_headerprobe_gfs2rs_blocks_countdiffocfs2_super_blockdl_tagval_lenvs_root_clustergvalid_wordsrs_root_blockprobe_ntfsocfs_volume_labelstart_data_sectal_blk_sizersrc_clump_szcat_blockdate_accxs_icountros_dummy1js_padvs_secs_trackcluster_lowleaf_tailxfs_super_blockrs_blocksizemft_cluster_locationtime_accprobe_reiserfsxt_clump_sizeencodings_bmphfsplus_vol_headergfs2_sbprobe_ext3ms_fatsbim_sboffvs_reserved2vs_labelvs_dir_entriesopen_foldervs_mediatotal_sizeembed_startblockbim_probecluster_highvolume_serialhfsplus_forkalloc_filebim_typefat_sizeblkid_probeset_uuid1set_uuid3sws_lastpagevs_sectorscluster_per_index_recordvs_fat_lengthrs4_magicvol_labelms_dummy2probe_fatattributesboot_folderjs_l2pbsizexs_uuidxs_blocksizeblkid_swab16vs_sector_sizeget_ext2_infofree_bksal_bl_stmd_minorvs_fatsnr_clustersattrs_offsetext_filexs_rblocksroot_dir_entriessector_xlms_reservedwrite_countembed_sigvol_id_lensb_root_dirms_sectorsoracle_asm_disk_labelms_total_sectleaf_headbuf_maxbim_magicfolder_countdata_clump_szbytes_in_usefile_countms_dir_entriesprobe_jbdsws_uuiddate_writesb_locktablealloc_ptrbnodeprobe.cjs_pbsizesbbufhfsplus_bheader_recordblkid_swab32cr_datenewbufjs_uuidtime_writenum_recsval_offattr_typeprobe_xfsvfat_dir_entryraid_disksmajor_versionbackup_datenm_al_blksnxt_cnidprobe_ext4rs_journal_devms_sector_sizers4_labelparse_devblkid_read_cacheskip_over_wordparse_tokenblkid_parse_lineskip_over_blankdev_pparse_tagparse_endparse_startread.clinenostrip_linesave.copenedblkid_flush_cachesave_devvalid_blkgetsize64valid_offsetgetsize.cblkid_get_dev_sizeblkid_llseekclear.cuuid_clear/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/uuidclock_lowget_clockhas_inituint64_tuuid_generate_timetime_miduuid__generate_randomuuid__generate_timetime_hi_and_versiontmp_seedget_random_bytesstate_fsave_umaskclock_miduuid_generateclock_highuint16_tftruncateuuid_generate_randomgen_uuid.cclock_regget_node_idlose_counterget_random_fdget_uuid_via_daemontime_lowret_clock_seqstate_fdadjustmentisnull.cuuid_is_nulluuid_packuuid_parseunpack.cuuid_unpackfmt_upperuuid_unparse_loweruuid_unparse_xuuid_unparseuuid_unparse_upperfmt_lowerunparse.ce2p_edit_feature2/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/e2pclear_ok_arrayfeature.ccompat_typejrnl_feature_liste2p_feature2stringe2p_jrnl_string2featuree2p_edit_featurecompat_arrayskip_over_blankseptrfnume2p_jrnl_feature2stringfchare2p_string2featurehashstr.ce2p_hash2stringe2p_string2hashhash_listls.clist_superprint_featuresprintedsecslist_super2flags_foundprint_mntoptsprint_super_flagsinterval_stringprint_userprint_groupmntopts.ce2p_mntopt2stringe2p_edit_mntoptse2p_string2mntoptmntopt_listprint_fs_errorsprint_fs_statee2p_uuid2stre2p_is_null_uuide2p_uuid_to_stre2p_unpack_uuide2p_os2stringos_typeostype.ce2p_string2osos_tab/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstructword_type../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4__divdi3DWunioncomplex long doubleUDItypecomplex floatcomplex double__moddi3__udivdi3isprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockpagesl_pageCountmajSizeendptroverflowstrtol.cstrtolstrncpy.cstrncpy/home/tyndur/tyndur/src/lib/stringstrrchr.csavestrrchrstrcasecmpstrncasecmpu_charstrcasecmp.cmemmovememmove.cdst0src0strcat.cstrcatstrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cstrdup.cstrlen.cstrlenmemcpy.cmemset.cu_intpositivedecimalitoastrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpc_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeouttimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexntohlnet.cntohsp_aliasesgetprotobynameip_strs_protoh_addrtypehtonlNO_RECOVERYinet_ntopfamilyhostenthtonsservicesprotocolnetshortproto_aliases_tcpNO_DATAserventTRY_AGAINhostshortinet_ntoahostlongservice_aliases_imaph_aliasesip_stringp_protosocklen_ts_addrnetlongservice_aliases_ircgethostbynameinet_ptonin_addr_tprotocolsh_nameh_errnoip_qherrorin_addrAF_INETinet_atonHOST_NOT_FOUND/home/tyndur/tyndur/src/modules/lib/posixprotoentservice_aliases_https_aliaseshstrerrorh_addr_lists_portgetservbynameunlinkunlink.cSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flagsold_posio_resposix_files.cF_GETFLflags_sizefd_to_filefd_listnext_fdaccess.caccessoptresetostrnargcopterrgetoptgetopt.cnargvoptoptgetpidgetpid.cgetppidreadlinkoldpathsymlinkmisc.cgetpagesizeisattygethostnamepipemkfifostat_buffchmodinode_numlost_statmknodfstatstat.cstatuslstatmkdirgettimeofdayuser.cgeteuidgetuidgetegidgetgidrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidactimeutimbufmodtimeutimeutime.cstrerror.creaddirio_direntry_type_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirfileidmktemp.cmkstempmktemptemplatesend_messagemetadataio_create_linklink_dirend_free_pathlink_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlinkyieldsleep.cresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlerfscanf_getcvscanfsscanf_tellinput_errorjtellinputjscanfmatchedfirst_digitconvert_numbervfscanffscanf_ungetcassign_number/home/tyndur/tyndur/src/modules/lib/stdlibcassignnegationmatching_errorjgetcsscanf_getcscanf.cparse_percentjscanf_getcjungetcjscanf_read_numbertptrscansetvsscanfmatchsscanf_ungetcsscanf_statejscanf_telljscanf_ungetcfscanf_tellfscanf_statevfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_argsfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcasprintf.casprintf_putcasnprintf_handlervasprintfasprintf_argsbuflenputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcio_write_request_tfputssetbuffopenfflushfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftellsetbufferatexitexit.catexit_listabortptr_typedivisorremainderulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexrnd_seedsrandomsrandrand.caFebaFrigmtime_rdatestrctime_stringnstrBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDecaThuDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTaSataJanaWedaSepaAprmonatlocaltime_raTueLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJunaAugasctime_bufaMonlocaltimesprintf_handlervsprintfexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_putcsnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namerpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_tcur_bytemac_to_stringip_to_stringregister_netcarddevice_numbernet_devicenetwork.cip_bytesstring_to_ipdriveropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cget_tick_count.cget_tick_countphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrtok.cspanpdelim__strtok_rstrtokcontmemchr.cmemchr__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu+t P +R %P')P,-u-/u/Ht,>>FSFHt EEP<EPEEPHIuIKuKptpquqsustSuu tP tvRSSS?FSS(lSSSSStp&tptl@tlPP&4P9ZP_ePPP  PrSS?FSlSS&SSS  Stvtvh&tvtvtvtv tvththithth&thththth thtvtvitvtvtvtv tvfQPPi~PPPP  u  u # t ! P! + S. S S # S| P V P  V , Vp w Vw P V V  P # V tt  tt tt$ % u% ' u' t$ B PB t~$ B RB t~ t~ t~SPSSPSPS(P(6S6Et~ENP1t~;Jt~ot~ tp tpk R R t~ t~ W . W.WHW6WoW V V g S Q S Q S Q S P S P tl0 otl P S" S6ESoS tl.tl6tlEotlPP th.thO6thEoth t~1t~ t~1t~ t~1t~ VkV3sV t~qt~qS1t~EJt~ t~.t~u`t~jot~ t~FWHiWi"t~"1W V t~Ft~Hkt~kV"V"1t~ W t~Ft~Hmt~m"W"1t~ t~Ft~Hwt~w"t~"1t~ t~_"t~yMV&1Vuu%t%tPt P%t PP(,u,2Q23u35u5+t(NqN4S4qSqSqSq#S#n&qn&.'S.'J'qJ''S''q'(S((q((S(W)qW)~)S~))q)#*S#**q**S*+q(JqJ+twoP PEZP%%P~))PAtlPtlPtltltl#n&tl.'J'tl''tl((tl(W)tl~))tl#**tl*+tltw(?twVtwtwtw#%tw&n&tw.'J'tw''tw((tw%)W)tw~))tw#**tw*+tw?twtw*S*twtwtw#n&tw.'J'tw''tw((tw(W)tw~))tw#**tw*+twAV VlV;VV#|$V%&V;&n&V~))V))VC*n*V++VAtwtwtwtw#n&tw.'J'tw''tw((tw(W)tw~))tw#**tw*+tw %S(%)SS %SoSIQPQVS((SAtwtwtwtw#n&tw.'J'tw''tw((tw(W)tw~))tw#**tw*+twPE~S(?Sn*z*SWSS-FtwFlSltwStwceSStwS!#SvtwS13Sc%%tw''tw((tw%)W)tw))tw*+twthVthPth_th_vPvthPthc%%th&&P&;&th''th((th%)W)th))th**th*+thtwVtwtwtwc%%tw&;&tw''tw((tw%)W)tw))tw**tw*+twWbRbkPkR**PtwVtwtwtwc%%tw&;&tw''tw((tw%)W)tw))tw**tw*+twtwVtwtwtwc%%tw&;&tw''tw((tw%)W)tw))twz**tw*+twPPUPktP4thth6thP!th!V!VV!!th!!P!""th""B"PB""th""P"J'thJ''V''th''V''P'O(thO(g(Pg(t(tht({(P{((V((th((V()th#*+th4twtw6twn&tw&)tw#*+twPG#Y#P}##P##P##P]$t$P8KPfsPxPP$$P*KPfsPxPP|$$P$$P%$%P=%N%P!&P%%PO&f&Puu3t45u57u7t4[[StStS4[[Vt Vt VT[Q[jPjQPQQuut*tCLSwSS";S?LSY[SiSLt\LtpLtTJt`uutSt7S79t9St WWt P1Ptx9txuutuut22TSTVtVS00PuutStuuctP,t,.P.ct 8R?SPacP*S.QSScSdeuegugytuu1t  1R1t45u57u7t4NNt4rrt 4tt4N NYWY[t[WtWtWtWtW4NNXVX[t[VtVtV{SSSuu;t#P#/V2*V-;VR;tXQtTRQR;tT+W)S-tp-tl-thq-t`6;t`<=u=?u?t<VVt<VVaWact cWt  W  t W<VV`V`ctcVt V  t VS Suu,t//WtWt,WllqPRqt t ,//VtVt,VsSPSPSPSPS*S*,PztltlHt\,t\,-u-/u/t,@@t,fft ,[ [twVVvtltlQxWWJSOvSSuu1t  1R1t45u57u7t4YYVtV4YYt 4YYtt4 t uutuut99StS99t PRt 99WtWuut !u!#u#>t@AuACuC^t`auacuc~tuutuutuutuutuutuu tuu0t01u13u3PtPQuQSuStPbbjSjltlStyQuutQtuutuut u  u tuutuutuukt3P3kt\<R<ktX<Q<ktT<<\S\`t`{S{tStkS>^W`}WWkWL`t`ut`t`]t`dkt`L`tputp KtdKtp]tp)PDQPPP 1PL]VcoVo|PRVkVL`thuthKth]thL`tlutlktllmumouotlPtXlRtTlQtPlVtVtVtVWWWWt\t\\t\%t\t\tltlct`tl,tlPx~PSSSS"SStdtdtd3tdththBthuu t t t t/t1 * t t t ? t 1 t1 @  @  t1 t1 @ @  t1 t1 @ @  tVjVLV  V VPPP P  P P!t}/<t}JLt}[8t}Ct} t}@ o t}t t}  t}* Y t}^ t}  t}?  t}t} & t}& 1 P1  t}VjVPRVRVV/V  V@ t V* > VR> ^ V V  Vtl /tltlt  tl tl tl ? tl  SVySVt SV  SV SV SV ? SVth /ththPRtht  th th th ? thtd /tdtdt  td  PR  td td td ? tdW /W~Wt W W W ? WV/V  V^ V V  V?  Vt~/t~ 1 t~ t~ t~0 t~  t~t~/t~ 1 t~ t~ t~ W2 W W t~ W  t~ P PS S 1 Sa S S?  St~/t~ 1 t~ t~ t~< t~  t~t~/t~ 1 t~ t~l > t~> D PU ^ t~^ z P  t~  u  u F tuut  0W02t2WtW'2tTEtTYSt`R<S<ZRr~RRSRSSSVSSVXVVuu@tP@QR3S6=S@AuACuCt@OOt@iit uuAtAtAt jjtAy ytA tAtAththAth[t`t`<At`]Q Q4AQSAStlAtltpAtpDEuEGuGjtDTTjtlmumouotlWtWtWV,VVV P .VFVS S  P7kSkrPSSP  PSPS&S&)P).ShS.tLFtLtP.tPFtPtp.tpFtptl.tlFtlth.thFthx|td|Rt\ -t\-Vt\uutStStSPPPPPuutP"S&SSRtp_VVP.WWuutQtuuOtOt6W8@WBMW%Btd,BtheRRR R,#V,4S8>S,BtlPQuQSuStPccQtuu?t  !P!?t44?t @AuACuCt@TT]S]ataStS@t  u  u tt3P=XPUrVtuuuwuw8ttVt8VtSt8S89u9;u;)t8PP)t8vvt t t )t 8qqtmmt)vWWW)WSPST,SmS}SSS)SV VVVvVVV VVV)VPPPPPPPP PPP$)PQ}Qgpt`ptXt`tXt`tXt`tXt`tXt`tXt`&tX&4t`4,tX,Ft`FKtXKht`htXt`tX/t`/tXt`tXt`)tXvtp)tp,-u-/u/t,CCVtV,Nt dSSSSPPSSS SS&S&2P2JSbzSuu tP tLR tHVt VWtWt VW tW t VW tW t VW tW t VW tP - P- tP P tP u u  t    Rt  u  u a t 2 P2 S tHS X PX a tH| - VW0 C VWS S , S0 B SF O Sd e ue g ug td P S S S P S V P VR V V V V V PVP2V?GVGMPMVPVPVP&V-2V7<V{VPVPVPV**VQ\V\PVPV tlY tl&tltl t~Y t~]&t~*t~ t~ t~ t~ t~ t~ <t~glt~t~ t t t tY t &t2<tt t t <ttVt tB t t  W &t2<tt"W"t t t t V <tt WY W WW*=W t4 t &t2<tt t; t &t2<tt WY WC WI R WY W&W=WuutVtV t V0EtSS-SS?hRmRRS S PS #P#-SSPSPSSSuuttt  t~tt~ t t~tt~``tptptPPPPPPPkSPSPS,SSPSpSuzPPPS*5S5;P;`S|SPSPSSSQvSvyPyS1t~pt~t~R;t~pt~t~Ept~t~Rpt~t~'tpttuubtbt`WdeuegugtdtdEVEat avVvst sVt Vt Vat\mst\zt\t\t\t\ SE]ShmSsSSS SPmuP ]SmsSatlmstltlVatlstluu@t!P!>W>@P =V<S@AuACuCt@UPUmVV@URUtpuutNNftfZtZtiSSSS*tw<tw/VOVVNYR[fRfqPqR%.PPRuuvtStkSkmtmvSxyuy{u{txStStuutuutVtVtuu t PP !u!#u#+t,-u-/u/7t89u9;u;qt8EEqR8EEEPEGt GKPKgt ggPiot ooP8P Pqt8WWitiqtuuuwuwttQtSVPPuu6tVt/V/6tWt 0W06t 6tpSQ89u9;u;t8RRVtVt8RRWt Wt 8MMtpdSkQuutQtPt Pt PR tuuWtMQMWt$P$.t ..P.Ot ORPMR3 3WtXYuY[u[tXmmStuutPtP(t((P0KPKtPPtPt 0t0vvtt tV-VVS,SSt`t`V0t`9<t`<>VBvVvt`Vt`tp0tptpPd|Puu t W MtMZWZtW tt  t t t t  tt ttFMtM^^t t t CFPPP PFKWsW W*Mttgtt ttFMtttt tttt !u!#u#GtHIuIKuKmtpquqsustpQtQtpRRuutQtQtPt Pt PPPuuqtEVEHtHaVadtdnVnqtFWFHt HbWbdt doWoqt HtHddqt"DSdmStuuuwuwttQtQtPt PRRRuutQtQPt PRRRuuvttStvtxyuy{u{ txPtPtPtPt Px tx StSt SVV Vuu+tPtP+t,-u-/u/st,;;TPT[t[bPbstVYPuu>tP>t<S@AuACuCbt@JJbPdeuegugtdqqQdqqR{{PPuutPVW Wuu4t45u57u7t4HHSSSWtWStS4 t MWR_rRtRRPRPRRR RxRRMWtptpMUWP W PWMOPPP3zQ*QQMWtd? tdtduutuu tP}VPVV VuxPPPP'tptp tpFtptp tpVtpYtp tpYtptp tpY|S SYtp tp  u ut ##t t t t  WWiV]  ]t/ /StS] qttt -;t~t~t~t~-7SSR1ShS-;t~\t~t~-;t~8t~8vWt~NSt~t~t~-;t~t~t~t~-8VVVV-;QQQ'QQ-9W PW<BPjtPtWPPWuub t  b t  t b   S t = S= G tG Z SZ b t V V D VG b V S= C SZ b S tp b tpd e ue g ug  t u u t  t P t  t  t  t Z Z t  t   M tM Z  Z t    t tdM tdZ tdH e td td S> V SZ q S VK e V th thZ th P P P P  PM R P P P P P P V VZ ] V  Q/ M Q Q & Qe g Q Wc m Pm WZ W P tlV tlZ tlZ e tl u u t u u Et  S t *S*-t-;S;>t>ES  V t +V+-t -<V<>t >EV R P R R P-R5>RCERHIuIKuKtHbbStStStSHllt t HbbVtVtVtVRQPQQQQuuBtSt@S@BtDEuEGuGtD\\tDrt rt zzt jtPorPPP*/PMUPozPPjvS2zSLztptpztprztptpztptpuuIt6R66t6IR3W36t 6@W@Bt BIW2V26t6?V?BtBIV 1S16t6>S>BtBISLMuMOuOtLrr|V|tVtVtVtL^^rQtr{QS{QtQSQtQSt St QSQtt Ld dtlLjjthuutVtAVADtDaVaeteVtQtQSQt@QS@DQtD\QS\`t S`et e~QS~Qtt  tlthuuttt qt {t VPnVv{V}VVV'W'+P+oWmSmoW;?R?CPCPRuu@t@tBMVM`P`V5V.W6W;@W@AuACuCWtuuvt  Pt PRtRTPRTVtRV]PR]_tR_ePRegtRgmPRmotRotPRtvtRxyuy{u{txtxRVRUt U_V_bt bVt VxUtUxH HMtM x<<MtMSWQSP5MPZZPPPuuttt StSVSttSVSttSVStSVStt t tptptptptpWWPWPWuuut++tntnuVt VVVnt nuVt1YnuPQQPsuPxyuy{u{# tx# txPPbt b# t xPPbtb# ttvVEtvEbVbitvinVntvPVPVVPZVVTVTfPhVP1V1QSQrVrS1 V1 < P< P VP c P V PRR # RW#*W*4P4bWnPWtltltl tl $ P$ # tltu"?W?CPC|W|RWPStuStutuWtuSP W  tu S< K WK P PP # tu5qRR'R R< P Rtl1btltltuPbtutuSPbSS1SQS$ % u% ' u' # t$  t   t # $ J J # t Q P Q Q Q Q P Q # Q S,  Suu2t2R2Q45u57u7`t4CC`R4CCLPLNt NUPUWt W`P`auacuct`ooR`oo{P{t Pt uu%tVtVt%Vt t %%tP P()u)+u+t(ttt(ct ciit t t (ttt(Q Qctc ^t^ t t(\\ctctttt(@@MVMtVtVtV^t^VtVtWPWPWWWW1W14P4WPIWILPLWPWitTtT'[tTtTRtTiyPP0R0hPhjRjpPpzRRPRctXtX ^tXtXtX>BPi~VV [VVtptptp3tptptpctptp^tptpQtptp^tpptpPxyPctptp[tptpPuutuutS"t"]S]`t`S--t PTYPu}PPzQPQPuu"tt"tt "t "t uutPSSSWSRtP&Q&tLtTJtTWltTvtTxQ2JQfJtXWltXvtXtXVVWlVvVVP!.PinPPPPPOOPglPqvPPhWJWWlWvWWt\Jt\Wlt\vt\Q!dQQQQWlQvQQtdJtdWltdvtdx{P@JPuutPtPtPRRRQQQuutuu't()u)+u+ t(<P<QSx~SoSs~S S(?R? t(]Q] ttAetdt t ttetdttt ttettdtt ttWtWtdtt tWWWPWPWPWWW\P\eWeqPqW P dWiqWxWWPWPW W P )WQWPWzWz}P}WP Wtetdttt ttettdtt tdt@ t@<VxVV#VVP VZqP V<V<xtXxt\eVeVdVtXQt\Qt\ tXHQQQtXQtX t\<VxVVVR V VtHHetHdtH t`Ot` t`<VVV V4eVeqRqVtptpPP{PP9tptp  u  u C t ! ! * P* , t, C PC C tD E uE G uG W tX Y uY [ u[ k tuutuu t !u!#u#t 00EVEGtGwVwytyV3DSGvSyS@@P_rP~PPuutPtPtVt Vt Vt VStStStS QtQPPPPPPuu'tP t %P%'tPP%%PPPP()u)+u+"t(<<LPLTtTiPitPtP"t(dt (mmt"tLLPPPPP"P?PSTSS"SLTR~R"RLTtptpPtpPtp tpP"tp$%u%'u't$tPtt~$RARRR$QAGQQAtMttt!PAtlRtltljSnsS+6S6FPFaSP +P9APR]PnwSSSPSdt@dntXn|t@|tXtDAtXRtXtXqlWnyW{WWWAtHRtHtHAthRththoS+ASRnSuutWtWtWtTtP tLtd RRPRR th%thuu^t  P$t$.P.WtW\P\^t^tp  !V!$t$SVSWtW^V  "W"$t$TWTWtW^W S$RSP0<P\^P`auacuctuu tWtWt Wtw twtwtwtwe twtw twSVSV SV  SVtw% twtw. twtlr tltl tl  u  u t   t t t t\ V W 7 VC r V V W P 8 WA s W} W W W W : tpC u tp tpuu<tP5t5:P:<t''5t 5<P33P::PP ,P13P<=u=?u?t<cPcvtlvyPytl<LRQLNSQNSVSVSV<tttNRRZWWW\QQuutPthRWWtt`t t`t t+tl+.PR.tltltlFsSVSVSVSVpQQQnPPPPPuuat P atl R ath Q YWY[Q[aWWS[aS 0PDSP[aPXV[aVdeuegugtdrrPtPtPtuRPPuutPWWRVVQSQSttht thuu<t<t  Vt7VW78t W8:t :<VWF Ft <tqqt< tX<tX/6SqS/:tpqtp/:t\\t\t\t\4<t\/:t`it`/6SLqSS<S<=u=?u?Yt<MMWPRWYt \]u]_u_xt\mPmxth\pRpW$,W.xW\ppstsvt`t vxt`\xt\  .t.[ [xt*S24ShjSotSvxStlPR4P<xtlSV.2SVAaSVjoSVtvSV+VajVxyuy{u{vtxvtxt tHttHVWPRVWtHWvtHx `t`j jvtx"t"jjvt`tPjvtPP S APU\PnP(SjvPPP$$P;SPejPtT,tTjvtTtX,tXjvtXt\,t\jvt\xyuy{u{txPRt uu tP t PtP tt  t  t t  SS RQtpPtpP tp !u!#u#t 00@P@ItIXPXtPt @@It Iggt t t  t 3FSISS@GVZ^V^^P^VV@BPPuu tPP S V u  u q t % P% b Wd o W % R+ H R\ \ Pi i P! ` Sd m S# a Vd n Vt u uu w uw tt  S t S P t S t St  W t W t W t W V V R V P P P P u u t   V  t , V, / t/ V  S + S6 S  W% - W4 6 WC W  tpb tp  tp tp u u : t  ) tH t : t  + 3 :  W P W W  W! ) W+ 3 W8 : W P4 tp  tp+ 3 tpuu[t[Ruut77WtW77jSjt Sddtt@tptpKtltlthjS=VVVuuztt&P&zt**zt VPV79P;=PMzVQ-9Q=zQPPCZP_zP|}u}utuutuutStSt QQQQQuutuuNtNRP*P@CPPQuQSuSYt\]u]_u_gthiuikukth~~PtPtPth~~RuutuutPtuutuuVt=S=?t?HSHJtJTSTVt::PEEPQQPXYuY[u[atdeuegugotdxxWtWt6W68t8oWdt 88[t [ffot }}PPP00P:?P}SQSRSRS4S8?S?BRBHSH[Q[oS}t`t`B[t`mot`}tptpotppquqsusyt|}u}u\t|PV V04V9FV|R\t`|Q!t\!-V-\t\P((PAAPtp0tpI\tp\]u]_u_t\St\Vt {QPQuutuutuutuu?t  #P#(t(:P:?tuu4t4R2V24t 1S14tuutPRPt5S59t 9St Vt6VW67tW79t9VWtWtuutRtSt St VtVWtWtVWtWtuu^t33^R33IWIKt K\W\^t **3St3GSVGHtVHKtKZSVuuGt  Pt"PR"'t R')t )4PR4APtAGt uu t u u7t 7t,P.5P89u9;u;t8KKYSY[t[ySy{t{S8QQTtT[[t8 t 8tRRPuu1tPSS1SR45u57u7}t4CPCLSN{SIIPlxPuutPQRuutPSSRPPQuuItPFVRBIRESLMuMOuOctLaPdeuegugyt|}u}ut|P|R|Quu-tVt-V-t SQSQSQ-Stp-tp01u13u3t0?P?bSfS0TRTdWfW0^QfuQuu tPS SRW WQV V  u uet PNSReS >R>etP (Q(5Vhiuikukth||Pth||Vt uxRxSRSRuutRPt Pt uutuutPuutPSSuut1P1wS{SS7R7YWsyW{WWBQBxV{VVuubt P 9V<_V R :W<`W Q bt`  S R S 4R48S<^SdeuegugtdPdpRpSdyQuutVtuu!tPSPS$%u%'u'.t01u13u3;t<=u=?u?JtLMuMOuOntpquqsus{t|}u}utuutuutuuatSat_W^Vdeuegugitlmumouo}tuutuutuu` tPVV` V R% 7 R` a ua c uc n tp q uq s us t u u t u u j t P V V / V2 j V R S R S R S  R . S. 2 R2 D S Q W Q W Q 0 W0 2 Q2 j Wl m um o uo  t u u t u u t u u t u u t u u t  7 S7 : t: Q SQ T tT S  8 V8 : t : R VR T t T V A A T tT [ [ t  u u K t  W t  W  t K W V2  VL M uM O uO tL f Pf S P S SSL d Rd tlL d Qd k tdk  P ?td?RPRtd tp tptp:?tpMRtptptp R$R W W?WRWuutuuFtHIuIKuKrttuuuwuwbtt@S@CtCbS2RXbRAVQbVdeuegug?tdxxVtVt?V@AuACuCt@RRVtVtNSSuuYtYtWt MWMOt OWWWYt StStSOtOUSUYt\]u]_u_t\kkth\VWVWt VW)V)*W,;W;[V[]W]VWVWV\tttd\z zt`tp,t`,9tp9t`tpt`\t\SS,;S]SS,tl2]tl]WtlWtluutV!t!+V+.t.VIIt t W!t!,W,.t.WuutWt/W/1t1WVt .V.1t 1V$t$KKt St-S-1t1S   t $t$$tpDtpuutPtlRVUVVVSWPPW?RVVVVVuutWtW\PchP|tttp tpt@Gt@t@ Et@Kt@SSSSSththth EthKhthththtdtdtd EtdKhtdtdtduu8!t#t#ssststi ti   t  8!txx#t #t Qt Qssst st i t i   t  8!t ##t#tststApti   t# #t#t sti ti    8!t#t#ssststi ti   t  8!tVtVtQVQatasVsstsVtVtpVptVi ti  V t V 8!tSt St QSQat asSsst sSi t i  S t S 8!t tPWtW\Payty~Pt t  Pz tttQatssttpti t t t 8!tttQatsstt0Atpi t t 8!tQ Q*SQaSSaQQaRR[PP8!9!u9!;!u;!X!tX!Y!uY![!u[!!tX!l!Pl!!S!!S!!SX!l!Rl!!tlX!y!Qy!!V!!V!!V{!!W!!P!!W!!P!!W!!W!!u!!u!"t!"P"/"SR"X"S\""S""S! "RQ!3"3"\"t\"w"w""t!""-"Q-"\"t \"p"Qp""t !R"R"\"t\""!R" R"\"t\"" ;"D"PW""VWF"Y"V}""V""V""u""u"_#t""P"K#VN#\#V""RQ"""L#WL#N#tN#]#W]#_#t"""J#SJ#N#t N#[#S[#_#t `#a#ua#c#uc#&t`###$t$$$&t`#w#w#2$V2$e$t e$j$Vj$m$t m$$V$$t $%V%&t &&V`#:$:$e$te$$$$t$%%k%tk%%%&t&&`#w# w#&t##Se$i$Sm$$S%D%Sk%n%S%%S#k$Wm$s$W$$Wk%&We$k$Ws$$W%k%W%%We$i$S%%Sg&&S&&u&&u&I)t&&&&V&&t&&V&&t&I)VL)M)uM)O)uO)n)tp)q)uq)s)us) +tp))P))V))V) +Vp))R) +tdp))Q))tp))Q)M*tpM**t`**tp**Q**tp*+t`+ +tpp)++ +t + +*4*Q**Q +!+u!+#+u#+9+t<+=+u=+?+u?+f+th+i+ui+k+uk++th++P++Vh++R++tlh++Q++S++W++P++W++u++u+4,t++P+,S ,$,S(,0,S++RQ++VQ++VW(,*,VW+++4,t+++4,t +,,(,t(,4,+,V,,P,,V ,,P,%,V*,1,V4,5,u5,7,u7,o,t4,@,P@,m,S4,M,RQ4,T,T,o,tp,q,uq,s,us,,tp,,,,P,,u,,u,"-t,,,,S,,t,-S-"-t,,,,R,,P,,R,,P,,R,,V- -V,,P$-%-u%-'-u'--t$-[-[-s-Ws-w-t w--W--t $-J-Y-`-Pw--PG-O-P--u--u-K0t--P--S-K0S--R-K0tP--Q--W-K0W.$.VL//V//V040V--V--tH.8.tH8..V..tH.L/V//V//tH00V40K0V--tp8..tp.L/tp//tp00tp40K0tpL0M0uM0O0uO0p1tL0^0P^0k0So0p1SL0b0Rb0l0Vl0o0tPo00V00R01V1 1tP 11V1.1tP.151V51G1tPG1p1VL0b0Qb0m0Wm0o0Qo0p1W 11R!1:1RD1P1Rb0o0tp1p1tp|00P00Pp1q1uq1s1us12tp11P12V22V22Vp11R11S11S2 2S12S 22S22S12tp22tp11S22S22u22u23t232P3213S53x3S|33S2*2RQ2V2V23t3&3&33t22P22R$3-3P53;3P;3@3R33P23V+323VB3y3V33V22V|33Vy23tl+353tlF33tl33u33u33t3333P33u33u35t34P44V45V55V33R34S45S55S33Q34W45W55W55u55u56t5556S6 6t 6{6S{66t 66S66u66u6J8t66P67W77W7J8W66R6J8t66Q6J8t666J8t66P67S}77S77S 818SE8J8SL8M8uM8O8uO88tL8q8q8|8S|88t88S88tv8}8V88V88u88u809t88809t88V 99V#909V0919u1939u39 @t09I9I9b9Sb9f9tf9 @S099;D;g;n;>> ?i?0999>t>>> @t\9f9tv9 @t\9f9tp:;;tpg;n;tpu;h=tpt=>tp? ?tpi? @tp\9f9t:;;tg;>t> ?tX?]?td? @t\9d9W ;;;Wl;n;W>>W99RQ\9f9t9;;tg;>t> @tO: ;Wg;l;Wn;;W??W\9f9tlr:;;tlg;h=tlt=>tl? ?tli? @tl\9f9tl;;;tlg;n;tl;h=tlt=>tl? ?tli??tl? @tl\9f9t;;;tg;n;t;h=tt=>t? ?ti??t??t? @Pg;l;W<<W>>W??W@ @W\9f9t;;;tg;n;t;h=tt=>t? ?ti??t? @t @ @u @@u@NAt @P@P@NAth@@SV@@SV@@WV@ASV'ANASV@@SA#ASPAQAuQASAuSAAtPAAPPAARAAth}AAQSAAuAAuABtAAA`BV`BcBtcByBVyB|Bt|BBVBBtBBVAAABWBBt BGt>GlGVlGoGt/F3FS3F5FP5F9FS=FJFPJFvFSFFSF GSGGS1G:GSbGkGSvFFSG1GS>GbGS\FFtpGoGtppGqGuqGsGusGHtpGGPGGVGGVGHVpGGRGGWGGWGHW=HoHSHHSGGtlGHtlHHuHHuHHtHHHHVHHPHHtHHSHHuHHuHnPtHIIxISxI|It|IISIItInPS=IyIVILVLLVMNVNNVNnPVtI|ItIJtLLtMMtdNNtOOtPPt:PLPtcPnPtdIzIWIJW?JBJWJ+KWP:PWtIzIWLLWMMWM[NWN3OW[OOWOOWtI|ItIJt|KLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItlIJtlKLtlLLtlMMtlMNtlN3Otl[OOtlOOPOPtl:PLPtlcPnPtltI|ItIJt"KLtLLtMNtNPt:PnPttI|IthIJthKLthLLthMMthMNthNNthN3Oth[OPth:PLPthcPnPthtI|ItIJtKLtLLtMNtNNtNNRNDOt[OPt:PLPtcPnPttI|ItIJtKLtLLtMNtNDOt[OPt:PLPtcPnPttI|ItIJt(KLtLLtMNtNPt:PnPttI|ItdIJtdLLtdMMtdHNNtdOPtd:PLPtdcPnPtdtI|It`IJt`LLt`MMt`MNt`[OPt`:PLPt`cPnPt`tI|It\IJt\JKLt\LLt\MNt\NPt\:PLPt\cPnPt\uut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Suu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uu5tWtWtWt5WVt Vt Vt 5V\S\tStSt S tS't')S).t.0S05tGRP_bPP\SSS S'S).S05S89u9;u;t8JJVtVtVt8wwt t 8JJStStStuPPPbpPPPSSSuuPtPRPQ$S$'t'PSPQuQSuStPaPi|PPP_R_gWgiRipWp|R|WaaPP_eSsSuuttRtWt WPPPSSuuJtPtPJt  Jt !!JtP#3PBEPLMuMOuOtL\\tLuut L||tPP\lPP\nthth\ntltlcjSeS\ntptpVVuutPtuu1t#S#)t)/S/1tRPR R)RP45u57u7dt4NNbSbdtdeuegugtdttySytSttyPyWWPWy}SPSPSPSPSuuBt(:R>BRDEuEGuGtDTT]S]ataSDYYat akkt %t 35t Ft t t t DtD tY_WVW%VF]V_fVfnWnyPyWVVWVYPYWYathththVthuthYatl|tlYatp%tpAtptptptpYaRRRRYaQQQQYaRRRRRDVRuu\tZWZ\t$S$&V&XSXYVV$P$NVNTPTYVY\P\]u]_u_t\yySt St St SPuutWtWtBtpIVuu t u u,t ,P,,t,-u-/u/t,EENSNRtRS,EEOVORt RVuutStuuttt tuu#tSt S #tR RRPV$%u%'u'Vt<NRRVRuutP u u tuu>t@AuACuCt@SS]W]_t_W@SSUVU_t _Vt Vt @U[SSPSSSPSU\V\_RfSVRSSVUWPW_tptpPtpfwPzPUWPPPuu@t!P!>W>@P =V<S@AuACuCt@SSVtVVt@SSWt Wt Wt elSllPlSSuutuutPVVRWW u  u `t))6t?`t&&=t =`&t&`)V)1P1NVNQPQ`V?IRKVRVaPaR=FPQ`R`auacuct`tuu)t P )Q R R P 'P,-u-/u/3t,1P45u57u7t4BPBQ4ORO_W_qRqWRWRWMSSuutuutVtVtuutt tt*S.SSQRVW!,W1W!.Q5SPSeQePQuu?t@AuACuCrtJpStuuuwuwtuutPtPRRuutPtPRR u  u =t@AuACuCt@VPVt@@VRVbVeVV@VQVaSeSSuutuuWtStWS1PSWPXYuY[u[tXiiVtVXiirPrtPuutt QtQt Q tQSSSuu\t--TVTVtV\V--SSSVtV\S0@PZ\P\]u]_u_ t\rPr tp\rRrWW W\QQlrSrQSQS StPP  u u6t 2Q26t89u9;u;rt8GGnQnrttuuuwuwttQtuut..VtV..t"7PPPuutP-W/WWYWRQthQtht%'PADPv{PPuu t t\ tX tTx W W u u t   t   + W+ t   t u u F t  F t PR . PRH I uI K uK ptH g g t ptH s s ptl } P P PPe W + W Wz R R t~ pt~ We WpWl r R Rl S S!S Vl VpV PR PR PR t~ t~pt~ P t~a v P  P; N t~N U Va t~pt~pquqsustptt  ttptPtPtPt4t>ttVLtT}tt#\S*fSS<V[_V_fPPtLtQQt't'Q+QtQQSSSR)RRy/VfxVVVV#SfSSSuuututlS!t !mSmut uthxyuy{u{txPtVVVuu@tQ@AuACuCtO|QuutStSuuTtStTSTUuUWuWtTttTkkt SWSPSP@QSQSPSStptpPPwSSS*VSVV"VW\VxVuuttMMttStjSjltltSOZPrtPPPP9PtuuuwuwttttStStSPPPPPPuubtNtN--bttP't'.R.2P2CRC-t-URPCLW0WbWV"t{CSVCKt{VKNt{-t{-]SV]vt{Vvt{t{Vbt{QVCKV PCFPQQCNQQCNQLW-0WSCJSQQCNQACPRPRPRRCNRRP3;PJLPFNt{[bt{FJS]_S_cQcSPSQSQSRQRbSuuLt P )V+LV (S+2S28PBLSLMuMOuOtLWPWSuutPSSuutt%.P.5SIPSP\P\SVP6V69P9VV19t_\t_RR19t_\t_PDct_c}t_} t_ t_t_t_t_\\P P5PP19t_\t_t_t_=t_QSt_t_19t_\t_t_19t_\t_19t_\#t_#+V+.P.Vt_t_Vt_16V\VVP!VVV19t_\t_Vt_uuttXSSS{SSattttttvttIKW WattUttaSSS=DSDRPRhSSPSHTVTZPZVVPVVPVVIWWW{WWuu?tP5S7=SRQ@AuACuC4t@]]Wt2W24t~(t(t RQuuGt  Pt"PR"'t R')t )4PR4APtAGt uut  WuudtIaSdeuegugtdxPxtldxRxthVSW~VVVuuvthSlrSrvtPvt iVxyuy{u{tuut\\|t |DIP6AtHACStLCxSVS;SUSuutuutStStuu t tuuVt IPuuXt&S,SXS(W,WXWuuntuu_tPR]VQ\S`auacucrttuuuwuwtuutuutMVMOtOxVxztzVHHOt Ot HHOtOLSOwSzSHOttnsPszttttPttuut-V-/t/XVXZtZV((/t /mmt ((/t/,S//S(/ttNSPSZttttPttuut {ttt EE^t^ss{t{t ttttt7W{WWW7V{VVV7SSS>kSs{SSS7tpR)tp)6R6StpS^R^{tpRtp7tlP)tl)6P6StlS^P^{tlPPtlPtlSSSSuutuu~tFQFntn|Q|~t,S,.t .BSBaRnzSz~R>QPQaPprPtvPx~PFaQ|~QuutQt Q tSt SR S RPPPPPQ Quut>V>@t@_V_ataV=S@^SaSUZPZattttPtt99PZZPPuutStuuN t##N tt -->t >RRN t kSytpR tp  tpF b tp tp  tpRW - WUV - V{ V V N VPtR- tF b t{ N t8tR- tF b t{ N tUS S - S SS S  S{ S S N S>VtR t tF b t t  tW h W WyS SSlSQR\S3 3 S S Q S/VV V VR RTltl\ tl tlF b tl  tlP Q uQ S uS i tuutEVEGtGoVoqtqV@@Gt GDSGnSqS@GttejPjqttttPttuutt tHHht ht 11hthtWW WVV VjSSSSS SCtpQVPXtptp tpj~SSSuut,,SSSnPv{S{}t}PWnRRuult+R+0t0?R?DtDSRSXtXgRgltPDSPSXt XgPglt uuXt?V?AtAXVXt uu!t  !R$%u%'u'tuutStStuuLt<V<>t>JVJLt;S>ISLMuMOuOtLYYiPitP^mSSSuut""t7Vt7HVWHLtWLtVWt>tdtd,OPRPRPRJiQmwQQQ$Q3[V/WWRetpemRmtpRtptpXytlytLtlRtlHtlHtLyWWWyVVuthth`thuyPPPyRYRyV[Vuut((tt" tt"t=:tJt(fRQRQRQ&ORQ.\VW&OVWtpN&t@Ot@T&tLOwtLwt`tdotdZpt\pR!t\!&ROt\W_tH!ROtHPVnP&PPPtDtDOtDtDPPOUPPRRPPuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt)u)Q 'S &Ptt~uRuR\\~uRu R\\~u XSX\u\~SYV\mV2W2BupBZWZ\up\~Wttuuu VVWupWupWupttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt&u&R01t13t3=u0<<<P@AtACtCfu@^^fRpqtqsts}up|||PttuRttuWuWuVVttqu33VuV``qu^W^`u `oWoqu ]V`nVttuuttuttu//uhu`hu`hupupWFWWhVjlPtt~u  ~u**Du Dff~u   MWMQuQ~W  JVJQuQ~VGSf~SttuStt6uPu P 6utt uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttu !t!#t#)uttu !t!#t#u EEuhuVVACPySttutt uttu !t!(t(4u@AtAHtHTu`atactcuttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuWuWPS7[QSSQ{QupQ !t!#t#u CCWuWuCVVttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nulultt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt'u'Q01t13t3;u@AtACtCKuPQtQStS{uPbbwQw{QPbbqSqwu wySy{u tt% uPuPSuPSuPPBuPB_S_uPSuP>S>uPSPSPSuuPuS*uP*NSNuP S uPSuPSeuPeSuPSuPSuP0S02uP2>S>buPbSuPSuPS% uPRuVGuGVuuVu?u?VuVeueV u VCuCSVSbubVu% VQ% uuuu>>CuCSSbub% VVu u  u % uyyuuVVuuuu*u*PPu++u u RReueu>>bubuu% uWWV(W*LWLW V RWReVeWVV>W>CVCSWSbVb% WPRP_cSnpPPSRSPDSDQPQpS*RPqPt|PSSCSPSP  SPRPRuSuaSatutSu S RuReSe% uW(W W]eWWQ)QQ9RQQ>CQSXQZbQPPPPPPPReP>~SSSS S&SNSCJS0 1 t1 8 t8 k up q tq s ts u t t u t t u t t + u0 1 t1 3 t3 Q u` a ta c tc | u` j j | Rl | Q t t u  S u Ptt;u@AtACtCaupqtqstsupupVu VputtuPttiu  5S5>u>iS  :V:>u >iVpqtqsts+upVu+Vp+u p+uS+S01t13t3Qutt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt uttu !t!#t#ruceQttuttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttru""rQ$:S=rSttuttuttuttuP !t!#t#3u22P@AtACtCSuttutt u PttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Quu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P(  &  Z4?((0 l&(R `F&l0hsx o6E.7 + o6E.7 n 0 Y o.7o.7  6E  6E."H6ENHmEN66EN6ENN_1oN.1o_J1J1JJ`m"1m"14)#* ()LVl()LVluEfn*z*(@Wfn*z*(@z**''&;&vVz**''&;&W9GKv)7kuTlF **W)~)(('(J''n&.'# 8**p)~)(((('(J''n&.'"#q"""c"!!!! p! ~ J-8n&.'-8n&'/J:Jc| @ t  [@   ^   z e x K o ^ .FxhhxFU.,  r r '08:[z)iz)szsz.CP.[i5'5s|2(200o0o --8MCMYx Yx jv;Lzz 8@%.8@%y`lBM+LQ +LQ#  # &  hMT'8 s # s # *PQrC*1Qr$CEP_r1C_r1CJQ @ZOZxzzpsxsxjxjx, , u+Au4A"  ?  " e / x } $ / x } d |  !  !    #LQ#LQ '[f [f'<A<A GOQ,["$Td##%%%0%m$$##}%%g&&&&.L/40K000//L//040//1111V22|3~3o22|3~322{44r5599 ?I?99'?;;? @i??? ?Y>>t=L>_<<;U<`>>? @`>>? @??>>>>;;??i??? ?t=;>o<<;;;;??i??? ?>;>=>==<<;;==??v@@=ANAGoHHHHH H=HHHHHLHoHIIJJIIJJIIIIIILJjJ~JJKLLPcPOPNOMNMMKKLPcPPPOONONNoNyN6NdNN"NMNMM$LLK L(KKLPcP3O[ONNNNMM9KNKLPcPDO[ONNNNMMPMMM;M|KKhKrK!#35BEsvLO`c|'W*W*.lNY`b`bz @ tev t!,etKT  yDf#+ |||Lp(,,, RT/U - `/U - z`p N {   N {  S  S/ R\l/ R\lFFu|NP(NP(BP'BP'*3*@&(&(*@&(*@*A$p\\,8KT`~X_r02 (:(:@O/25;/hp8X8L0DL]GI$9;57HO`d"*8 *8"8^8EZ^VXT8(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3>% Xto*v|u(Sb>CSb>C % bexXetoXeto3 L u*vCSxjX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)03"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@T1'1@1-2@2^ 5@?@F@M@R @  X@P ] fuur9~qsȹ-j0ԗ g~ (  G  <@@1@2@@@@@ @ @     @@(@;@H@^@ m$@ t@@ @ @@@1@P@!t@+@ @@("@J60@VI<@  [0@  gl@ shB@,@  @ @\@ `@ X@ @  @ $@ (@ 0@ 4@ @@ H@ t@ ,@ T@ L@ !<@ (D@ /@ ;@ H@ UP@ \8@ c@ n@ @ @ x@ \@ p@ @ d@ h@ @ @ F@$@ 3@;#1;Ch<@N<@O`>@XsK@@pQ@ U@l\@u^@Mh_@B n@@n@t%.;Tt@ GS[x}@o@}@ @e@JԦ@@ĭ@ &P@9̭@ E`@gVȰ@]d(@?oh@d@d@ @,@rȭ@ ķ@w@ @ D@@t @<(@)ȼ@ 7Խ@yKP@/V@eb@@s(@H@d@d@@ @@d@e`@q@@~ @@t *5A@OX`]@lv`s@P@ @q@I@+@RL@I@@@&@$|@T2@?X@YM@Ai@ y@ @(@>h@@@n@$@U@ @ @% @2 (@: @E Э@ J @Z @k 8@u @~ @- s@ @ H@ @ `@" @+ Hs@ @" @ @V" @t5 @;E @N @$\ @k h@{ 0@ @ 8s@ @8 @C  @ ܭ@ @ @  @  `t@@  %@/ 9 ? (@OU l,@2c k q { 3@  5@@5@L @  8@) D8@ L8@` 8@ @( 8@6 w@@ 4:@# X:@2 :@3' :@04 :@0@ ;@5K X;@ZT ;@:` ;@j p<@@z <@ 4=@@ t=@ $>@* P>@: >@C >@ ?@ @@ @  A@ B@ `C@( F@d w@ I@0 J@f> K@`V @@ _ @ o XL@` D@ @ L@a M@P Q@ Q@ R@n  |U@L U@5 V@O $]@?v(0;^@dI_@Z@ hH@ v$@ ,@  @ @ @ e@_x@x@`@0 #@  00@ 9D@ BL@  VX@ _d@ m@P v@H V@ @P (@ P@ X@ h@ t@ `@ p@ &x@ 2@D@@ PYcmz@ @ @ u@)y@>E@IN@ ejt@ @g$@`@ @@ @ @ @ @ @ @ Ȭ@ Ь@ 'ج@ ;DM@  U@ ]@f@as@ ~@ @ @ @K0@R@ @ @ !(@ 2@AIT@@ gs|@ @7p@' @ @ "@+0@7@#C@Q[fn@@ y@H@ D@ @@ L@ 0@EP@ @``@$ @@@#.:AHRbiz@+@y@ @ @ @ @0@N(f@,x1@A@ W@t0@\P{@zP@-@ @Qd@% {@B0[@T@ P@0xU@3@ 9@vUM@&o@@@h7@ @d@ }@@(@`,`@@@##@8 3@&HP/@"Q+@![@l2@@@$@ 0@O@ 3@@@@@L@ 5@ @"}@ Dt|@+['@o0@@U-@O@*@8@Hv@(P@%@0 z@i@$@9.u@rO@Y[@ o@wQ@^t@9@(Dc@@P/@@8@ 0@":@>%@Q)@ei@ x@p@ @ 0@hl@L)@ZlM@|.@@0%@I0#@f@Tv@W?@F,@lOLg@b@ hH@rH3@@@@@+P2@c2@2 @@@+x@l*@|=0@Op'@V\:@x@d @Z`@;@ @ @0@!@,A@M@E@I@ @ %&@ 8@?&@H|@}i&@ v@~ @o@"hl@K|@;@Tp@$@"0@q@ @ `@&`@k p@@7 @:9ho@=R@Z,@s@{@@#*@H@a5@@?@ *@@@ d]@D@ d@  @?# @/8 0@ J `@[T @X @u j@ h@ @! @ @ @ @ @4 #@r @ 2@1!Tf@&!p@43!@G!`@O!0@f!,2@#s!@u|!@/! $@!@!@x!d%@$!d/@!+@! @ "p@"@@!4"0+@]C"@R"y@%q"y@H"r@"PZ@"@"l0@_"@t"e@"Я@I"@" @#@~#:@.#@;@ H#+@0`#4@'j#PR@o~#@-#p@#@#S@A#@#p@#@ #&@ #|@>#|I@2 $@@/$p@&$@_,$@F$X%@ Q$x2@[`$ty@rq$X@B$@ $@$,@m$ @$L;@ $`@9$%@$&@5$(@ %DT@#%@@*%@ 3%Ў@);%P@O%+@f%-@z%9@%@j%@@ %P@3%@D%p@*%@ %81@=&0-@&-@)&ԭ@ %&@D&p@IJ&@O&c@ \&D<@ o&<|@&@E&`@!&@&@I&@"@&|@G&@ &,@f&L#@&@ '@0'@<$'P@5'-@3I'p@Vg'@z'@&'P@6'\<@ 'v@3'@ ' '/@\'M@'@G'@[(\c@+"(%@5(x}@QC(@ g("@w(@ (h:@(@(@( @z('@l(X;@ (PV@)@ )00@9)| @'),@@@)`@'M)@a) @ g)@)@#)@D)@)@ )L`@)%@9)@ )@)@F)H5@h)@@ *@ * R@.%*@@,*@ 6*0@ L*P@RQ*г@WX*@]*T@?y*ԩ@*:@*{@X*@ *Xe@n*@ *p@*^@*/@K*@ +L}@+(+8#@;+`@B+5@S+p@Q[+@ b+0@_i+&@+@t+@&+`@'+@+@2+@+@\+@V+.@6.@.@;.@.@.@.@ .@*/!@/u@n7/@=/@L/0@ R/@ c/~@~/@ /#@+/@@'/P@/@a/@/0@&/@0@  0@?0@0@!0@ )0@10@ >0@Z0@.b0`@j0d@Xu0&@A0@N0@@v0@>0@0@@0@)0 r@W0P@0@!0%@0@I 1@1@/&1`@41z@BO1@m`1@ j1@qx1(}@"1@R1@@$1@!1@@!1@m1x@1\@_1$;@ 2@ 2@G2@.@#2H@ ,2h@*C2@T2@Yb2@h2(@ o2@!{2@@2P<@ 2L@2@2t@ 2@@ 2]@2t@M3Ā@53$@uC3p@IO3;@j3 @w3@ 3@i3_@3@38@13@@ 3@v4`@ !4\(@P04@E64\j@N4K@Qb4p@zw4L@ ~40@d4@ 4@@45@jjh@I@Ee[^_F@ V^ZSPJZY5@j EKU @tEEPuu uf@l@U1ÐU1ÐUSf=\@y]f h@ƒt:QjEPR\@E8t\@]fH@uf\@̀\@=t..9t1`@xh2@h@N`@V..9u h@th2@PIN`@듍vUVSut e[^ËX@t NC9HuB9Ht=Ӌu\@t vVPh@5`@< e[^Ë R\@u 1e[^à vVPh@5`@\<1 e[^ËX@뮐USjÃtIu(ECX@X@\@u+1]à SH@]f]f EpuPh@5`@;1 ]UE@EVfUWVS EЉU)ЉEuT@t6J]A%9u2JA%9uX@t(J]A%9E;Ad@Ѡ@ߥf u$^_PS 1fǁc@ =d@d@vA9u}cQmE)ӍS0A)EgfffEE)B0A)UE0Ad@e[^_ÍvJA%9uE;AUe[^_à RM.ud@Ѡ@f} {Sd@USU@?t ?@Cu@[ÐU]Ít&'U]]u}CvMsUV tR@Ѓ@%=t&ftt]u}]!)믍t&@@֋~t11҃9Љw~N1)=@@A)AVF ޭޅttYPtOAtU@fP +PA +A9R @G@@]u}]ËVfQ맍v9 @tQ9 @t=tABAtA 1)@@A $ D$p@뷋A@륍'U0VS @ @@@9s։ D$ $oۉt11҃9ᆳމw1 AqA AA@@[^]Ív Ft&P|^~@t&9t&wv|.~5@t& @t&w0@vwv|ލ~@t&@@$&UWVSt&@@EEEMtы@! @5@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf1hfL QA UQEyACKGDGE1ҍY@@ڃt )ÃfCZ[^_]ÉE}tETF^05@E;11FKAA y]YEAGDGFE@GG@ GG@GxUGPGMHGDGE1@@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0FCP X9<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Í@Ѓ@%=t ftu@@1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUVuS] >t9u1ҍu[^]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]s&UWVS ]} &$Jju+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$hu<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$gHAEEs{xC{$~gEE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=ĵ@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$W1 f?[D$E`@D$U$luɍFD$ ED$E<$D$Uh@FD$ ED$E<$D$@v'UUE @U]'UW V`@S1ۃED$D$$D$ED$E$flt&߃ t;>t[`@D$ED$$ku˃1[^_]Í& tED$`@D$$kE h@[^_]Ív'Uu%$"@ĵ@%`@&@ =@uÐUWVS }1=v̵@t$$gt&9{u̵@t$$g$ƍ [^_]UWVS }1 v9{t+̵@t$$_gu [^_]t&̵@t$$Wg$ [^_]UVS̵@$ƋEȵ@Fȵ@11&@;Fw̵@\$$fu̵@\$t$$hE D$F$U^[^]h̵@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$j\$D$D$ E D$E$ []ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$ UED$D$ED$ E D$E$RUug@&@е@Ít&UWVS,EUMI=Ե@GԵ@е@ Eu&)ċE\$#D$D$$?hED$ED$C$E\$t$ |$D$$t&1 &е@\$$DdtF;~uе@\$$HdE;u|;~t)&k[V떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$v\$ƋG 4$D$fG $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1$;$3]u]Í&U(E uu}}]EEEzе@t`$4É0E{C<$|$ƋE4$D$*s \$е@$c]u}]%t&뙐U 0]Ít&U j0]ÐUED$ص@$fa1tÍv'UED$ص@$6a1tBÉ'UWVS }1]v<$D$et&ص@t$$`uԃ [^_]0$C$$ص@t$$`UWVS 1t&<$D$dt.ص@t$$b`u [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$d9E r݉4$dt$$D$&$d4$E rd$맍vUE]utoU1u ]u]ÍvE $%d$ZƋE $ d4$D$E D$WE tC$1s롸$ tE$c$E $c$҉CthtdE$cD$ED$$E $\cD$E D$C$ص@\$$R`ص@1$C$$U]]u$y\$D$$@o4$؋u]]É'U(]u}D$=E$a¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&H@eUص@$m\Ít&'UWVS,EEE EFEEE}&$aEF$a]]x;D$E$EED$D$EE$|$FD$]$EEEED$ص@$N\lED$ ED$E܉D$E$EE,[^_]'UWVSB^D$0,@$@ص@$u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$X`<$D$tt$<$8`4$.`UDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&H@獴&UU S]G) ʃ) 1[]Ðt&H@獴&UU SG,Ћ] ʃ)[]ÍH@䍴&UVSUMu t@@B@Bt\1ۅt.H@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@]uu%@1[]Í&$ti@B$2@D$@1[]ÐUED$ D$$1Ít&'UED$ D$$o1Ít&'UD$D$$@>D$ D$$@"@t&3@=@u@ U=@]]uu}} G~&H@&]u}]Ív tՅt4@@C@C @C @C1t@G@G@G  @G@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$@u@t$Ѓ1[]Ð1[]v빍H@ U$nÍUEwE]*t&]Í&'UU ~ÍD$D$ D$D$E$ 1ÐUS @u@tr@B@@:#@8@U::@D$@D$@$n?[]Ð @E @;] @}A@-t@@[]QA@-@ta7D$-U@@$Xt@-1&?[]Ív @t&y@D$E$2Xx:t,@@8u @@[]Ív@8uh @9E @PE:@@8:@D@D$@D$@$?U @@@bC @U1]É'U1]É'U]ÍU]ÍU]ÍUE$A<É'U}׉$]ÉuD$4D$G!$D$D$$L$D$t$$G-G1G,w, O0tAG0G]G@u@G}1] US] D$С@E$C^t[]vH@[]Ít&'Uuu]}} D$С@4$!t%$$]u}]Ðt&4$?tI$1@D$4D$<$BGAGG@@GH@농v'U(]]}} u$|$t]u}]Í&$D$ϡ@0 tԋG G\$ D$D$$kG0G$ 두U1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG@\$$ PuH@ [^_]$ҡ@;ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f@\$$lOnU;uݡ@\$$lO [^_]fUED$$D$Í'UVSu1N t&;0tk@\$$Nu$ D$_D$ߡ@$@1D$ ;3CC@\$$P[^]&'UWVSE}}Et[^_]1&;8t @\$$"Nuމ<$1ۍt&;>tV@\$$Mu1D$ D$D$ߡ@$@:UFF[^_] f뿐UOD$:@$@@\ÐUED$@D$@$@D$ g;@UE D$D$E$<Í&'UED$D$$;Í'U$@81Ív'UEu1}]$;tL$vQ$fw7D$F|$$Ɔ<$"]u}]Ív‰'UE$:ɃÍU]W:U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[CG$D$4$GuȋE$EF4$;F&D$|$E$=H\$4$Fuډ4$GfvD$Ȟ@$Jt$$lKftUcv|$E$F4$)t&D$E$=Ft xW11vD$xE$Ft@C$JƋCtrǍ&$6@JƉ뮍F$EE$EuE#&tcu :F/<$\mED$E$vEt8_4$\$I$9JƋGu/볍&|E$jFE[^_]Í&E$]D9|$E$E1>)E4$ v@UWVSG1ɉ‰EE#E$hEËE$CStdfuC.C E\$$_F11vD$xE$FDtXC$IƋCt+rǍ&CC뗐t&$6@HƉ떍F$EE$CuE#&tcu :F/<$tmED$E$Ct8_4$\$G$QHƋGu/볍&|E$DE[^_]Í&$E$mBD$E$ C8$@@E$(B\$D$E$5DaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EEH@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$(FҍUUE $T$E ÐUH@$9@D$ED$,ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$6؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$5؃$[]fUS@]U u$T$5؃[]Í\$D$ D$$ []Ít&US]$C\$$t@t$ 2[]Ðt&D$@$5ؐt&UVSD$С@$G@ wD$ D$D$4$5 Ƅw@D$D$V@4$$@D$ D$D$$D$С@$Y@[ )wD$ D$D$4$ Ƅw@ZD$D$2@4$6$@D$ D$D$ @$D$С@$i@ wD$ D$D$4$ Ƅw@D$D$2@4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$2@4$ @vD$V@4$ @*D$2@4$ @U1]É'U]Ít&'UE@1] U]wJ&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$Ut$u\$ D$y@F$GƉ]u}]Íu \$KS<$/C $/U|$T$$\$ D$D$y@F$ƋC $/뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$Z4$м딍US$]u$[]Í&Ct$ELED$ D$D$@C$D$Ë@ D$E$C $C$;E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$,1҄u뱍vC!C$辻뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$;$wt&tyvC!C$莺:vK9Crt$ED$ $sY&{Cft$ED$CC$sv'U]]u$ :U $D$T$ D$^$9]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$賿tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;(@v/$@Eܣ(@$)$@$) @$@EED$ D$D$@G$Ë@ <9}sE<D$ @D$E$C $$,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$_utRu4ttG!9u܍f]v֍ovɍt͉$v#G!9uIvvE<$ED$ D$D$@G$GË@<9}sE<D$C $ (t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$O5 )čt$<$559s@a<w%$@vЃ|+uf<$49rE1ۉ$4UT$D$F$+E$4t$ D$@$D$U$脴w t Nun1ۉ<$le[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$3$"FU$T$P3$&ËFCFCF C FCFCFCFCF C F$C%C$$跶D$ D$$D$C%4$?v'UD$@$@Ít&UWVS] D$С@E$~C$ D$@$N84$t$ D$D$<$uN@D$D$@$4$ $H@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$'31[^_]á@D$L@$%H@e@D$@$H@<@D$p@$4$ H@ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$@4$/]$t$D$ D$D$$O$f&'U$~ÍU,@tED$,@$,1Ð-,@uH@É'UVS1ۃ,@uu!&Ѓ,@\$$j*uu[^]U(}}EU u1]]EUt\$t$ $T$Y=EU\$t$ $T$<]u}]ÍUWVS,E ]E@E܋EuE@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$%~8$t 1҃[]f[]Ít&'UWVS$ 1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|إ@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&U(E Eu@EPu@ED$ED$E$LÍv'UE D$E$ÍUuu ]]4$9~tu ]]u]9u EUE $ÐUMSU AA[]UES4]EEEEu@]D$E ED$E$_x4[]ÐUED$E D$E$ÐU}MU EtÐD$T$ L$D$ܥ@@$U $]t$u |$KA9rS׃r9w)uD{t&$t$|$]Ít& {܍UVSE0uEE] EuD$E]Ev@ED$E$(x9v0[^]Ðt&UED$ ED$E D$E$zÐUED$@$Ðt&UED$@$1҅t $U]&UED$@$1҅t $U]&Uuu]u1ۉ؋u]]Í&4$u$t$ D$D$É$UFu u0]ÐUSD$ D$D$@$蠬t@ MZ$؃[] UED$"@$D$ E D$ÍUWVS E}D$@$U v2t&D$@$aU 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$ t<U$ Ɖ<$9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$||$\$E$\$4$ ËE$荓؋u]}]Í&'US]$n\$ D$+@$D$迫[]É'UWVS,]D$@$EU)čD$ET$\$$UE$zEtD$$Ue$譒$4@衭$)č\$t$$D$9@$D2EE(&D$9@$e܅e܉<$,UƍD)č\$|$$3/ED$D$tD$$$u$$ E\$1ۉ$<e܋EetjU$ƍx@#)ċE\$$D$U TE$_\$ |$D$;@$ét$Ue[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$D@$$D@$D$D@D$$D@UT$D$$$D@~D$q\$D$D$$D$ 荿[]Í&U($M@]uu}"4$D$L$M@$D$M@D$J4$$M@WT$t$$$\$D$D$$D$ Ͼ]u}]fUED$ D$D$V@$צÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$_@C$e$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$XD$$FFF D$D$$Ǖta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأH@EE؃<[^_]ÍvEEH@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$躔\$UT$M܉ $\$E$FU F$E] UMV~HU1fC D$CD$EE$聒MC K9}MƋVT$D$U$VF D$$ 4$ʼnUE ]u$tD$E$^$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-H@ [^_]Í<0Ctl@@\$$u$Ƹt>@@t$$@@>D@FD@FF t&F [^_]uH@fU @@tÍs@@@$@$@$Ðt&UVS@@t519pt#@@\$$u[^]Ít&[^]bf&'U(Eu]}t;${D$4$NjED$t.]Ћu}]fH@ލ&Et$ D$D$E $RD$|$4$茾څt떍t&U(Eu]}t;$˽D$4$NjED$Bt.]Ћu}]fH@ލ&Et$ D$D$E $"D$|$4$ܽڅt떍t&UE]uu}} #tEt$|$$蝽t]u}]Í&]u]}]ܼt&H@ÍUEt&D$ ED$D$E $нÍH@Í&UE]u\tVD$ ED$D$E $t]u]Í$uH@ӍvH@ UE]t&UVS u ]00 D$С@$0$ft^ErtDaDED$$t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$С@$(@H@됍&15D$С@$uLvEwfvEwE+D$@$v$諹H@UE D$RD$E$0ÐUS]D$С@$&t$:1[]f$蘥t$l1[]H@ːUWVS]$謬E$!ƋE D$@E$e4$P UP()ԍ\$CHCL$t$$6~\$ ED$@D$G$čtm3tNe<$;4$uU$xue[^_]ÍtuH@t&븍H@롍&H@ 뉍&H@yt&H@aU8}]] u}$謦$"t|txD$С@E$%ED$@<$ EUBU;BH@ E$U$H@4$t<$t؋u]}]fH@΍&H@딍&$D$@KtE1ۉ$t$ D$D$U$ 4$2lt&e4$}PUP,)ԍ\$CHC L$t$${UUC\$ ED$@D$UB$/tB&vt evH@ftuH@t&H@ 뷐UWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1UWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS@t1ېЋ@uX[bUngueltiger PPB! While reading flags on %sWhile reading version on %s%5lu %-28s %s while trying to stat %sRVadlv12-Oct-20081.41.3lsattr %s (%s) %s%s%s/%s.. %s: lsattrUsage: %s [-RVadlv] [files...] @-@-@-@@-@-@-@-@-@-@-@-@-@-@{@-@-@o@-@-@-@-@-@-@-@c@-@-@-@-@-@-@-@-@-@W@, ---Secure_DeletionuUndeleteSSynchronous_UpdatesSynchronous_Directory_UpdatesiImmutableAppend_OnlyNo_DumpANo_AtimeCompression_RequestedjJournaled_DataIndexed_direcctoryNo_TailmergingTop_of_Directory_HierarchiesExtentshHuge_file: COMERR_DEBUGCOMERR_DEBUG_FILE/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ A?CWDGET_ENVVillegal option -- %c option requires an argument -- %c lrwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert :/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createY@ Y@ Y@Y@ Y@ Y@ Y@ Y@ Y@ Y@ Y@Y@ Y@ Y@ Y@ Y@ Y@Y@ Y@ Y@ Y@ Y@Y@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZEd@@c@@c@@c@@c@@c@@c@@c@@c@@c@@c@@c@@c@@c@3d@3d@@c@@c@@c@@c@@c@@c@@c@Ed@Ed@@c@@c@8c@@c@Ed@@c@@c@Ed@k@_h@_h@_h@_h@_h@_h@_h@_h@_h@_h@k@j@_h@h@h@_h@j@_h@_h@_h@_h@_h@k@k@_h@_h@Gf@_h@k@_h@_h@k@Sr@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Sr@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@Rm@[q@Rm@p@Rm@Rm@q@__Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK Warnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt IO_ULINKlwIO_LINK zR| D'AB E<L_AB E @О@f@@@@@@@ğ@@@ 2@@@@@@@@ @@#@%@K@4@g@G@2@V@@s@{@}@l@@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@[X@p l@> @ D@(@0NX @` @9@3@@<s @! @"@&@)@!@+ #@g1'@!N2'@M7.@y<3@;>5@D8@7E9@0I;@0I<@9M@=@dN=@ nO=@VF@|FXG@X G@Y@G@\0H@`M@sm]@(^o^@Myt@}{u@}Pv@?hv@w@x@\x@x~@f{@@S@E@@K@@@p@A@@K¡Ќ@Q0@.p`@>!@-Ѝ@J @q@@§ @9`@ Fp@`@]t@r\@'o@_j^main[fgetflagsp ufgetversion!> piterate_on_dir Aprint_flagsf_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hookNhet_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#Perror_table_name?%errnoQinit_memory_managerfreeZmallocrealloccallocdstrcats omemcpy!memset"9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoul&librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerE)timer_cancel8timer_callbackytimer_register+rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*1nsyscall_psyscall_vN2agetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars77sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killR<Plgetoptoptargoptindoptopt+opterr=optreseti>chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat<DgetuidgeteuidgetgidgetegidGEvwaitpid,waitXwait_child_addqinit_waitpid0IxstrerrorYI=seekdiryrewinddirtelldirreaddir3closedir_opendir'MZrpcsend_messageNnyieldRnO,io_split_filenameio_get_absolute_pathZio_split_dirnamedVget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"FXnset_rpc_handler#Xyadd_intr_handlerJYa)vfprintffprintffprintf_putsn+fprintf_putc\}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#` Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6sm_exit2abortGatexit{exiti^o 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintfFMy0vprintfcprintfprintf_putsnprintf_putc8}{sprintf_putcQvsprintfsprintf}a_assert;h~]snprintf_putcvsnprintf!snprintfPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timer\dinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namexlio_seekV{create_shared_memoryopen_shared_memoryclose_shared_memory ysyscall_putsnqEmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6nwait_for_rpcv_and_wait_for_rpccKppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperdstrtollist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspnostrncmp¡ostrncpydstrchrpdstrcmp!dstrcpyostrdupostrlen(qQd__strtok_r strtok§omemchrrunlinkF=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatoaccess4t io_remove_linkio_create_linkr__udivdi3o__umoddi3fQ@@q@h"intXI5Lf7e~t](e 'eoy.Z%1H id2# 3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFztHI3)c-vl3d@@k@@q<b7IY+,3 6t@W@h"intXI5Lf7e~t](e 'e(e)e{(e1)e*e+e,3-e.e0sy.Z%1id2#3#pid4#.5# 7#8z#>9z#:A#4 /!"S###    ]4v4 ` a#q b#  c# d#  e# f# g# i# k# ( l#$ m#( n#, o#0Nt@o@2 eM^G OPmp@@Uelstn@H#3@@23u)c3i3U-@P@ }3@W@9{'de{9\|st~|i3 x6(@all83<@93@@:eD@;3H@<3L@=3P@ Y3( '3b7  8 IUX@l@kh"intXf~t](O)O{(O1)O*O+O,3-O.O0]yv4`az#qb# c#d# ed#fo#gz#i#k# (l#$m#(n#,o#0o7*3X@l@ e) G ) buf+ A\[@   Y3 Ul@@Gh"intXf~t]yo(3l@@e''kd ?3l  U@C@h"intXI5Lf7e~t](e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4 /!"S###   DIR&K3@C@88cdiriKde]dep]3len3ret3 >3]8] V C =. UD@&@Poh"intXI5Sf7l~t](l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K   O###  % 5D@&@f4G 4]4l6:fp78: V dd/a@@[1 IS(@X @!0:oh"intXI5hf7~t]( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  :,    v  %2(@4@" 0E0vfmt0t1% %   %8E_4@X@N_-DzxF  6P_X@l@xQl@ @"EvMfmtt%%9 @X @96E7vfmt8:%8F k<.@d SX @ @oh"intXI5Sf7l~t](l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4Kz  0#z#.:#    % # #   l [Q:X @_ @% p\:` @g @Q5?Fargh @a @}?fn?tmp? fd:G :):ad @; @H ett el el2a< @ @e 0et el: @ @ Z9e @ @ Eda! Af:tletga hatphi:cpj? ! @"j @r @msg#%$% H3d@ H:\@ S0`@ V& Y:'5T@'6X@  S @ @o7]D%int> @ @ num, chI iI p= % % ? @@ % buf@;{ ! @ @7H@int K@3@*h"intXf7Z~tvyZ](ZIJ#K#Lh#"Mh# Nh#OM#@OMYM#ZM#[#\Z# "]h#h^h#s3z3  s cO nz i3   ptr3  3~ d s1 s2d nzOkqkxUxjqoZ  s c3 nz i3b@@P @@| ptr minM maj -)hR S6@;@`z@@m@@~@@p @(@hh @@!V@X@ Z""h #sth maj  @@@$0 %mX~$p&9>`@@='h=zi.?3@apA9)BhbmajCminDMZEMS"Fzf`~@@ZS@@P`@@`@@p`)Dh `A@F@L<@T@)h5&@@Sp'"zptr;minM7 z).hS@@0`@@m( qs.$$7BM X`@@i`@@^&% @3@3' z_'" z73p ~@-@@-@)R*b@*Ac@+,eM,3*f3@* g:@*h:@*vk:@*l:@*m:@-q.A @@|@ h"intXf~t]#@@|@s""$o  !@@ inth"Xf~t](OA@@(:T*:tF :ddstBsrcCtDdj/}@@   o   %4 @@Y h"intXf~t](O=#AD%Oy< @@:&c0:3hF :d t=d c?z" dstAK o5b@q@ h"intXf~t](O#d@)@s""dlen$d  o ~/0@@ Cn.O5s.CU.O st0IKi1Oy;O t5O YY ]@(@ str5Q3]wF 3 c0@7@str"!3@@I@1s1s2P@l@ɸBendx˽]̽_ͽ^neg3Z3out@ ! C p@@ end 9!@@KendEV@@BDnJDD3FVbnegG3(outR@3 @C@Hs1P@q@t1J3y! Z @>!@ h"intXI5Lf7e~t](e 'e 0Zzo y , e-# .#  /2 k@@jZjZG jgil3 qZ  rZup e @ @? U dAk  dA F4 @ @ 4N E  EG GdiHZ :HZ   9!@>!@!^i:Z6ĵ@ 4@  1@  " 2`@H Z @!@"@2h"intXf7Z~t](Z'(#")o#  *zo  & '# (O#   a@!@!@>!2  `Oj!% b2ic3!  O!@"@!y  NO!% P2iQ3" ,O "@"@4" +`" +Oid-O" 52"% <2i=3" #̵@ $Oȵ@T2 Z #@'@h"intXf7Z~t](Z 'Z 0|Ooz 3 pid4O#  5O# A 6o# 7z#  8 '$ (*# ")o# $ *Ao M tpids| sO:u3a v r #@Z#@"pidp| pOa q; b`#@#@"pida| aOa a3c S#@#@#gpidQ| QOa ROX C#@$@I#pidA| AOlenAo B;  A$@,$@u#* 0$@y%@#{pid|#J ;#A o $ ;*$ OV$ {a K(g\@rt$}A H!9 1%@%@$pid0|J 0;A 0o 0; "a 2!{ ;%@%&@$#pid|$$J ;$$A o%$ ;?%%;_%%a r%%j O%& 30&@&@%pid|%J ;%A o& ;$&3D&a b&&3 O&@&@&ppid|&J ;&A o& ;'O7'a ߉U'' L&@'@~'J|' JO'A Ko( Kz6(a M NzV(( 3OԵ@) :*( .е@0 u '@'@Xh"intXf~t]o '@'@i(  '@'@(|0 '@ .@h"intXf7Z~t](Z 'Z3pid4O# 5O#A 6o# 7z#  8 o   '(#")o#   *y(Ve)#*#q +1  '@'@(:3( ͙ V  '@(@ ):39) h C (@(@Y)eB)iD3) E (@)@)de*i3.* L* :)@+)@j*e* * e0)@)@*Pd*"do++hc+ j 3)@+@+_e++& 3, 1,)@I*@^   3 +@g+@O, {,3,G #3p+@,@,str",sep$,h .o -e/: 3,@%,@)- N \0,@3-@U-!pidZ|- ZO-"Zo" [z #a ]zud# ^ouh# _oulz _o-$i`3up a  6@-@ .@-U=|.-@.@ AU.-@.@>C3.eKLQ. # -lص@ %Y3 .@3@Kh"intXI5Lf7e~t] 'ey  #A  e    3  #r #D 3#0   o 3.@Y.@d.s s. 3.  3`.@.@. s(/ 3^/ &3.@.@/ % %3/  >3/@/@0^=3.0 =p0 =s0i?31 os0@_0@?1) nsk1idpZ@ 3`0@0@1 s8 30@0@1 s 30@!1@2i43 301@ 2@12csig3]2 c2oldr2 i 1 2@g2@2 3+3 z x3# H3p2@2@3 G33 [4 g2@3@-4M {3@23@Y4< z34 k3@3@3@4w pidjz j34G! +w@! ,@! -@ "Y3L. 3@5@oh"intXI5Sf7l~t](l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % 'C:3@5@4 @:(5 7Ax5 Ba5 oliE?$6=D?@  ?8 V4?@(1: @C2:@ 0:@ 3:@ 5@8@h"intXI5Lf7e~t](e 'e(e)e{(e1)e*e+e,3-e.e0syv4`a#qb# c#d# e#f#g#i#k# (l#$m#(n#,o#0o.Z%1p id2#3p# pid4#.5# 7#8z#>9z#:A#4]4|  a435@5@M6 x 3 3  `C35@5@y6 : B3 B P35@5@6N x  ޾ {36@ 6@6 x    J6@6@6 u  3 6@76@)7  ̾qR3@6@7@U7DfQD7WQJ7posSs7   37@U7@7: 37WJ8fD^8 vy3`7@8@|8 x x8WxJ9z379: {D`97@8@dir ~9 | 3 8@8@9x 9WJ :3@:fD^:v8@8@buf}g(@ Y3 8@8@Dh"intXf~t](O)Oy#d8@8@|:)d8@8@:/o8@8@:5o8@8@;e 9@;@h"intXf7Z~t](Z 'Z'(#")o#   *o y  )  pid*|#+ #,3# #BCCpidA|iC3DC nvpidm|io3pC7|9@9@,;&pid|X;&;3;C<9@;9@#.1<7I9@9@VaO<j 3|:@#:@m<X&T0:@:@<pidS|<VCoutf:@H:@d:@V#.<7:@;@=qpid}|:= }O}o= ~z=C= K#.=7!(#@.=7"29;@;@>#0@ $Y3`S ;@<@h"intXf~t]oydJ*r;@<@B>?)3+@d ?  <@9=@h"intXI5Lf7e~y8wt](e 'e0~y.Zf/A%1Yid2#3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> /!"S### _  DIR&l%"e&"#,!'#"(l#)#+*#+# _2 -t<@"<@n>sdirssAs~ i0<@S<@>dirhs]~`<@v<@>dir\s^C'<@=@>'dirBs?D->?J\?P'? w 253=@*=@?_dir4s*s0=@9=@?e) _Vu @=@=@h"2>intXf7e~t]orpc"@=@[=@@pid!Z2@ #ZP 2>`=@=@Q@Dpid0Z}@ 0Z@  0Z@len1Z@ 1zA 33P :Th ZT Du =@=@zh"intXf~t]o=@=@2A( 8=@F@h"intXf~t](Ooyo'(#")d#  *  &  f Z -/ 1&2#3#5&# o6ppcwd}Ivr3 p.pcwd}Ivr(3i)3FvDlenEdEEIGv oci=@?@^AhAhpA7h3AjugposkArluhmulInvQBhQwdoB !!!!"#>@H?@(!!!!"#H?@?@[!!!!"$?@?@!!!!" %}@@@@C&-CIv'~pMC(0@@@@'}kC'F dC@pi3&3Iv)U:d9p";di<3I=v_]pH]}D^ib3Icv%@}@@tD@CZ&CIv*~pudr3'"d!D'u}4D+6A@eA@r!C,N_D"Y"d-|(!@,rD,D",D,D-!, E,))E,4IE+@C@pC@!!R"^,jrE"t.~C@ D@!!!,E,E/}D@F@E&E' }F*pul'"d9F'IvWF-@8+!RP"^,jF"t.fE@E@-!!!,F,F"u F@F@h"intXf7Z~t] 'Z(Zo'oF@F@F pid(oG8oF@F@G pid7o 9oFGVoF@F@YGm TO uidTz tT Uo pidWoG kF@F@GzF@F@G {Gh#u G@G@!h"intXf~t]oG@G@H; #u G@3G@bh"intXf7Z~t]o! G@3G@/HU  O]5$Ry@G@"H@!0:oh"intXI5hf7~t]( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O :  O  O  :4   v# H#arg#l##fp$## k+4O@G@{G@[Hfp3#:3ap3%t5 t\6h,<OG@G@Hfp;#:;ap=%A>OP/OG@G@H%arg.%H.Hn.O5I  (OH@"H@UIarg'%c':Ig%y0H@L@h"intXI5Lf7e~t](e 'ey.Z%18id2#38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3 0H@TH@IYo`H@uH@I3H@H@I  d3H@H@$J,c3PJH@H@cs>u{!8H@bI@JP8Jpos3Jc3Ko3pI@I@$Kc3PK I@I@cs>u{3I@J@K neKstrYK{3 J@J@6L7strYbL/J@L@L~0L1~~"2zL>V>V) @$@b%@&@Y3 'yM@]@-h"intXI5Lf7e~t]o(e 'ey.Z%1?id2#3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z# 5Z#A 6# 7#  8a 7id8#9#o:#;Z# ;<?Iid@#A#oB#CZ#  DI# AX \EOyidP#QcUidV#W K  z&& zres {K# |#%F  V2%"13E %M@M@!Mc8M@M@MM3 M@1M@yM u_3@M@IM@Mx ^3PM@1N@M_ MH?aN3N" 3_ ?out8sM@ ;R3@N@kN@N Q8M3pN@N@N LHL?"LG3N@N@'O FHF?tN@O@SOsrcOOoO OP$P  7PwO@O@ UP  A  X3O@HP@hP7 P"P3PP@P@Pu Q yp!3P@DQ@JQ" vQ#ZQ*hsPQ@Q@Q gQ npos8R wXR nN3Q@ZR@vRd MRAMsRM3S$#`R@R@0S R@S@\S SSoS TbTz83T@RT@T:%str7 7O%3`T@T@Tc$3T $&ch&zu{U3T@U@Uc3DU zU E!U@eW@U "PU" V"oXV" V#(V \'  >W"QW()'  *W",W0V@W@*i3W+ EF3pW@W@W  EW,cGz.X ]?W@X@NXu P\?zXF \3X \X,i^3X,c^3Y!KX@Z@,Y "x JXY"JxY-L?up.msgR +SE*iW3Y# ~Y# Y/+3_ z 0Z@Z@@Zl3[@\@lZ 0kZkZ Hm _n\o,srcqZ,dstx[/0F 9[ A 1!}\@]@W[M "["["U[#e[+V-M- @-'.Z$@-/(@282 Y3)Iy]@^@"h"intXI5Lf~t](Zoy'(#")o#  * e]@"^@\ d3C\ msggd J hzVi,A, 3\E0^@D^@b\BM3P^@^@\s Lus 1^@^@\ 03\^@^@i43] 5u P(,@Y3 +.y^@t@#h"intXf~t]!q{o3 d {3 d 3 { 4  # H# argd#]"A!b 0 U3:TOV{"! !  ,!# ]#}'|buf|+|O2V^@T_@$]%1VP]k1O]|1]3Vrem4OOL`_@`@].KV^bufK6^KOb^KO^pMuXN.u`OV^ PO^|QOup 3 `@G`@^mtm_c{C_3P`@`@y_tm__n3_Pi32`3E` 53`@5a@c`!8`":3`#-@a@pe@`!:,`$ap,fyb%.ud"s/3c%:03ul"03+c"03c"13c"23d&i33bd#k3pe@t@d !tmd!:d$apfe&tg"3i"G { j" O k"+!OIk"F "Ok"_#Ol'$O"%3m"&n(t?pe@)p&ret23en) &ret=3n)'"n) &len3-o&pad3o)e&ret3p*s@t@&ret3Jq) &ret3q*f@f@&ret3q*Ws@Ys@+ret3P)8&ret3Ir,t@t@&ret3r, n@/n@&ret3r*\g@g@E&retX32s)P-bufl %m])&ret~3qs.}/0s1]) +buf "3Zt)8 &len3ju*rt@t@+ret13P*Rm@m@!&retH3 v*p@q@?&ret 35v)hY&ret#3iv*pq@q@w&ret?3v*q@q@&retC3v*q@q@&retE3w)&ret-3.w)&ret3w,t@t@&ret)3w*Wk@|k@ &ret^3"x): ":@x)T "Vxx*Xn@tn@r &retS3x&retY3y)0 &c{SyP&ret3qy,l@l@+retc3P2{ 3 45{6 B,-Syt@u@'!0:oh"intXf~t]yO :O O : 4  # H# arg#l<Ot@&u@yc:;ap;%]=l-CO0u@Ju@y:BapD%AEOP,OPu@u@zarg++?zn+Ouzlen-O%Ou@u@zarg$c$:z.syu@Av@'!0:oLRggn:int {gng : 4  A# Hp# argn# ]  H!# " #:~@&gu@u@zKarg%Kc%:j-gu@v@"{H,N{:,y{ap,%{t.lM/`A0g{k<g v@Av@{H;:;ap=%A>gP0yPv@v@(oh"intXI5Sf7l~t](l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K 'Pv@v@{ %$| : %O| %:z| }&:|  % 8 Vz0yv@w@(h"intXf~t](O!|o3 o 3 o 3 4   # H# argo#  "W H#W# $d# %d#)3v@v@|arg(|c('} C3w@[w@i}!HBW}"Bd}:B}apBq ~tD dEXAF3+~U3`w@w@>~HTW"Td:TapVqAW3P1yw@x@[)oh"intXI5Sf7l~y8~t](l 'l0y.af/H%1`id2#3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %e&#,!'#"(s#)#+*#+# %  -$$!! #' l -%*:P )!w@w@j~n3Cw@w@~ B'~ D~ w2w@w@DPw@ x@,? O'XdirQ!xw@ x@Q)e2x@x@SD>: x@)x@ =!A==:00x@x@ /!5$ J3 u x@x@f*h"intXf7Z~t]oS!x@x@B  O  O3x@~@*h"intXI5Lf7e~t](e 'eo 3 pid4Z#  5Z# A 6z# 7#  8y NHJE eKE# ,!L3#@ Mz#D NU#H U? Adv3x@y@nrres3a 3y@:y@ˀdev"z@y@y@Stؒ#)SCzcpos3'3y@z@t́3uppos3   z@z@t3Jsupret3) %Cz@z@]QeBlz@$}@;cmdk#k3pidm#pzuhq;rulzWwzj Jh}jYdirizڃh J Y h wX0}@}@W3aYmsgZ81}@~@/e0a2msg3 \N~@~@[pidMo5~@6@B,h"intXI5Lf7e~y8wt](e 'ey.Z%1Cid2#3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#AJl#K3# Ld V .~@6@ - A-l -3 /d.6u @@@-h"intXf7Z~t]D%zo/O@@S@6"O idObz`@s@u idO o  @@ idO6Zu @@-h"intXf~t]otdL3@@nOsniH7su @@-h"intXf7Z~tvyZ]$hD%o&'#a(z#) ! " O G  O ptr" @@ .  hf1@.@8"0OG 0O ptr22p70@K@d"6O76OG 6O ptr8G3P@l@3F"FOHO Up@@φT"TOb8u @@.h"intXf~t]o@@ @@'87@@.h"intXI5Lf~t](Z)3 'Zo `$  .  ) ,!*# +z# len,o# /& num0o# 1&#5 o4z ppb5z# 6o# 7o# R8o# QoldP.PoPonewRA{>b?5Y@@SYppbzȯAolenooTi3Q 3 @v@rppbzoɈi3R3@@+ppbz(oS)+3 i3Qarg 3sb3b`,!`alenao [co :d3newe!"""!#$?3bshm3 "opi3 3 Az  3@P@9)9bshm3p9I%& #%10 "a"V"K"B&X 'lr#w#()@@k"""& #) "& ##'''Ί'#?#P@@*: Ţ)9:shm3Zretȇm+Y3:Jb@@?0Z4AAc3Aintj9Adc8A: AcA*Ac)AHAcGArMAcLAd@@vb%A@@c$A@@؋; /A@ @:ec.A%@$@f7H0@O@ZR>AP@~@ c=ACA@@  cBA5@ą@TЅ@@3zRA@$@ cQA؍ @@Sv 1 H@"@S BWA0@G@ cVA#\AP@e@B c[AnaAp@@ c`A;@p@0h"intXf~t]#]@p@؎str"J""3A$]=%3q&\'3Ȑ o Y3><.|p@@h1h"intXf~t](O'(#")d# (##$o#  *q bNp@@ M  LVd@@<7 Uh @9@ ֑ :3Rn3_ o@@[@  :3Ԓ:ݿpo`@@H3:3i o:& (ȓ o@|@ (o^?B@@| A @7@Ӕ'  :35 om@7@ $h@@@͕n g go;Im V6@@[7+0@,34@5-8@=@z@s2h"intXf~t](O&zy%d@z@s$$Ӗs1* bit+o tbl,Lidx-3  o og>@ˌ@2h"intXf~t](O%3@ˌ@$s1#Ps2#n$do>Ќ@!@\3h"intXf~t](O*Ќ@!@ۗdst)src)In)d d,Qs-R o  [? 0@^@3h"intXf~t]+0@^@˜p*ch*3c,Qo?`@@3h"intXf~t]*3`@@-s1)Ys2)o.@2@͍@:4h"intXf~t]+#@͍@to"&"$o @;Ѝ@@v4h"intXf~t](OD&Ѝ@@0str%\len'dK( o  9AP @>@4h"intXf~t](OY$d @>@str#ٚs%R oMA`@@@%5h"intXf~t]u2@@@s1$o11ԛi3 tok3*c43^sc43q @ o   `@@ s_o_a<@B @Y@5h"intXf~t](O) @Y@s&ܜc'3n(dV p+R    A&C `@i@5h"intXf~t]yo'3`@i@ux 'k9CP p@R@6!0:oh"intXI5hf7~t](^" '*,Oy.v%1uid2# 3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * /  f  '  (# " )#   *'8 (8#fd)O# +O# =,O# dupOp@@kfdOO@@͝fdO7OO@)@fdO%iOg O0@:@fdOcmdOOoiO@@sap%argO@@ap%argOPO@@@) O8U\i]O:@K@ y~8P@@ݠ7fd}O !iO=@\@[fdObuf";ǡ"A#: 8#H=ret[ $`@ @ZfdObufТ";"A#: 8H#Hfret@@fd~O٣"A~"~OF#: 8wf@ٔ@ fdeOHe"e#: g8-oH@a@&fdGOR"HGr""G#: I8#-Q 8p@|@6%fdO& ':.O@$@bx G O(lnfdOF#: %8o) af 8h@@|f8*0 f8ߧ+:,-:O0@R@x 99(0@@ (3OD@.68.b78.88. YOE `@@{8h"intXI5Lf7e~t](e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K &3`@@J %v%3f)èH dir-  V dY3FI @[@R9h"intXI5Lf7e~t](eo 'ey.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z? [# \#^z#e_#  aa `dc d#fz#eg#  ah ! 3@$@ +3 ?uls ?Ω@h z"z(H   V  a  330@[@<1h 1 2V43vU 56s G?r H?@0 ͙@™@@[@mzڬ"nzHo r  a Y3G  \@@:int~]ohf" % ,*!X)!t9!1!"!I! !! low`# `#  s llv ! !M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k?!_\@@n^Ed^e `A7- LWbmx"d=[t`@@@@KI  @@;;int~]ohf" % ,*!X)!t9!1!"!I! !! low`# `#  s llv ! !M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0kX!S@@uR:vRwT VA7- LWbtPmxZzDZ)]p@@T@@ز% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > &I : ; .: ; ' @: ; I4: ; I4: ; I .: ; ' .? : ; ' I@4: ; I1X Y .: ; ' I@: ; I: ; I 4: ; I4: ; I 4: ; I? < % $ > $ > : ; I : ;  : ; I8 $ > .? : ; ' I@ : ; I 4: ; I : ;   I &I4: ; I? < % $ > $ > $ > .? : ; ' I@: ; I  I&I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I.? : ; ' I@: ; I: ; I 4: ; I4: ; I4: ; I&I' II% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ >  : ;  &I .? : ; ' @: ; I: ; I4: ; I4: ; II!I/ 4: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > .? : ; ' I@: ; I  I&I% : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/syslsattr.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hstdio.hstat.herrno.hgetopt.ht@A yXg%pX4oiwh$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ9 strcat.c@@"?8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h @;fr<z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h@!@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h #@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c'@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h'@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h.@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/ ../../../include/arch/i386../../../include../../includegetopt.cstdint.hstddef.htypes.hio_struct.hstdio.h3@xf #C;  3I;g4).Y^l iWXvgn%y( P p ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h5@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]9 ../../../includeuser.ctypes.h8@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h9@i+hC ../../../include/arch/i386rpc.cstdint.h@=@!X@Kxx< [3 sleep.c=@=xM ../../includelost_path.ccollections.hstddef.h=@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hF@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.cG@=gP ../../../include/arch/i386add_intr_handler.cstdint.h G@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h@G@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h0H@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h]@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h^@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hPv@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.hv@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.hw@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.hx@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.hx@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h@@?Dx ?Dx =3 puts.c@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.hp@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h@$>9LV2z Z: ../../includestrncpy.cstddef.hЌ@)Xg[ye_; index.c0@*\ strtok.c@@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h @(JgKwp@6 unlink.c`@&?^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.hp@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h\@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@AB DG. 4p@sAB DG.\.\.84@"D  F AB D_..R.J.\.(4@OAB Fk.S.Z.| X@AB |  l@AB |  L@AB FE.|  D@AB Fx.| (@ AB G.4@$AB X@AB (l@AB F].].O. @8AB ].| dX @AB d` @AB (dh @AB DY.\.j.W.X. dd @AB BV. d< @AB DB.N.u.d @AB J. d @AB F.| \ @9AB A| @AB @AB FI@AE E`@?AB F@VAB F@3AB D| T@@<AB AD| @AB F|  @AB F| @9AB 0@AG F@hAB B0@AB @@ AB P@AB Fp@ AB @ AB @oAB F @#AB P@!AB |  ,@vAB FIF, @AB  , @AB AFF,!@>AB | @!@dAB F!@oAB F "@AB E| , #@:AB D,`#@1AB ,#@1AB ,#@0AB ,$@AB ,0$@IAB F,%@AB A,%@AB ON,0&@YAB X,&@YAB X ,&@AB IFF| |'@ AB |'@AB | '@&AB '@'AB  (@AB F(@gAB AG)@AB 0)@AB MF)@_AB L +@GAB FFp+@AB L,@AB 0,@AB F@-@AB F| 4 .@IAB D4 `.@IAB D4 .@IAB D4 /@AB E4 0@_AB D4 `0@%AB 4 0@%AB 4 0@aAB  4 01@AB MFF4 2@WAB D4 p2@qAB D4 2@AB 4 3@"AB 4 @3@IAG |  3@;AB D|  5@AD  5@AD  5@ AG  6@ AG  6@ AG  6@AB  @6@AB FHE 7@EAB D `7@AB FI 8@AB IFF|  8@AD  8@AD  8@AD  8@AD |  9@AB C :@#AB  0:@AB E :@AB F ;@&AB | 4;@0AB | `<@"AB `0<@#AB ``<@AB `<@AB IH`=@AB `0=@ AB |  @=@AD  `=@DAB E| X=@ AB | =@7AB C@@AB F@@AB FD@AB F| F@ AB F@AB F@!AB DF@ AB F@ AB | G@AB |  G@AB | @G@;AB G@!AB G@JAB IFH@"AB | |0H@$AB |`H@AB |H@ AB |H@NAB D|H@AB BF|pI@NAB D|I@\AB D| J@kAB D|J@jAB H| M@AD M@AB  M@AB @M@ AB PM@AB D@N@+AB pN@-AB N@.AB N@AB FKO@xAB DPP@aAB DP@AB FFPQ@AB DQ@zAB D`R@#AB  R@fAB IFFT@RAB FF`T@EAB DT@UAB FFU@UAB FpW@RAB DW@AB IIX@6AB CZ@AB [@AB I\@AB F| |]@bAB E|0^@AB |P^@GAB |^@HAB B|  ^@dAB FLG`_@AB F `@'AB P`@AB F`@EAB A@a@0AB Fpe@uAB C| t@6AB 0u@AB Pu@@AB FFu@AB | hu@ AB Dhu@OAB Gh v@!AB | Pv@?AB |  v@dAB FGGw@[AB H`w@(AB | hw@AB hw@0AB hw@ AB hw@0AB h x@ AB h0x@`AB FF| x@AB | @x@QAB A@y@*AB @@y@mAB F@y@mAB BC@ z@rAB FI@z@7AB D@z@DAB F@0}@AB D@}@AB PF@~@+AB | x~@fAB D| @@AB `@AB @AB | @AB | 0@AAB LF0@AB 00@AB 0P@AB 0p@AB | @ AB @ AB | @lAB C @VAB C@jAB F@`AB FP@HAB L| @AD @AD @/AB @AB @AB 0@AB P@.AG @/AB @AB Ѕ@AB @4AB 0@AD P@AB p@AB |  @AB F| Tp@AG T@!AB T@yAB HFT@@AB  T`@AB FFFT@lAB FFT@)AB DT@AB MFT@@OAB DT@!AB | @AD F| @KAB DD| Ќ@QAB B|  0@.AB | L `@>AB A| | @-AB A|  Ѝ@JAB FI|  @AD |  !@@AB BD !@"AB | X! @9AB A| !`@ AB | !p@AG !@AG !@yAB C!0@ AB C!@@AB F!@KAB !P@RAB AF!@AB O!`@AB O!@tAB LF!@IAB !@AB L!p@ AB !@AB E!0@"AB | x#`@]AB D| #@dAB F#0@+AB JI| #\@'AB E| 0$@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutdir_lenst_inoprogram_namelist_attributesd_reclenlsattr_dir_procd_namenlink_toff_tgid_tprivatest_blockslsattr.cst_uidblkcnt_tuid_tst_atimeerrnoGNU C 4.2.2pf_optionsst_modeoptinddirent/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscdev_ttime_tst_nlinkgeneration_optdir_namest_ctimest_rdevverboselsattr_argsdirs_optgenerationst_blksizest_gidusagestderrmode_tst_devblksize_trecursivemainst_mtimeino_tfgetflagsnotsuppfgetflags.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/e2pfgetversionfgetversion.citerate_on_dirfuncmax_leniod.cfirstlong_namelong_optflags_arraypf.cflags_nameprint_flagsshort_namecom_errnew_procreset_com_err_hookcom_err.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etpvardefault_com_err_procerrfwhoamierrcode_tcom_err_va__builtin_va_list_et_dynamic_listtable_numadd_error_table_et_listremove_error_tablen_msgssafe_getenvoffsetdebug_maskdebug_fet_list_lockstartedet_list_unlockdstrerror_message.cadd_to_error_tableinit_debugerror_messagebaseoopsnextnew_tablechar_setet_name.cerror_table_name/home/tyndur/tyndur/src/lib/stdlibcerrno.cdiffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountmajSizestrcat.cstrcatsave/home/tyndur/tyndur/src/lib/stringappenddst0memcpy.csrc0donememset.cu_charu_intendptrpositivedecimal/home/tyndur/tyndur/src/libitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumoptargoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptumaskmkfifostat_buffchmodinode_numlost_statmknoddevicefstatstat.cstatuslstatmkdiruser.cgeteuidgetuidgetegidgetgidrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpiderror_codestrerrorstrerror.creaddirio_direntry_type_tuint64_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirsend_messagemetadatayieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsretvalputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdinio_resstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadoriginshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexsprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupinit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.cisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigitoverflowstrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrncpy.cstrncpystrchrstrchr.cstrcmp.cstrcmpfromstrcpystrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrunlinkunlink.cpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initfdl_elementfdopenlseekpreadfd_list_elementF_GETFDnewfdfile_flagsold_posposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdaccess.caccessio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuut P RSTzSS4Ttxntx&ttttuuotP.S0MSOmSptutzQz{u{}u}tpqVpqNSNgqgSP16P@sWuut@SDJSPSt  Puutuutuut@@tt9@V@DPDVPVD]PPG]RBWWWuutWtWtW**]t ]bbt t tVVV&tptpuu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Sttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0Ptt<u<Q9S9<u ttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu tt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qtt uttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt]u,S,.u.JSJLuL]S&P.8P:DPL[Pttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P*3*@&(&(*@&(*@*A$p\\X_r02 (:(:@O/25;$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)038X8L0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@l' @ - @  5@\?@F@M@R @ X @ ];fOuv!J;d$0?b!f`\ <"  ?@@ @ @@@@@ @ @     @@(@;@H@^ @ m$@ t@$@ @ @P@@@P@!t@P@ D@ (@ %p@s1@@ :@OJ<@ NL@ VH@ `lz@@ l@h @\@ `@ d@ @ @@@@ @ /@ 7@ A@ P@ Z@ f@x@ ĵ@ ̵@ ȵ@ #@ #@0$@I!Ե@ 8=Gص@ S(@g]f@  n@ v2@0@a@ @ @ @6@@ @ :@@@ #)1==@7O`r @ N@(@ $@  @ ,@ `@E%,3CJYhpx@y0@ 4@ 8@  <@ '5@@ =D@ E@KVP@Rajvv@a@0H@N@-x@Q (@#@0=@ 0,@9@Z@@`@@"@!%@!8@(0u@/@ 6u@O?"@R%@a@pT@Uw@@O0@%;@08@0&@Y`w@(D@@@X@6@ @hF@~@f)@ 5@@lH@ "P@*8@2@:@N@+EH@J0@+Y@@k @Vx@!@d@@W@H@ @ @P@@ PM@!@o<@"0H@$0@" ;@& J@k @ #@:1 Ѕ@9 P@A 8@H 0<@#R P@H] PP@ab `@?i @M@ p p@~ @ Pv@? w@[ @=@ P@! @ 0@ @4 @ <@ pe@u @/ O@x 4@$ @@ @ w@. p+@5 @_? @tE .@IO \@'Y pN@-c 0^@i u@u 5@{ u@  @/ 0@_ (@  `@ @ @9 @@ [@ @ J@j @3 y@* @  @( @)5 T@ > @ID 0@I 7@EO G@!W @3@I\ }@r @ w@0 @@< G@ $@ t@6 5@  +@G `@ < @ @ Q@z @l, @ 3 @9: `@'G @ M :@#R `=@D_ @-@l 6@ r @9 @@  8@ M@ '@  2@W @ @ @@  @ @K @ M@ Ќ@Q `@  )@_ 0@ '@'% I@\+ @V3 G@C #@1[ &@u z@7 v@d @" `0@% p@  z@r 0@ @ 01@ U@U Ѝ@J @! w@0@o!@>X@6$@03@;7 @>@"Cd @VPQ@\@k~@+M@P@'@&`H@0=@ 0@@ P@.@D@@ApI@N`@>`_@ Pu@@p@F@!+@90)@@y@mQе@ [pW@Ra v@!i@y@m{p@ P^@G@@ &@Y@ .@IX @w@ @v`T@El@@ ^@d `@@"@j00:@?`7@D@LR@fS`@]Z0x@`i@pF@  @8@@p@`R@#\@`#@1@ ^@Hx@`.@IN@. @ @#@$G@J2H@"?,@L@@S` @b'@l]@br @ "@X@  @@p@X@z@D0@.@dT@R x@ =@  `@)0@ / 6@5 K@R@yXF@ `3@"x`<@@G@;F@ p2@q0}@@/@P`@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startlsattr.clist_attributesgeneration_optpf_optionsprogram_namelsattr_argsdirs_optlsattr_dir_procallverboserecursivefgetflags.cfgetversion.ciod.cpf.cflags_arraycom_err.cdefault_com_err_procerror_message.cinit_debugdebug_maskdebug_fbufferet_name.cbufchar_seterrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrcat.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedgetopt.cplace.1334stat.clost_statinode_numuser.cwait.cwait_listrpc_child_exitstrerror.cerror_message.1085posix_dir.crpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cctype.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrncpy.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cunlink.cposix_files.cfd_listnext_fdposix_files_initfd_to_fileaccess.clost_link.clibgcc2.cparse_pos_paramsputcharstrcpyinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileppb_from_argvstrtok_rlist_sizerpc_get_responsegetgidprintfstdoutvsprintflibrpc_rpc_handlerrpc_get_stringiterate_on_dirungetclist_pushsigemptysetstrerrorgeteuidrpc_get_intsnprintfio_split_dirname__strtok_rreset_com_err_hookmknodatolget_parent_pidlio_seekgetenvfchmodlist_poperrnostrtoldgetegidisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatinit_waitpidputsdup2rpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_emptyoptarg_assertvsnprintfrpcstrtoul__dso_handleitoaispunctopterrreaddirjvprintfisspacefflushset_com_err_hooklist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddset__udivdi3setbufferabortprintf_putcchmodsprintf_putcisxdigitalarmcom_err_vamessage_handlerstrtolstrnlencreate_shared_memoryrenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroy_et_listwriteatoffstatfprintfkillinit_service_registererror_messagedirectory_createstrcatadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infochdiropen_shared_memoryadd_error_table__dtor_end__fseekppb_is_validoptindmemchrjprintf_putcstdinwaitsend_messageinit_envvarsumaskerror_table_name_startlstatferrorsyscall_psignalreadcom_err_hookstrcollisupperstrncmpadd_to_error_tablefpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopeninit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullinit_messagingfopen__bss_startgetoptmemsetmainremove_error_tableftell__dtor_start__init_service_get_nameclearerrfclosegetenv_name_by_indexgetcharopendirisgraphintr_handlerisalnumisprintprint_flagsmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnoptresetrpc_get_dwordstderrsigismemberet_list_lockdirectory_closelibrpc_c_rpc_handlerfputcfgetversionoptoptdivmodpread__ctor_start__ppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_processcom_err_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenoet_list_unlocksyscall_v_exitregister_message_handlertimer_register_et_dynamic_liststrlenopentoupperfgetflags__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClasseslist_removefcntlmkdir__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/mke2fs0000755000175200017520000000000011517101521024557 1packages/e2fsprogs/bin/mkfs.ext4devustar tyndurtyndurpackages/e2fsprogs/bin/tune2fs0000755000175200017520000000000011517101521023705 1packages/e2fsprogs/bin/findfsustar tyndurtyndurpackages/e2fsprogs/bin/fsck.ext4dev0000755000175200017520000000000011517101521024533 1packages/e2fsprogs/bin/e2fsckustar tyndurtyndurpackages/e2fsprogs/bin/uuidgen0000755000175200017520000062524111517101521016350 0ustar tyndurtyndurELF@@4P4 (@@@@0QtdSFU=@@t8v@ҡ@ut hX@!@@ÐUthD@hX@@tt h@ЃÐQSP UWVS] t& v5vCEE$D$1yy$@nV")ċEt$|$ t$D$$Py@=@s& @sBwҁ@rt$<$VáĪ@$G${V>É$ qǍ")čt$|$t$$tpoL$qUWVSQH1Y1Ph;@SV$,t;rt'tt*R3h&@5Ȫ@>$Uv븐밃t7tC uV]SV7$#A1eY[^_ɍaà uṼ uV뻐UVSjuV0-0U3U11ډ$kXZjV0E3EÃt fkKue[^UWVS EUEuxZE~K]1 )1~PSVu[(G1E}k1ËEF9ue[^_ËMvUWVS,]E t EЃugE1}ԍvECWEPE%? fEfE%@fEXZSW|F;u|e[^_e[^_fU EEPuWfUWVS, \@=@l@u p@uvjV.];l@FM; p@4ot@ @t@=t@GEEÉց@]űE teU ~[Lgfff)‰=p@)щ t@Cl@)׉=p@@~W 5h@XF_X5t@5p@5l@f@Ph\@5h@L;5h@CY5h@F؉1҉]ff@fUfE%fEލUء`@Efd@fEuRce[^_ËMt@EUl@p@`@ `@\@=@ jZ*à hjh>@%@$7*XZhY@5@%h@ 5@@Mff@@%?ff@*f@f%f@?jhl@d, l@uKvUjuÍvUS]Ix ]X[f][[UMU BBBABBABBAB BA B fAfBÐUSM] A Q Q ЉQA fCQA fCQA fCA C fAfC[ÐUVS։ˍURPzUE$EPEPEPEPEPPREPEPuSVg@e[^ÐUEU @fUEU @wvUEU @_U]Ít&'U]]u}CvMsV tRx@Ѓ|@%=t&ftt]u}])믍t&@@֋~t11҃9Љw~N1)=@@A)AVF ޭޅttYPtOAtU@fP +PA +A9R @G@@]u}]ËVfQ맍v9 @tQ9 @t=tABAtA 1)@@A $ D$n@뷋A@륍'U0VS @ @ @ @9s։ D$ $nۉt11҃9ᆳމw1 AqA AA@@[^]Ív Ft&P|^~ @t&9t&wv|.~5 @t& @t&w0 @vwv|ލ~ @t&@@$&UWVSt&@@ EEE Mtы@! @5@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5@rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf 1hfL QA UQEyACKGDGE1ҍY@@ڃt )ÃfC [^_]ÉE}tETF^05@E;11FKAA y]YEAGDGFE@GG@ GG@GxUGPGMHGDGE1@@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0F} CP X9k <$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&x [^_]Íx@Ѓ|@%=t ftu@@ 1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐU8uE u}}]EV=Uw& @t;=Ĥ@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$xW1 f?[D$E @D$U$MsuɍFD$ ED$E<$D$U(@FD$ ED$E<$D$@v'UUE @U]-UW V @S1ۃED$D$$ wD$ED$E$rt&߃ t;>t[ @D$ED$$Mru˃1[^_]Í& tED$ @D$$`rE (@[^_]Ív'UE,$@Ĥ@, @&@ =@uÐUWVS }1=v̤@t$$Dnt&9{ṳ@t$$Hn$ƍ [^_]UWVS }1 v9{t+̤@t$$mu [^_]t&̤@t$$m$= [^_]UVS̤@$_ƋEȤ@FȤ@11&@;Fw̤@\$$,mṳ@\$t$$nE D$F$A\^[^];o̤@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$^q\$D$D$ E D$E$ []ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$a UED$D$ED$ E D$E$" Um@0@Ф@Ít&UWVS,EUMI=Ԥ@GԤ@Ф@ Eu&)ċE\$#D$D$$nED$ED$C$&qE\$t$ |$D$$bt&1 &Ф@\$$jtF;~uФ@\$$jE;u|;~t)&aV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $crÍ@$\$ƋG 4$D$AmG $B<$:]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1${$s]u]Í&U(E uu}}]EEEzФ@t`$tÉ0E{C<$_|$ƋE4$D$zns \$Ф@$Fj]u}]%t&뙐U 0]Ít&U j0]ÐUED$ؤ@$g1tÍv'UED$ؤ@$g1tBÉ'UWVS }1]v<$D$kt&ؤ@t$$Rguԃ [^_]0$C$$ؤ@t$$2gUWVS 1t&<$D$ kt.ؤ@t$$fu [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$$k9E r݉4$kt$$D$Al&$j4$E j$맍vUE]utoU1u ]u]ÍvE $j$ƋE $}j4$D$E D$kE tC$1s롸$KtE$*j$/E $j$҉CthtdE$iD$ED$$kE $iD$E D$C$jؤ@\$$fؤ@1$NC$C$;U]]u$I\$D$$@o4$؋u]]É'U(]u}D$=E$h¸tR+ueF)ĉt$E\$$~D$j3D$}$|$te1]u}]Ít&@eUؤ@$bÍt&'UWVS,EEE EFEEE}&$hEF$ h]]x;D$E$BEED$D$EE$i|$FD$]$hEEEED$ؤ@$blED$ ED$E܉D$E$EE,[^_]'UWVSdD$p@$@ؤ@$u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$f<$D$tt$<$f4$fUDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@B@Bt\1ۅt.@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@]uu%@1[]Í&$ti@B$0&@D$@1[]ÐUED$ D$$f1Ít&'UED$ D$$f1Ít&'UD$D$$@fD$ D$$@rf@t&P&@=@u@ U=@]]uu}} G~&@&]u}]Ív tՅt4@@C@C @C @C1t@G@G@G  @G@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$@u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE]e1t&]Í&'UU ~ÍD$D$ D$D$E$1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3@\$$[u@ [^_]f@\$$[$]#uȉ4$ 1[^_]Í&UWVS1ۃ}9~t3@\$$7[u@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$Ȫ@\$ D$<@$Q^ 1[^_]Ít&]F9tD$Ȫ@\$ D$@$^1[^_]ËE cF[^_]ÍUWVS }@1 f9>tl@\$$Zu$Ƹt>@t$$[@>@F@FF t&F [^_]u@fU @tÍ[@@$Ī@$Ȫ@$Ðt&UVS@t519pt#@\$$Yu[^]Ít&[^]bf&'U(Eu]}t;$+!D$4$NjED$!t.]Ћu}]f@ލ&Et$ D$D$E $"D$|$4$tI$1Z>D$4D$<$rWGAGG@@G@농v'U(]]}} u$|$t]u}]Í&$D$@tԋG G\$ D$D$$G0G$두UE@1]ÐU1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG@\$$;Nu@ [^_]$@:ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f@\$$MnU;uݡ@\$$M [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$Mu$ D$_D$@$ƚ@1D$ :3CC@\$$N[^]&'UWVSE}}Et[^_]1Y&;8t @\$$RLuމ<$1ۍt&;>tV@\$$Lu1D$ D$D$@$ƚ@9UFF[^_]f뿐UND$P6@$ٚ@@ÐU1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVSF1ɉ‰EE#E$EËE${CStdfuC.C E\$$E11vD$xE$CtXC$HƋCt+rǍ&CC뗐t&$@tHƉ떍F$mEE$BuE#&tcu :F/<$mED$E$.Ct8_4$\$yG$GƋGu/볍&|E$"DE[^_]Í&$hE$ BD$E$B8$@@E$A\$D$E$CaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EEB@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$EҍUUE $T$E ÐU@$@D$ED$n-ÍU@$Ít&'U]&US$Ī@]t$D$ $É[]Í&]ED$$Z6؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$Ī@]tE $D$ $É[]Ít&]ED$$z5؃$[]fUSĪ@]U u$T$N5؃[]Í\$D$ D$$ []Ít&US]$C\$$tĪ@t$ 2[]Ðt&D$$@$4ؐt&UVSD$@$@ wD$ D$D$4$5 Ƅw@D$D$@4$$@D$ D$D$$D$@$@[ )wD$ D$D$4$ ƄwĪ@ZD$D$@4$6$Ī@D$ D$D$@$D$@$@ wD$ D$D$4$ ƄwȪ@D$D$@4$Ȫ@D$ D$D$$$cĠ[^]Ð@Ī@@Ȫ@Ġ[^]Ít&D$@4$ Ȫ@vD$@4$ @*D$@4$ Ī@U1]É'U]Ít&'UE@1] U]gK&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$?t$u\$ D$*@F$wƉ]u}]Íu \$KS<$Q/C $f/U|$T$$c?\$ D$D$*@F$ƋC $G/뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$3@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$<@F$4$@딍US$]u$[]Í&Ct$ELED$ D$D$E@C$ D$Ë@ D$E$>=C $賽$諽E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+,1҄u뱍vC!C$.뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$w;$wt&tyvC!C$:vK9Crt$ED$ $O;sY&{Cft$ED$CC$;sv'U]]u$9U $D$T$ D$^$9]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$#tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$>)@$Q)@@EED$ D$D$N@G$Ë@ <9}sE<D$@D$E$9C $v$n,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$胿_utRu4ttG!9u܍f]v֍ovɍt͉$v蓸G!9uIvvE<$ED$ D$D$N@G$wË@<9}sE<D$C $'t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$4 )čt$<$49s@a<w%$p@vЃ|+uf<$49rE1ۉ$4UT$D$F$5E$`4t$ D$W@$D$1U$w t Nun1ۉ<$ܵe[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$3$蒸FU$T$2$&tËFCFCF C FCFCFCFCF C F$C%C$$'D$ D$$D$C%4$说v'UD$`@$d@Ít&UWVS] D$@E$~C$L D$L@$N84$t$ D$D$<$uNȪ@D$D$L@$4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$:1[^_]áȪ@D$@$%@eȪ@D$̛@$@<Ȫ@D$ @$4$ @ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$ٚ@4$b/]$t$D$ D$D$$O$f&'U$~ÍU@tED$@$m,1Ð,@u@É'UVS1ۃ@uu!&Ѓ@\$$ *uu[^]U(}}EU u1]]EUt\$t$ $T$I>EU\$t$ $T$=]u}]ÍUWVS,E ]E@E܋EuEp@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$!%~8$t 1҃[]f[]Ít&'UWVS${1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UE]@ÍvUE]@ÍvU]u/ 5@D$5qD$ Ӊ $\$&(]u @]Í&'U]U(E E0p@Eo@ED$ED$E$Ív'UE D$E$ÍUuu ]]4$9~tu ]]u]u EUE $^ÐUMSU AA[]UES4]EEEEPp@]D$E ED$E$x4[]ÐUED$E D$E$ÐU}MU EtÐD$T$ L$D$@Ȫ@$gUED$Ȟ@$gÐt&UED$˞@$G1҅t $YU]G&UED$Ȟ@$1҅t $U]'&Uuu]u1ۉ؋u]]Í&4$`u$Кt$ D$D$É$UFu u0]ÐUSD$ D$D$Ξ@$@t@ MZ$؃[] UED$מ@$D$ E D$蘦ÍUWVS E}D$:@$U v2t&D$:@$qU 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$ t<U$ Ɖ<$*9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$|$\$E$\$4$ ËE$m؋u]}]Í&'US]$~\$ D$@$D$_[]É'UWVS,]D$:@$EU)čD$ET$\$$UE$EtD$$3Ue$荔$@A$)č\$t$$D$@$T2EE(&D$@$$e܅e܉<$<UƍD)č\$|$$3/ED$D$D$$Du$$E\$1ۉ$Le܋EetjU$ƍx@#)ċE\$$D$U TE$?\$ |$D$@$ct$5e[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$@$$@$D$@D$$@UT$D$$$@D$\$D$D$$D$ []Í&U($@]uu}24$(D$,$@$D$@D$:4$$@WT$t$$$\$D$D$$D$ ?]u}]fUED$ D$D$ @$wÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$@C$$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐU(0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$(D$$FFF D$D$$ta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$bEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$ \$UT$M܉ $ \$E$FU F$E] UMV~HU1fC D$CD$EE$a MC K9}MƋVT$D$U$6 F D$$ 4$蕋UE ]u$tD$E$N$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-@ [^_]Í<0C %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c lrwaitpid(-1) wait.cwait_child != NULLCHL_EXIT..:/%s: errno=%d console:/stdinrsconsole:/stdoutaconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createT@0S@0S@S@0S@0S@0S@0S@0S@0S@0S@S@0S@0S@0S@0S@0S@S@0S@0S@0S@0S@S@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZU^@P]@P]@P]@P]@P]@P]@P]@P]@P]@P]@P]@P]@P]@C^@C^@P]@P]@P]@P]@P]@P]@P]@U^@U^@P]@P]@H]@P]@U^@P]@P]@U^@e@ob@ob@ob@ob@ob@ob@ob@ob@ob@ob@e@d@ob@b@b@ob@d@ob@ob@ob@ob@ob@e@e@ob@ob@W`@ob@e@ob@ob@e@cl@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@cl@bg@bg@bg@bg@bg@bg@bg@bg@bg@bg@kk@bg@j@bg@bg@ l@__ AZusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK ?telldir: Nicht implementiert IO_ULINKlwIO_LINK zR| 'AB E<_AB E @%@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@@@ @Vv l@n @ @3@@`@g"@!U#@M(P!@y-&@5.@;181@)801@> 4@?@4@7g@4@DP7@dlE7@ E7@M@@|NA@gO0A@PPA@fS@B@ZWG@cW@(eY@oo@qo@6sPp@Kup@?!w0q@z0r@{Pr@px@fx@Sԃ@y@`y@ ;py@@z@A`z@P~@5@@L @Ap@.0@K@Q@.@>VP@-@JЇ@@Ј@9ў@@@$@ Υ @]@9V@T\@'Q@_jVmain_ uuid__generate_randomuuid_generate_randomuuid__generate_timeuuid_generate_timeuuid_generate Wuuid_packv Yuuid_unpackM 4huuid_unparseuuid_unparse_upperuuid_unparse_lowerQinit_memory_managerfreeZmallocrealloccalloclibrpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_registerrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*"nsyscall_psyscall_vU#agetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars(7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill-=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatR5Plgetoptoptargoptindoptopt+opterr=optreset%18getppidgetpidi8chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstat>gettimeofday<?getuidgeteuidgetgidgetegidGg@vwaitpid,waitXwait_child_addqinit_waitpid'DZrpcsend_messagelEnyieldRE,io_split_filenameio_get_absolute_pathZio_split_dirnamedMget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"Nnset_rpc_handler#gOyadd_intr_handlerJPa)vfprintffprintffprintf_putsn+fprintf_putcfS}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#ZW Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6c_exit2abortGatexit{exitie 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf8o7srandsrandomrand randomFq0vprintfcprintfprintf_putsnprintf_putc86ssprintf_putcQvsprintfsprintfKua_assert!wPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read zysyscall_timer{dinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_namelio_seekVcreate_shared_memoryopen_shared_memoryclose_shared_memory ԃysyscall_putsn!get_tick_countq;mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6nwait_for_rpcv_and_wait_for_rpccAppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper?%errno5dstrtolLlist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspn.ostrncmpostrncpydstrchrdstrcmpVdstrcpyostrdupostrlen(Qd__strtok_r strtokomemchrўomemcpymemset9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoul$runlinkΥoaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4V io_remove_linkio_create_linkT__udivdi3Q__umoddi3fQ@@q@h"intXI5Lf7e~t] (e 'eoy.Z%1H id2# L3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFz,HbI3c-vl3d@@k@@q<b7IY+,R3sit@=@oh"intXI5Sf7l~t] (l 'ly.a%1?id2#L3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g %,w S  a%:t@=@2,b$:u$,c&:':Cstr(2uu)lX@@; ? %B $8O V[asT@@@oh"intXI5Sf,6e7w~8t] (w 'w%*w,:~01y.l%1id2#L3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4   !#"#  , S   2= 3l#. 4Z#a 5Z# 6Z#, 7=# HM :@@@atvhi:@%@ buf:i: n:fd:tpu:0cp Cu S e  7P(@@loutO numObufQ\uuRLiS:nS:tP :?g@@ outf numh:t|i:m 6:445num5 tv<!_@~!A"#7:t@#8l@#9:@#:;h@#;Zf@ l Z5:$fd:M @@8out numduu P% l&'%'' '( )1`*<*H+T#m A`@# :\@:op:out num$@@out#  v@@-;outu Y  SQ , Y:Ss @j@{h"intXI5Lf,6^7p~t]y23e#.4S#a5S#6S#,7# A  '@j@A uu&A ptr&P tmp(e out)PGLU|sl@@h"intXI5Lf,6^7p~t]y23e#.4S#a5S#6S#,7# A  'l@@< in&< uu&G ptr(M tmp)e BL  SA0/sr@} @oh"intXI5Sf,6e7w~t]y%23l#.4Z#a5Z#6Z#,7# H  94@; @R uu3R2 out3E fmt3]c 5`XSc%HJ< @N @uuIRoutIUEP @e @uuDRoutD&@h @} @uu?Rout? h'@] *.@]| @@Ah"intXf7Z~tyZ] (ZdI5J#LK#:Lh#Mh# Nh#YOM#OM5YM#LZM#r[#"\Z# ]h#^h#s3z3 B s cO nz i3  V ptr:3  :3r~ *d s1 s2d nzkkxxjqoZ s s c3 nz i3 @ @_ @3 @1ptr]minMmajP-hS @ @` @ @m @; @~ @; @% @ @ hQh  @ @!@ @ @8Z"hd#sthw maj  @ @$h%m~$&> @@'=z ?3>  @av pA Bh majC minDM EM Fz ` @ @ZS @ @P` @ @`U@`@p`Dh `@@L@@h &z @v@ p4 'z ptr minMP zy.hSN@S@0`p@u@m( qs.$$7BMX`@@i`N@X@^& @@'( z' z43pT ~@@@@)R* b@*c@+eM,3*@f3 @*g:@*:h:@*k:@*l:x@*m:@--q.Am /@~@h"intXI5Lf7e~t] (e 'e0Zzo y , -# W .#  q/k@6@g_jZjZj.il3qZzrZupe@@Z@dA2W dAF4`@6@Q4E}W EGdiHZHZ 9@@~@^i:Zj6Ĥ@]4@  1@  2 @ \@@h"intXf7Z~t] (Z'(#)o#J*zo  T&j'#x(O#  a@@2 x`O1b2ic3\ dO@_@oy xNOP2iQ3;,O`@@ j+'+Oid-OST52f<2i=3y#̤@s$OȤ@ `@@ h"intXf7Z~t] (Z 'Z0|Ooz 3 pid4O# z5O# 6o# 7z# 8 '$ (*# )o# J$*Ao tpids|zsOu3vr`@@pidp|zpOq;b@@pida|zaOa3S@@gpidQ|zQOROC @P@pidA|zAOlenAoB; :AP@l@<p@@h{pid|;o;zO {K(g\@r;}A H!1@@Npid0|0;0o0; "2!;@e@z#pid|$;$o$;%;&%9%OL&.3p@@_pid|;o;3 )&O@)@Rppid|~;o;O߉'XL0@@E_J|qzJOKoKzMMNz(r3OԤ@)]:*.Ф@0 - @@ h"intXf~t]o# @@0  @@\|3 @M!@ h"intXf7Z~t] (Z 'Z3pid4O#z5O#6o#7z# 8 o   '(#)o# J *y(V)#*# +1  @&@3 ͙ V 9 0@W@3  C`@@ BLiD3 E @G@di3  2 P@k@1] } ep@@ddoh*  3@_@H_t 3 0@@   3`@@LK B3U #3@O@hstr"sep$hs .o/ 3P@e@  \p@s @!pidZ|HzZOh"Zo"[z #]zud#e ^ouh#[ _oul _o$i`3up a { 6 @M!@UG=| @E!@F AU @E!@>CKL # -lؤ@ %Y3KA  P!@&@ h"intXI5Lf7e~t] 'ey _ #A V     3  T # # 3#0_ g  o+ 3P!@!@+s5 sW| 3  3!@!@5 s| 3% s &3!@9"@[ 5 %| %3 J >3@"@2#@ ^=3 5 =7!u =s!i?3! os@#@#@" ns2"idpZ@I 3#@#@t"5 s 3#@#@"5 s< 3$@a$@"i43 3p$@J%@"csig3$# cZ#oldr# i  P%@%@#| 3#W  ?$ H3%@!&@]$| G3$W [$ g0&@D&@$ {P&@r&@ %<| z3L% k3&@&@l%w pidjz| j3%G! +w@! ,@!i -@"Y39,O  &@.@U8 !0. :oh"intXI5hf7~t] (] " '%*,Oy.v%1uid2# L3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  *   e   '  (#  )# J  * '8 H (8#fd)O# +O#  ,O# dupO&@&@%kfdO O&@'@%fdO OoO'@'@&fdOG& iO&  O'@(@&fdO&cmdOq' 'iO'(@D(@sap%argO%(P(@|(@ap%argO8( PO(@^)@K(H O8w( \(i]O( :`)@)@( x ~8)@*@(7fd}O+)! iO_) *@*@})fdO)buf)";)"  *#{8A*#@ _*ret}* $ *@l+@*ZfdO*buf*";+" 2+#{8j+#@ +ret+ p+@+@+fd~O+" ~,"' ~Oh,#{8,"f+@9,@, fdeO -Hee#{g8*-oH@,@,@H-fdGOt-"HG-"G-#{I8.#Q:. 8,@,@X.%fdO& ':O,@.@.. O /( lm ?/fdOh/#{%8/)af 8/-@-@|f8/*f80+:,- :O.@.@@099( 0@ ( 3O@. 68.b78.88. YOL  .@0@oh"intXI5Sf7l~t] (l 'ly.a%1?id2#L3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g %  C:.@0@l0 @:0 A0 Ba81 oliE?1 D?,@  ?8 V 4?@ 1:(@ 2:@ 0:$@ 3:@x  1@)1@h"intXf~t] 'Oyo 1d1@1@1 'd 1@)1@1  01@4@h"intXI5Lf7e~t] (e 'e(e )ez (ek )e%*e: +e,3 -e .e~0syG 4` a# b# c# d#  e#d f# g#i#q k#  l#$ m#(Y n#, o#0o.Z%1p id2#L3p# pid4#.5# 7#8z#>9z#:A#4]4|  * 4301@71@2 3 3  ) C3@1@G1@A2 {B3 B  3P1@Z1@m2N  ޾ L 3`1@j1@2   R  p1@z1@2   31@1@2 L ̾B R31@a2@3DfQDI3 QJg3posSs3    3p2@2@3{33 J3fD&4 G y32@v3@D4 xp4 xJ4 z34{{D(53@v3@dir F5 |  33@4@o55 J536fD&63@4@buf}0 (@ Y3%  4@74@h"intXf~t]~0]1|y  !f#"q# "3 4@74@D6 tv! tz!d   @4@w4@h"intXf~t](O )Oy #d@4@G4@p6)dP4@W4@6/o`4@g4@65op4@w4@65 4@F7@Ph"intXf7Z~t] (Z 'Z'(#)o#J *o y < )  pid*|# + # ,3# ~BCCpidA|iC3<DC `nvpidm|io3<pC|4@~5@ 7&pid|L7 &7-37<C84@4@#.%87I@5@t5@VaC8j 3(|5@5@a8X &oT5@B6@8pidS|8<VCoutf76@5@5@V#.87GP6@7@9qpid}|.9z}O}o{9~z9<C9  K#8.97!X#p.97"9 7@F7@ :#V0@ $Y3VP7@7@mh"2>intXf7e~t]orpc"P7@k7@6:pid!Zb: #ZP 2>p7@7@:Dpid0Z: 0Z: z0Z:len1Z; 1zC; 33P :Th ZT D7@7@h"intXf~t]o7@7@b;(7@@@h"intXf~t] (Ooyo'(#)d#J*  &    / 1&2#3#5&# o6Dp; pcwd}v*3; ppcwd}v*(3i)3FvDlenEdEEGv oi7@:@;Lh;; hp;h3;jugposk<*luhmulnv< wd< !!!!"#9@X9@(!!!!"#X9@9@[!!!!"$9@:@!!!! "%Z}:@:@1=&L]=v'6p}=(@:@:@'}='d=@; pi33v) :d; 9p;di<3=vl_; ]pH]}^ib3cv%}:@>@=Z&L=v*6pud*3'dQ>'-}d>+6(;@u;@r!C8,N>"Y"d-|X!p,>,>",>,>-!, 0?,)Y?,4y?+@(=@=@!!R"^,j?"t.=@>@!!!8,?,?/}>@@@?&L@'}>@*; pul'di@'v@-@h+!R"^,j@"t.v?@@@-!!!,@,@b@@ A@h"intXf7Z~t] 'Z(Zos'o@@@@ A pid(o7AC8o@@@@JA pid7o 9ovA{Vo@@@@Am 7TO uidTz ,T Uo pidWoA Rk@@@@AzA@ A@A { BUA@#A@h"intXf~t]oA@#A@3B0A@CA@h"intXf7Z~t]o!0A@CA@_B O]" 1PA@2B@,8 !0. :oh"intXI5hf7~t] ( 'y.v%1Tid2# L3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O :  O  O  :   xv# #arg#$##fp$## k4OPA@A@Bfp3#3ap3%,5 t6h<OA@A@Bfp;#;ap=%>OP]/OA@ B@B%arg.%C./Cn.OeC  k(OB@2B@Carg'%c':CT 1@B@ G@h"intXI5Lf7e~t] (e 'ey.Z%18id2#L38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3 @B@dB@CYopB@B@C3B@B@(DH  d3B@B@TD,c3DB@B@cs>u{8B@rC@D8Dpos3Ec36Eos3C@C@TEc3EH C@C@cs>u{e3C@,D@E neEstrY$F&30D@D@fF7strYF/D@ G@F~0FL1~~2z(G>V>V)@ $@b%Ī@&Ȫ@Y3 "Q1G@W@h"intXI5Lf7e~t]o (e 'ey.Z%1?id2#L3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#z5Z#6#7# 8a 7id8#]9#:#;Z# <?Iid@#]A#B#CZ# DI# AX EOyidP#bQcUidV#gW K  z& zres {K#G |#%H  V02%1y3EH %G@G@QGc8 G@%G@}G30G@AG@GH g_3PG@YG@G^3`G@AH@H_H -HH?H3H _ ?out8G@ R3PH@{H@HH QM3H@H@+IH LHL?L+G3H@H@WIH FHF?H@I@IsrcI]IIH  J6JTJF gJI@I@J  A  X83I@XJ@J7H JJs3`J@J@KuH DK yp!3J@TK@zK"H K#ZKhs`K@K@KH g&L nposhLF wL N3K@jL@LdH ML MsM' M34M$pL@L@`MH L@N@MM]MMH ENN%83N@bN@N:%str7H 7%3pN@N@Nc$3)OH $&ch&zu{3N@O@HOc3tOH OE!S O@uQ@O " P"]PP"P"H P#$Q \' F nQQ()'( F *Q,Q@P@Q@*i3Q+EF3Q@Q@Q H E(R,cGz^R]?Q@R@~Ru \?R\3RH \S,i^3 S,c^3>S!2KR@T@\S "JS"JS-L?up.msgR +XSE*iW3S#F ~T#H &T/H+_ z 0xT@ U@pT8l3U@V@T kT?kT Hm _Hno,srcqU,dstxGU/`iU A 1!(V@W@UM "LU"U"U#)V+?V--@-'.Z@-Y/@282 Y3$1W@X@(h"intXI5Lf~t] (Zoy'(#)o# J* PeW@2X@GV d3sV msggd hzV i,A, 3E@X@TX@VM3`X@X@VsLus Q1X@X@V 03WX@X@i43AW5u (@Y3 %1Y@n@h"intXf~t]8 !q. {o3 d {3 d 3 {   x# # argd#]P0x/J E0 3`:O_V{^  Y  h # ]#}'|buf||O2VY@dY@TW1VW1OW 1WV3Vrem4OOLpY@*Z@ X.KV5XbufKfX?KOXKOXpMuXN.u`*OVXPO Y QOup 30Z@WZ@Ym,mIYc{sYB3`Z@Z@Y,mYYn3Zi3bZ*3uZ 3[@E[@Z!Z"3Z#-P[@_@Z!,'[$ap,f\%.ud"/30]%03ul"\03[]"h03]"v13^"23D^&i33^#3_@n@^ !,m^!_$apf_&ta"*3c" {gP+J1p@/q@$oh"intXI5Sf7l~t] (l 'ly.a%1?id2#L3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K S'p@/q@v [%w {%Bw %:mw ?&:w  % 8 V,10q@0r@%oh"intXI5Sf7l~8~t] (l 'l~0y.au/H%1`id2#L3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %&#h '#(s# )# *#t +# %  -$!!#' l -%e*:PH )!0q@Kq@wnCPq@q@wB'xH D0x w2q@q@NxDPq@q@zx?O'xdirQ!xq@q@Q)e2q@q@S>:q@q@xH =! =' =:0q@0r@yH /!x@}}02msg3 N@x@kx@}pidM*0JQpx@x@g(h"intXI5Lf7e~8wt] (e 'ey.Z%1Cid2#L3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI# Jl#' K3# Ld V A.px@x@} H -~ -lC~ ' -3 4/d0x@3y@+)h"intXf7Z~t]%zoOx@x@~O idO~zy@y@~ idO o~  y@3y@ idO1@y@\y@)h"intXf~t]otd3@y@\y@.nOsn2`y@ly@)h"intXf7Z~8lt]o!a`y@ly@Zeax"Oedx"ORix25py@7z@[*h"intXf7Z~tyZ]$h%o&'##(z#}) !  O  O ptr" py@y@.  h(1y@y@0O 0O ptr2 2( pD7y@y@6O6O 6O ptr8tG3z@z@3lFFOHOIZU z@7z@\lTTO3@z@\z@,+h"intXf~t]o@z@Lz@ Pz@\z@3`z@H~@m+h"intXI5Lf~t] (Z)3 'Zo "$    ) h *# +z# len,o# g/& num0o# R1&#5 14z ppb5z# 6o# 7o# 8o# xQoldPPoPonewRA=>b?5Y`z@z@Yppbz oY oylenooi3QZ3z@&{@ppbz+oVi3Rb3v0{@{@+ppbzo+b3 i3Qarg 3b3b`h `alenao co d3newe!"""!#$3bshm3 opi3 N3 z 3{@~@99?bshm3p9փ%@ &X #%1x "a"V"K"B& 'l#w#(|@;}@k"""& #) "& ##''='['{#?~@H~@*{Ţ9DŽshm3retȇ+Y36 P~@5@,84AAc3AintH9Adc8A AcA`*Ac)AHAcGAPMAcLAdP~@^~@ v@%A`~@n~@9c$Ap~@~@e; p/A~@~@Džec.A%~@~@7H~@~@Z0>A@.@K c=AwCA0@_@ cBA†`@t@@@ 3XRA@@9 cQAe @@Sv 1 H@@S WA@@ cVAx\A@@χ c[AhaA @5@ c`AF;6|8@8@[-7@int 7|@@ @-h"intXf~t]#]@@ @estr""6"3z$]ʉ%3%&*:'3U o Y37 n @a@.h"intXf~t] (O'(#)d#J(L##$o# *q TN @8@~ ; M  >Vd@@a@Ɋ7 ; U p@@7 ; c 3Rn3 o@ @ ; A 3a,ݿbo@@H; 3 o,,& (U  o@,@ ; o1B0@Y@  ; A5 `@@`' ;  3Ž oȄ@@< h@?@Zn ; g goȏm H6@@a@; 7+@,3@'-@9p@*@)/h"intXf~t] (O&zy%dp@*@s$@$`s1* bit+o tbl,Lidx-3  o o90@{@/h"intXf~t] (O%30@{@s1#ݐs2#n$dIo6: @ц@0h"intXf~t] (O*@ц@hdst)src)֑n)d0 d,Qs-R o  :"@@p0h"intXf~t]+@@Op*{ch*3c,Qo,;+@N@0h"intXf~t]4*3@N@s1)s2)(o;LP@}@0h"intXf~t]@#P@}@Gto"s;"G$o  <U@ʇ@,1h"intXf~t] (O^&@ʇ@str%len'de(' o  <jЇ@@1h"intXf~t] (Os$dЇ@@:str#fs%R oM=z@ˆ@1h"intXf~t]2@@s111a3tok3c43sc43 @ o   `@ˆ@ s__a@=Ј@ @;2h"intXf~t] (O)Ј@ @=s&ic'3n(dH p+R    A>@@2inth"Xf~t] (O3A@@:.:N:dndstBsrcCtDdD}Љ@   o   ?@~@)3h"intXf~t] (O#A%Oy|<@~@Ԙ:c0:3B:db t=d c?z dstA% o5?@@@3h"intXf~t] (O.#d@@[s""dlen$dŚ  o /@B@Cn.Os.C/.O[ st0IKi1Oy;Oś ` t5O YY 6]P@@str3]Q3z x cP@nj@str^ 3Ќ@ٌ@Ĝ1s1s2!@@;ɸendR˽])̽_ͽ^neg33outb@ Y CI @ @ĝ; end u  @@@K;endEV@@@;DHDD3FV<negG3out@U3@Ӑ@"s 1@@N1;3yAa @@4h"intXf~t]yoZ'3@@z'k{Aj @}@5h"intXI5Lf7e~t] (e 'eyo.Z%1?id2#L3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K s&3 @}@ L%Ҡ%3f) dir-=  V dY3hB @@5h"intXI5Lf7e~8wt] (e 'e~0~y.Zu/A%1Yid2#L3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> !"S### _  DIR&l%"&"#h '#(l# )# *#t +# _2 -t@@[sdirss s~ i@ӑ@dirhs]~@@dir\szC'@@ߡ'dirBs D-+JIP'} w 253@@_dir4s*s@@Ǣ) _C@[@7h"intXI5Lf7e~t] (eo 'ey.Z%1?id2#L3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z[#Q\#^z#_#  a`dcQd#fz#g#  a=h b3@$@X3x?ul?£@ z zH  V  a  330@[@0#1\X12J43j56 G?fH?@q͔@/”@@[@mzΦnzHor  a Y3Ds \@@Y8int~]ohf"5 %4 ,f Xe tu m ^   Y Q  low`# `#  s llv I  < M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k{ _\@@ n^9d^Y `A7- LWbmxX1Ot`@@@@٩Es @@8int~]ohf"5 %4 ,f Xe tu m ^   Y Q  low`# `#  s llv I  < M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k S@@uR.vRުwT VA7- LWbtPmxNnQd@@T@@̬% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I I !I/ $ > .: ; ' : ; I.? : ; ' I@: ; I4: ; I4: ; I4: ; I 1X Y 14: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > I !I/ .: ; ' I@4: ; I 4: ; I.: ; ' @: ; I: ; I4: ; I4: ; I.? : ;' @: ;I4: ;I 4: ;I: ;I .: ; ' I : ; I.: ;' I : ;I: ;I 4: ;I!4: ;I" : ;#4: ;I $: ; I%4: ;I&1UX Y'1( U)41 *41+ 1,4: ; I? < % $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I 4: ; I I&I% $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I$ > .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ >  : ; I : ;  : ; I8 .? : ; ' I@ : ; I  I% $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > $ > .? : ; ' : ; I.1@1 .? : ; ' @ : ; I 1UX Y 1 .? : ; ' I@4: ; I.? : ; ' I@4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include../lib/uuiduuidgen.cstdint.hstddef.htypes.hio_struct.hstdio.huuid.ht@$ .Kl/f tʅqֻZ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sysgen_uuid.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.htime.huuid.huuidP.herrno.h@@ !W??K/xJKucJ/W ftx< v .gwJ~+'hlYhK!,<KK~Xv~ɻg/Juf<'f*X?9v=;k /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includepack.cstdint.huuidP.h@&/====>ZK>hK>hK>hm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.hl@&=uuun /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.h@3B gzJgzgZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h @>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ ../../../include/arch/i386../../../include../../includemessaging.cstdint.hstddef.htypes.hrpc.h@tB/@T@04.O.t>>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h`@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.hP!@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h&@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~p ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h01@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]D ../../include/systime.ctypes.htime.h 4@!<=gw]9 ../../../includeuser.ctypes.h@4@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h4@i+t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.cA@=gP ../../../include/arch/i386add_intr_handler.cstdint.h0A@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.hPA@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@B@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.hW@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hY@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%IowI ../../../includeprintf.cstdarg.hjprintf.ho@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.hPp@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.hp@&gI38 ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h0q@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h0r@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.hPr@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.hx@?Dx ?Dx =3 puts.c@y@>(eN ../../../include/arch/i386get_tick_count.cstdint.h`y@ >{ ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.hpy@ ic?9 fi='=% wait_for_rpc.c@z@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h`z@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.cP~@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.c8 ../../includestrtol.cerrno.h@@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.h @!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.hp@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h0@$>9LV2z Z: ../../includestrncpy.cstddef.h@)Xg[ye_; index.c@*\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.hЈ@(JgKwp@8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@;fr<zT ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h\@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| ,4t@D  F AB DR.| (x@@dAB EF.E.\.a.$x@AB Fs.^. x(@AB Fx.x@AB Q.4x@AB F}.!. N..h..X.x@AB H.x@+AB DR.| @VAB | l@nAB A|  @_AB EI..@< @AB P @AB h @AB | p @AB p @AB FIp@ @AE Ep @?AB Fp @VAB Fp@3AB D|  8@vAB FIF8@@AB  8`@AB AFF8@@>AB | @dAB F@oAB F`@AB E| 8`@:AB D8@1AB 8@1AB 8 @0AB 8P@AB 8p@IAB F8@AB A8@AB ON8p@YAB X8@YAB X 80@AB IFF| @ AB @AB | @&AB 0@'AB `@AB F@gAB AGP@AB p@AB MF@_AB L`@GAB FF@AB LP@AB p@AB F @AB F| @P!@IAB D@!@IAB D@!@IAB D@@"@AB E@@#@_AB D@#@%AB @#@%AB @$@aAB  @p$@AB MFF@P%@WAB D@%@qAB D@0&@AB @P&@"AB @&@IAG | &@AG &@AG '@yAB C'@ AB C(@AB F`)@KAB )@RAB AF*@AB O*@AB Op+@tAB LF+@IAB @,@AB L,@ AB ,@AB E.@"AB |  .@;AB D|  1@AB  1@ AB |  01@AD  @1@AD  P1@ AG  `1@ AG  p1@ AG  1@AB   1@AB FHE p2@EAB D 2@AB FI  3@AB IFF| 0 4@AB | \ @4@AD \ P4@AD \ `4@AD \ p4@AD |  4@AB C 5@#AB  5@AB E P6@AB F 7@&AB | t P7@AD t p7@DAB E|  7@ AB |  7@7AB C :@AB F :@AB F >@AB F| @@ AB @@AB @@!AB D@@ AB A@ AB | A@AB | <0A@AB | hPA@;AB hA@!AB hA@JAB IFhB@"AB | @B@$AB pB@AB B@ AB B@NAB DB@AB BFC@NAB DC@\AB D0D@kAB DD@jAB H| G@AD  G@AB 0G@AB PG@ AB `G@AB DPH@+AB H@-AB H@.AB H@AB FKI@xAB D`J@aAB DJ@AB FF`K@AB DK@zAB DpL@#AB  L@fAB IFFN@RAB FFpN@EAB DN@UAB FF O@UAB FQ@RAB DQ@AB IIR@6AB CT@AB U@AB IV@AB F| W@bAB E@X@AB `X@GAB X@HAB B|  hY@dAB FLGhpY@AB Fh0Z@'AB h`Z@AB Fh[@EAB AhP[@0AB Fh_@uAB C| To@ AB To@ AB T o@RAB ITo@ AB | o@6AB o@AB o@@AB FF0p@AB | LPp@ AB DLpp@OAB GLp@!AB | p@?AB | 0q@AB Pq@0AB q@ AB q@0AB q@ AB q@`AB FF| 0r@AB | Pr@QAB Ar@*AB r@mAB FPs@mAB BCs@rAB FI@t@7AB Dt@DAB Fv@AB Dw@AB PF@x@+AB | px@fAB D| x@AB y@AB  y@AB | x@y@AB | `y@ AB | py@AAB LFy@AB y@AB z@AB  z@AB | d@z@ AB dPz@ AB | `z@lAB Cz@VAB C0{@jAB F{@`AB F~@HAB L| \P~@AD \`~@AD \p~@/AB \~@AB \~@AB \~@AB \@.AG \0@/AB \`@AB \@AB \@4AB \@AD \@AB \ @AB | @@AB F|  @AG @@!AB p@yAB HF@AB  @AB FFF@lAB FF0@)AB D`@AB MF@OAB D@@!AB | $p@AD F| X0@KAB DD| @QAB B| @.AB | @>AB A| P@-AB A| L@JAB FI| Ї@AD | @AB BD@"AB | Ј@9AB A| ( @AB F| \ @AB F|  @9AB  @AG F P@hAB B @AB  Ќ@ AB  @AB F @ AB  @ AB  @@oAB F @#AB  @!AB | !@ AB | ! @]AB D| ("@"AB ("@#AB ("@AB ("@AB IH("@AB ("@ AB | "@dAB F"0@+AB JI| (#\@'AB E| \#@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutuuidgen.cGNU C 4.2.2mainprognamedo_typestderr/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/miscuuid_tusageclock_lowget_clockhas_inittv_secuint64_tuuid_generate_timetime_miduuid__generate_randomuuid__generate_timetime_hi_and_versiontmp_seedtime_tget_random_bytesstate_fsave_umaskclock_mid/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/uuidtry_againoff_tuuid_generateclock_highmode_tuint16_tftruncateuuid_generate_randomgen_uuid.cclock_regget_node_idlose_counterget_random_fdnbytestimevaltv_usecsuseconds_tget_uuid_via_daemontime_lowlastret_clock_seqstate_fdadjustmenterrnouuid_packunpack.cuuid_unpackfmt_upperuuid_unparse_loweruuid_unparse_xuuid_unparseuuid_unparse_upperfmt_lowerunparse.c/home/tyndur/tyndur/src/lib/stdlibcdiffstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountnextmajSizefirstcaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeouttimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementoffsetfdopenlseekpreadfd_list_elementF_GETFDnewfdfile_flagsorigin__builtin_va_listold_posio_resposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdoptindoptargoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptgetpidgetpid.cgetppidmkfifostat_bufblksize_tst_ctimest_nlinkfchmodinode_numnlink_tlost_statmknoddevicest_blksizest_gidino_tst_atimedev_tst_inofstatstat.cst_mtimestatusgid_tlstatst_blocksst_devst_uidst_rdevblkcnt_tmkdirst_modetime.cgettimeofdayuser.cgeteuidgetuidgetegidgetgidrunningwaitoptionswait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidsend_messagemetadatayieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsretvalputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexrnd_seedsrandomsrandrand.csprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertiondirectory_closeio_direntry_type_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cget_tick_count.cget_tick_countphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigiterrno.cendptroverflowbasestrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspn/home/tyndur/tyndur/src/lib/stringstrcspn.ccharsetstrncmp.cstrncmpstrncpy.cstrncpystrchrstrchr.cstrcmp.cstrcmpfromstrcpysavestrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontmemchr.cmemchrdst0memcpy.csrc0donememset.cu_charu_intpositivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoiunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSu Q u u tq{V{qVqVqqSqSP.MPYPPPWWuudtIaSdeuegugtdxPxtldxRxthVSW~VVVuuvthSlrSrvtPvt iVxyuy{u{tuut\\|t |DIP6AtHACStLCxSVS;SUSuutuutStStuuVt IPuuntuu_tPR]VQ\S`auacucrttuuuwuwtuutttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0Pttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttu !t!#t#)uttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttuttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt uttu !t!#t#ruceQttutt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttutt u PttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt.u,P,.utt>u  )S)+u+8S8>u  >Rtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcutt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P,, *3*@&(&(*@&(*@*A$p\\(:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)03X_r02 0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@l' @ -@C5X@X\?@F@M@R@X@@0p ]0$fT`uAXMzTG9,#0 Z?D0 tP `A@@ @@X@@@@@ @@     @@(X@;@H@^@@ m@ t@D@ @ @@@@P@!@@d@\@ '@ 5l@ ?t@ Oh@ \f@ k`@ x@_@@x@ @ @ @ @ @ @ @ @) @ 5AĤ@ HP̤@ WȤ@ etE@I@p@IԤ@ ؤ@ @g@  @ 0&@ $@a@ $@ 0>@ F@ N`)@K_)@Rjs,@ ~1@@ @ P6@7@7 2<D@ OVH@_@ h@ o@ w~@ [@E@ H +3;CLSp@yd@ n@ y@ @  "..8P[@0IB@NQ< @^P@-ePr@Qs`@| @07@ p@4@T@{@`@@"@@!@`4@o@ Ī@ pp@Oo@  @3@BN@UI@OS#@%_P4@gp@Ys@>@@`1@ P@h@@px@fP@@1@@l@ @p4@~@PH@+B@ 0@+:@+z@V8@dE 1@ L:@aQ@gB@ lPz@ @z@@z@ `G@@o@"@B@$.@" 7@&0D@k&@`@:@ @ @4@ @# ~@H$ `J@a) @?0 PG@ 7 @E @ L p@?T P7@X @!` @ m @r @4z $@ h @ @ _@u p~@/ I@x @ @@ 0q@ @ @_ p+@t P!@I \@' H@-" @X@( 0p@4 01@: Pp@ G `y@ V 0@/_ @#@_e @ u @@| @9 x@ U@ @ D@j @3 r@* @  `@ 0@) +@I @ p2@E A@! &@I w@, Pq@0= 0A@N P@a o@6i P1@ p `@G @+ y@ @ K@z `z@l (@ Ј@9 0Z@' @ 5@# p7@D @ p1@  @) @@ 0 3@6 G@= @ G o@RL P%@WS @,@X l@nd Ќ@ l `@t 0@K| 0G@ @Q @  @_ y@ 0@' C@\ @V @V A@ @1 0@ @t@7' @". #@%9 ,@ @ s@rM ~@U y@i p$@s O@Uy @J @@! q@0 @@o 4@ @@> R@6 0@ .@; @ t@ `K@ @ o@  @x@+ G@J@$@&9pB@A1@I@ Q@Y@ f@.nP~@vpy@AC@N@>pY@o@@&@@@!@y@p@Ps@mФ@ Q@Rp@!r@m @ `X@Gp@ @ )@Y7Ȫ@ >o@ F!@IR(@hq@ x@vpN@E@ Y@d*@P @@0{@j5@2@~@L@f @]q@`0@@@ '@,@9 z@KpL@#RV@Z@1p@ X@H0r@!@IH@.y@@#`~@A@JB@"P@(@@W@b`@`@*Ї@1,@6 @>t@DJ@.Q@d`N@Rfq@ u@~ @'@ 1@ *@'@y@@ P&@"@PA@;A@  %@qv@" @'@"@3`Z@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startuuidgen.cgen_uuid.cget_random_fdget_random_byteshas_init.2491state_fd.2414last.2413adjustment.2412state_f.2415clock_seq.2416node_id.2490pack.cunpack.cunparse.cuuid_unparse_xfmt_lowerfmt_upperliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetopt.cplace.1334getpid.cstat.clost_statinode_numtime.cuser.cwait.cwait_listrpc_child_exitrpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexrand.crnd_seedprintf.csprintf.cassert.cdirectory.cinit.cseek.cshared_memory.cputs.cget_tick_count.cmem_allocate.cwait_for_rpc.cparam.cctype.cerrno.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrncpy.cstrchr.cstrcmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cmemcpy.cmemset.cstring.cunlink.caccess.cposix_dir.clost_link.clibgcc2.cparse_pos_paramsputcharuuid_unparsestrcpyinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileppb_from_argvuuid_generate_randomstrtok_rlist_sizerpc_get_responsegetgidprintfstdoutvsprintfrandomlibrpc_rpc_handlerrpc_get_stringungetclist_pushsigemptysetgeteuidrpc_get_intuuid_generate_timeio_split_dirname__strtok_rmknodatolget_parent_pidlio_seekgetenvfchmodlist_poperrnostrtoldgetegidisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelgetpidio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatinit_waitpidputsdup2rpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_emptyoptarg_assertrpcstrtoul__dso_handleitoaispunctopterruuid_unparse_lowerreaddirjvprintfisspacefflushlist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddset__udivdi3setbufferabortprintf_putcchmodsprintf_putcget_tick_countisxdigitalarmmessage_handlerstrtolstrnlencreate_shared_memoryrenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroywriteatoffstatfprintfkillinit_service_registerdirectory_createadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infochdiruuid_generateopen_shared_memory__dtor_end__fseekppb_is_validoptindmemchrjprintf_putcstdinwaitsend_messageinit_envvarsumaskuuid__generate_time_startlstatferrorsyscall_prandsignalreaduuid_unpackstrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocuuid_packset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getstrtoksigfillsetfdopeninit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullgettimeofdayinit_messagingfopen__bss_startgetoptmemsetmainftell__dtor_start__srandinit_service_get_nameclearerrfclosegetenv_name_by_indexgetchargetppidopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnoptresetrpc_get_dwordstderrsrandomsigismemberuuid__generate_randomdirectory_closelibrpc_c_rpc_handlerfputcoptoptdivmodpreaduuid_unparse_upper__ctor_start__ppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_process_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenosyscall_v_exitregister_message_handlertimer_registerstrlenopentoupper__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClasseslist_removefcntlmkdir__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/e2fsprogs/bin/badblocks0000755000175200017520000077375511517101521016652 0ustar tyndurtyndurELF@@44 (@@@@<lQtdS~U=@@t8v@ҡ@ut hx@!@@ÐUthD@hx@@tt h@ЃÐQSP UWVS] -?Bt& LvsbvpEE$D$y$`@诡芃")ċEt$|$ t$D$$@=@s& @sBwҁ@rt$<$ád@$t${kÉ$虥Ǎ")čt$|$t$$oUÍvU 5@ht@5h@k$ U 5@h@5h@k$UVSÉ@jEPS;ƒE8u @t$ SVh@j5@%j苂vЍe[^ÍvL$qUWVSQPEIMj5d@PrZYj5h@Ar$$荘EtUt@EEEEE@EE@Phy@uuWXv$ @h@h@E4@d@륋x@t@@9~-P5|@c1|@x@ `@j@qt@|@@t@0`@!N@`@E `@Eh@h@E@=`@}`@U\@(@`@l@<@`@p@@`@rEj@`@[E=M5`@h@j5@#$ @h@u=t@|@t 8]K;4@4@}<}@4@91@U@@E4@4@9GEE9Eh@t-EPu E jh@dZXZ=h@Vu:SE@/EVuS@@j}ąt@uĉuȅt@uȉd@@jh@11ۋ d@u,;]}A uuuuuU܃ uC d@tRPh@5h@g;]| usL@;d@t Pp|@t PU'1eY[^_ɍae@{l@t@|@ @t@VEPuWf=P+Rh@P(E@h.l@}@7E5@Suht@5h@e \@5h@jjh@phj@uvuh@5@rfhm@uv@uh@5@=uh@Ph@IPuh@5h@e=\@u:5h@j jhP@p$|Wh@jvU5h@j7jh@ouh@5@ Puh@j5@j{5`@h@jbSh@PVQhL@jIuh@5@6Ph@j)UP(fU@hPS@jGXZhPS@jGYXhPS@j GXZhPS@jGYXhPS@j GXZhPS@j zGÐU@t jP# jzUWVSƃEU]tBtuz9sB9tD tIB9u`@ d@ue[^_5h@jjh!@ n1ۃvQ3Ph9@5h@bC9s5h@jjh@me[^_Í<9s%C9t萐%yH @C9u`@ d@b5h@jjh@vme[^_1 UWVSjEPTu+5@<׻뉅04 )ș)Ӎ[) WQSh>@]S荗 @@91RP,$ @1RQ,$ٝ<م<S$hS@hHSgƃ5h@Sm VjS+Ƅ5H^_5h@Sm[5h@xie[^_ÐWQhK@]S̖ @@?hv@ZUh @jD$rB@uZfUWVS,E܉U؉Mԋ}=d@~5] }ȉE̋MˋEÍ4jVPu;11 tPhl@5@5@Wp@PEPuuJÃp@u>xRuؙe[^_ÐPShx@5h@_ؙe[^_fjEPRyv1ۉؙe[^_ÐjEPQcfUS P5@t1]ÐPSh@5@V_X5@gYXS5@u8@t;@r ]fh@Pj]Rh@P5@$uvUWVSEUM}=d@~e] }؉E܋MˋEÍ4jVPuk11 tPhl@5@5@PEPuuHÃx8u ؙe[^_PSh@5h@&^ؙe[^_f1ۉؙe[^_ÐUj5@uRh@P5@ÐUWVSE@h@5@ t pv;Esh@5@@u܋EpUЉt#à EP!x|tىMމu@d@c=`@u =d@~5h@j:jh@gxE EPẸ@h @jR@Y[h @jD@XZh @j 6@^_h @j(@Y[h @j @XZh @j @t@EUUEM IMEMEtEv@U@M @`@t =d@|EEE@9U l@t ;@Vu+u @t99s)֍9E su )փRuEÃq@P@@E9EtU ;@\ @M|EUUMMEEEu%E;@M@RUE5@uMUEE~LE1EpM9Mt/E4U<p9t֋E@@E9E>5@uMUEREEEU@EE)U@s@E@M @@M @ Z@@QuًUE9t @Ph@5@5@]EE@@9-B@@`@u d@t5h@j#jh@1d@ j:=`@u =d@~5h@5 @`eEU9U 5h@a^|:[u1Y5@ @e[^_Ãh@5@ @3|@E~-Ph@j5@a$Yo jOSRh4@P΃jj;5h@jjh@c 5@~G|xLtuڋEExDÉF9@ă 5@_$n5h@j;jh`@bE HPuh@5h@dW iUWVS,EEEEЋU‰UԅT&d@ t@M|@UE HEEEME؋M̋ECU@M @`@t =d@~u@9U vtl@t 9E9E su )փRuUЋEÃ=d@~@@9@9U w@ j7`@ d@`@ d@aE @U@5`@t =d@]@9U l@t 9E9E s] )ӃRuًUԋEE~NE1fE]E9Et3uދ}M9tދE@EE]E9Eu͋E@@$@ 9]1E)؉)Ӄ=d@@9U @ je6`@ d@EU9Ul u Ee[^_Ë]냡@P@E $@ 9M1)Ћu)|B@E`@u d@,5h@j#jh@^`@u=d@5h@j#jh@^}5h@5 @`5h@jjh@^5h@5 @_QEؠ@EC jUj jCp5h@j+jh@@^E HPuh@5h@R ENPh@j5@ $iUWVS$uh@5@{h@5@@t9r݋t@EE+E܋M܅Md@E Xt@ 5@@t@u`@d@EEE܉EUUE @9M l@t 9E@E9E sE )ȉEQuMU܋EE5t@tQ~M]EE]E9Et2U9҉ދ}tE@EE]E9EufU@@E9E]%E @9M @ j2 `@u d@t5h@5 @)] 5h@XXuX5@Ee[^_ËE@E?E5h@j*jh@_[=d@J jU89tfE9t)ʉUf $@ 9Mr1t)ЋU)‰U EEB@>Eh@5@@`@u=d@5h@j#jh@Z5h@j*jhl@jZEEE܋M|@] KSVh@5h@"OVh4@P5@$ $fRh@jߐUVSE8+t [^ËPtX E 9tJU 9u1؅~ωt9t19}19t9t;U t9U rىfUu uvfUvUVS]Ku e[^u SUTًBI9M|zG _,EӐUvUWVS(ƉUMj<Ã1߫+t{sECt*1w S F+e[^_Ív PEtʉC u܅t9KNjuE1e[^_f |vF+e[^_ËK{ 1UVS]u K SCVuCBȍe[^ÐUvUE 11UE 11U1ÐUSjQRPxPjEPS4]Ð1]ÐUWVSdju%5ǃ#EPWk:uE%p= EEEEvEUEUEUUM9uݐEU9U|[~Q11ɉEUE RPuuM1f W.؃e[^_f9EsvEUEUӉ1ډt ]uVf]uI@e[^_û끋Eؙ} U1nUWVSTEPud9u Ep 1hj@h@\YƃRPhSlXPVhSSXj SMtj S8tuSRt&tEPS8uEpu9}u VPE uh@u01e[^_à VPE 1e[^_Ë}Ujju uÐUE U|#~@Ív=wRuPu0ÐU (@UU(@t (@Ð(@'@U(@(@'@UWVS Eu }UUt&5h@PR5h@jjh@iQ uBtPuW5h@E5h@jjh@7Qh@Ee[^_`Nh@ V^ZSPxRZY5h@j RU (@tEEPuu uf(@'@U1ÐU1ÐUSf=@y]f h@7 ƒt:QjEPRa@E8t@]f@uf@̀@=t779t1@xhm@h@V@Vz779u h@thm@PU@듍vUVSut e[^Ë@t NC9HuB9Ht=Ӌu@t vVPh<@5@.D e[^Ë R@u 1e[^à vVPh@5@C1 e[^Ë@뮐USjÃtIu(EC@@@u+1]à S@]f]f EpuPh@5@:C1 ]UE@EVfUWVS EЉU)ЉEu@t6J]A%9u2JA%9u@t(J]A%9E;A@@ߥf u$^_PS 1fǁ@ =@@vA9u}cQmE)ӍS0A)EgfffEE)B0A)UE0A@e[^_ÍvJA%9uE;AUe[^_à R7u@@f} {S@USU@?t @Cu@[ÐUWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1UW}_OW wEGEG GEG _U}E ogw _OW wÐU]Ít&'U]]u}CvMsV tR@Ѓ@%=t&ftt]u}]Q)믍t&@@֋~t11҃9Љw~N1)=@@A)AVF ޭޅttYPtOAtU @fP +PA +A9R @G@@]u}]ËVfQ맍v9 @tQ9 @t=tABAtA 1)@@A $ D$} @뷋A@륍'U0VS @ @,@,@9s։ D$ $}ۉt11҃9ᆳމw1 AqA AA@@[^]Ív Ft&P|^~,@t&9t&wv|.~5,@t& @t&w0,@vwv|ލ~,@t&@@$&UWVSt&@@MEEE(Mtы@! @5@Q ]UyЃ1҉])9o]N M~E]܍M1E)9ӉMr9w/;M܉EUs/F%ƋF ]EE~f;M܉5 @rы_C)9EwK)ȃ)9EvWӋSuSG L)9Ewu}EGt 8ƅf1hfL QA UQEyACKGDGE1ҍY@@ڃt )ÃfC[^_]ÉE}tETF^05@E;11FKAA y]YEAGDGFE@GG@ GG@GxUGPGMHGDGE1@@GXڃGWPGG@ GGx]GXGUPGDG댐UWVS } u0FCP X9<$culjEv11҉H9uUEt1ҍ&MM9u4$ [^_]É)U&xH [^_]Í@Ѓ@%=t ftu@@1돐} [^_]y4$1pv'US] ]$Jt11f9w[]ÐUVS]utU t&tu[^]Í؃tu[^]ÐUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]&UWVS ]} &$Jxu+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$vu<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$uHAEEs{xC{$~uEE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=$@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$W1 f?[D$E@D$U$zuɍFD$ ED$E<$D$U@FD$ ED$E<$D$ @v'UUE  @U]-UW V@S1ۃED$D$$D$ED$E$t&߃ t;>t[@D$ED$$yu˃1[^_]Í& tED$@D$$0E @[^_]Ív'UE,$C@$@,@&@ =`@uÐUWVS }1=v,@t$$ut&9{u,@t$$u$Pƍ [^_]UWVS }1 v9{t+,@t$$_uu [^_]t&,@t$$Wu$ [^_]UVS,@$ƋE(@F(@11&@;Fw,@\$$tu,@\$t$$vE D$F$c^[^]v,@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$x\$D$D$ E D$E$ []ÍUED$E D$ D$D$E$ UED$E D$ D$D$E$a UED$D$ED$ E D$E$" Uuu @0G@0@Ít&UWVS,EUMI=4@G4@0@ Eu&)ċE\$#D$D$$ED$ED$C$wE\$t$ |$D$$bt&1 &0@\$$DrtF;~u0@\$$HrE;u|;~t)&kiV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$F\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$k$c]u]Í&UEMU ]$Eutxv @ 0 t&C 1$ $]u]Í&U(E uu}}]EEEz0@t`$É0E{C<$|$ƋE4$D$:us \$0@$q]u}]%t&뙐U 0]Ít&U j0]ÐUED$8@$fo1tÍv'UED$8@$6o1tBÉ'UWVS }1]v<$D$t&8@t$$nuԃ [^_]0$fC$[$S8@t$$nUWVS 1t&<$D$t.8@t$$bnu [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$q9E r݉4$qt$$D$s&$q4$E q$w맍vUE]utoU1u ]u]ÍvE $Uq$*ƋE $=q4$D$E D$grE tC$1s롸$tE$p$E $p$҉CthtdE$pD$ED$$qE $pD$E D$C$q8@\$$Rn8@1$C$$U]]u$I\$D$$@o4$؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$p3D$}$|$te1]u}]Ít&@eU8@$mjÍt&'UWVS,EEE EFEEE}&$nEF$n]]x;D$E$EED$D$EE$o|$FD$]$oEEEED$8@$NjlED$ ED$E܉D$E$EE,[^_]'UWVSBlD$pL@$@8@$u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$m<$D$tt$<$hm4$^mUDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@B@Bt\1ۅt.@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@@]uu%@@1[]Í&$ti@B$0S@D$@@1[]ÐUED$ D$$1Ít&'UED$ D$$o1Ít&'UD$D$$`@>D$ D$$@"`@t&PS@=@uD@ U=D@]]uu}} G~&@&]u}]Ív tՅt4`@d@Ch@Cl@C p@C1t`@Gd@Gh@G l@Gp@1rfKUS]=D@t=G( t#M `@ `@[]Í&[]Ív[뼉'US]=D@t=GH\$$@u`@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE]e1t&]Í&'UU ~ÍD$D$ D$D$E$1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3 @\$$Gcu@ [^_]f @\$$7c$]#uȉ4$ 1[^_]Í&UWVS1ۃ}9~t3 @\$$bu@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$h@\$ D$@$Q^ 1[^_]Ít&]F9tD$h@\$ D$@$^1[^_]ËE cF[^_]ÍUWVS } @1 f9>tl @\$$au$~Ƹt> @t$$rc @>@F@FF t&F [^_]u@fU @tÍSc @`@$d@$h@$Ðt&UVS @t519pt# @\$$`u[^]Ít&[^]bf&'U(Eu]}t;$+!D$4$NjED$!t.]Ћu}]f@ލ&Et$ D$D$E $"D$|$4$ t&;0tk@\$$Tu$ D$_D$@$@1D$ A3CC@\$$yV[^]&'UWVSE}}Et[^_]1&;8t @\$$Tuމ<$1ۍt&;>tV@\$$Su1D$ D$D$@$@@UFF[^_]f뿐UUD$ c@$@@LÐUED$@D$@$ @D$ GA @U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVS2N1ɉ‰EE#E$LËE$ KStdfuC.C E\$$M11vD$xE$vKtXC$uOƋCt+rǍ&CC뗐t&$@4OƉ떍F$EE$OJuE#&tcu :F/<$tmED$E$Jt8_4$\$9N$NƋGu/볍&|E$KE[^_]Í&$E$ID$E$;J8$@@E$XI\$D$E$eKaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EEo@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$LҍUUE $T$E ÐU@$@D$ED$3ÍU`@$Ít&'U]&US$d@]t$D$ $É[]Í&]ED$$=؃$[]fUWV1S }'`@$st4$ t7`@$t7 [^_]f`@$u`@$t1fʍ&'US$d@]tE $D$ $É[]Ít&]ED$$ =؃$[]fUSd@]U u$T$<؃[]Í\$D$ D$$ []Ít&US]$NJ\$$td@t$ 2[]Ðt&D$@$<<ؐt&UVSD$j@$@ wD$ D$D$4$5 Ƅw`@D$D$@4$$`@D$ D$D$$D$j@$@[ )wD$ D$D$4$ Ƅwd@ZD$D$m@4$6$d@D$ D$D$@$D$j@$@ wD$ D$D$4$ Ƅwh@D$D$m@4$h@D$ D$D$$$cĠ[^]Ð`@d@@h@Ġ[^]Ít&D$m@4$ h@vD$@4$ `@*D$m@4$ d@U1]É'U]Ít&'UE@1] U]K&US]U taҋCu@CC{%t't#9t$t&胺1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$Ft$u\$ D$@F$wƉ]u}]Íu \$KS<$6C $6U|$T$$#F\$ D$D$@F$ƋC $6뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$%@F$4$ж딍US$]u$[]Í&Ct$ELED$ D$D$.@C$ D$Ë@ D$E$CC $C$;E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$31҄u뱍vC!C$辵뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$7B$wt&tyvC!C$莴:vK9Crt$ED$ $BsY&{Cft$ED$CC$Asv'U]]u$i@U $D$T$ D$^$D@]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$賹tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$0@$0@@EED$ D$D$7@G$Ë@ <9}sE<D$@D$E$?C $$,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$_utRu4ttG!9u܍f]v֍ovɍt͉$v#G!9uIvvE<$ED$ D$D$7@G$wË@<9}sE<D$C $@/t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$; )čt$<$;9s@a<w%$\@vЃ|+uf<$U;9rE1ۉ$D;UT$D$F$k<E$ ;t$ D$@@$D$1U$脮w t Nun1ۉ<$le[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$M:$"FU$T$9$&ËFCFCF C FCFCFCFCF C F$C%C$$跰D$ D$$D$C%4$?v'UD$I@$M@Ít&UWVS] D$j@E$~C$# D$m@$N84$t$ D$D$<$uNh@D$D$8@$4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$';1[^_]áh@D$@$%@eh@D$@$@11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$,~8$t 1҃[]f[]Ít&'UWVS$ 1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|t@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UE]@ÍvUE]@ÍvU]u5@D$5qD$ Ӊ $\$^']u @]Í&'U]UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA + @ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@$Ðt&UED$@$Ðt&U@]ÍU@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB$D$*@D$j4$"$*@WT$t$$>$\$D$D$$D$ 请]u}]fUED$ D$D$3@$ÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$<@C$u$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐU(0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$(D$$FFF D$D$$LJta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$bEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$躆\$UT$M܉ $ \$E$FU F$E] UMV~HU1fC D$CD$EE$ MC K9}MƋVT$D$U$f F D$$ 4$|UE ]u$tD$E$N$]u]ÐU1}]fU1}]fUU t t   ]Ðt&]ÐUE] ƒ  ЃÍ&UE]0 ÍUE]PƒA ЃÐUMAЃ vAAƒ Љ]fUUBЃ vBvB]Ít&]ÐUE]AÍUE]aÍUM~ u1]Ít&AAƒ Ѓ]ÍU1U~1 ]É'UUBw ]Ít&'UUBw ]ÐUWVS ]f$u<+E<-<0E}1EmfB;EJ~-$*to$;V;E\$(H)ʉ}9}EE{ƍ4Ct"$u$u߉M tU :Uth}-@ [^_]Í<0C COMERR_DEBUGCOMERR_DEBUG_FILE/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ A?CWDGET_ENVVWarnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c lrwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %d..:/%s: errno=%d console:/stdinconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/create@0@0@@0@0@0@0@0@0@0@@0@0@0@0@0@@0@0@0@0@@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZU@P@P@P@P@P@P@P@P@P@P@P@P@P@C@C@P@P@P@P@P@P@P@U@U@P@P@H@P@U@P@P@U@@o@o@o@o@o@o@o@o@o@o@@@o@@@o@@o@o@o@o@o@@@o@o@W@o@@o@o@@c@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@b@c@b@b@b@b@b@b@b@b@b@b@k@b@@b@b@ @__PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 i@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@W@E@E@1@E@E@E@&@@E@E@E@@E@E@E@E@@Ρ@@@E@G@E@+@E@E@E@E@E@E@E@@@E@@@E@E@@E@Π@E@E@@@E@x@E@>@E@4@E@E@@E@ğ@@@@@@@@@@@@@ @@@@@%@*@/@6@@@H@Q@Z@]@`@c@f@i@l@o@w@~@@@@@@@@9@x@@@@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK telldir: Nicht implementiert IO_ULINKlwIO_LINK zR| T'AB E<_AB E @@@'@@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@*@`$@h$@&@W"l'@G#'@0'(@`{+D-@9m,-@'//@3s7P7@Q`87@<"97@.9 8@>:`8@;09@?>@BA@D`C@gJG@!]KH@MPPN@yUS@][@;9`^@e`@fa@7gPa@gk d@00lPd@dmd@ nd@:um@|vn@w0n@#xPn@{@o@xt@Є@(@@$@ @ݡ@@?ȥ@F@@@ر@f۳p@SЭ@@ `@͸Ю@f@@д@2@A@@K@-@@Js@-@~@9Xм@jp@ @]@9 @@_JjtmainQprogram_namecdone_stringusys_page_sizeRIext2fs_u32_list_findext2fs_u32_list_testext2fs_badblocks_list_test#ext2fs_u32_list_delzext2fs_badblocks_list_delext2fs_u32_list_iterateext2fs_badblocks_list_iterate9ext2fs_u32_list_countfext2fs_u32_list_equalext2fs_badblocks_equalext2fs_u32_list_iterate_end2ext2fs_badblocks_list_iterate_end\ext2fs_u32_list_iterate_beginext2fs_badblocks_list_iterate_beginext2fs_u32_list_addext2fs_badblocks_list_addext2fs_u32_copyBext2fs_badblocks_copyext2fs_badblocks_list_createext2fs_u32_list_create%ext2fs_sync_device) *ext2fs_get_device_sizeG#ext2fs_check_mount_pointext2fs_check_if_mounted "ext2fs_llseekf#_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hook'het_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list#{+Perror_table_namem,__udivdi3j/?%errnoQ/init_memory_managerfreeZmallocrealloccallocs7ostrncpy`8dstrcat"9dstrchr9dstrcmp:memset;9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoul?librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEBtimer_cancel8timer_callbackytimer_registerDrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*Jnsyscall_psyscall_v]Kagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsP7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killU=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatR]Plgetoptoptargoptindoptopt+opterr=optreseti9`chmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstategettimeofday<fgetuidgeteuidgetgidgetegidGgvwaitpid,waitXwait_child_addqinit_waitpidgkxstrerror'0lZrpcsend_messagemnyieldRn,io_split_filenameio_get_absolute_pathZio_split_dirnamed:uget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"vnset_rpc_handler#wyadd_intr_handlerJ#xa)vfprintffprintffprintf_putsn+fprintf_putc{}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#x Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6_exit2abortGatexit{exiti 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf87srandsrandomrand random{$ gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF0vprintfcprintfprintf_putsnprintf_putc8ݡsprintf_putcQvsprintfsprintfa_assert;ȥ~]snprintf_putcvsnprintf!snprintfFPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ysyscall_timerdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_nameرlio_seekV۳create_shared_memoryopen_shared_memoryclose_shared_memory ysyscall_putsn!get_tick_countq`mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6͸nwait_for_rpcv_and_wait_for_rpccfppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupperdstrtol2list_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspnostrncmpdstrcpyostrdupsostrlen(-Qd__strtok_r strtok~omemchrXomemcpyjrunlinkoaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4 io_remove_linkio_create_link__umoddi3fQ@@q@h"intXI5Lf7e~t] (e 'eoy.Z%1H id2# <3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzH%I3$c-vl3d@@k@@q<b7IY+,3fbt@@h"intXI5Lf7e~tye] (e 'e0~y1yo.Z %1n id2# <3n# pid4# .5# 7# 8# >9# :A# 4<# A=t#!AO>]4z,! s   % !# 7 "#' ~ 8e   C p`4 q'-~_%#num3#vt@y@2dev3PHR"QL?b|@@^IW@@We@1@9strtmpnretIxtn3i34@c @g*%3$*c3 n ! nt@ n` nin0!3tL!etP O KH! 3tX '3dev3  /ed!KZt\ 3n~"(`#9 v$G%H&S&_'k @%x ehn(eZ)3))3))e6e*qd @r @+"p,retrZt @ @ @ @3- @< @(\HT/enie^nbe!\hptr Ll .Jn/tv1/tv2/bufn0,hr3,min3,sec3.41109 < @ @2ī`2#@2~3len34lɝ$$$}%& 5&6 56$$%7\  U @ @j %3A3 @@ dev?3 H? try?3 ?3 @ gotB~ 8tv1C`8tv2CX*3@@ 9bad :7 u3@@U M dev3 H try3 3 7 got~W -@@ w  ;\ 1 se@4@ dev3 OC 3 K eK    S u try3i39! h / f ,3 n3got3 3k 3   !uD  0<-5\@=w @D@q $ !3@!e@ e   e3e4@@R dev3~O36KVe!HtP!tT / i 3try 3got 3 , 3  n 3- !eM! @e@@y dev3O3-K}e 1try3]got3} e >@l@i3 e  2D3d@2E3h@2&G3`@2rH3\@27I3t@2J3x@2K`|@?L32M3@2Nel@2Oep@2[P@2i@2j@2k@@outl0@2m@2n@2ސ@!3@A Y3A$nA '3A160Ab70A80B>A@BB @B<Te$@fbO@`$@Hoh"intXf~t]y8VCt'dp`p :# num:# ":# _# :#4q  qC :# bbC# ptr:#stt A ptrk pk "m ptrk ppk  m"m ptrk pk >Im"m ptrk:@ @bbC'blkt^low:~<:mid:): @2 @%bbCblkt:4 @= @Q#bb͘blk͂Q:@ @ @}zbbCblkt:i:( @ @FbbCblkty: @ @rNblk_bb C: @ @9blkYE: @!@fbbDC&2:!@c!@>bb11Cjbb21C?:d!@m!@bb1>bb2>#p!@!@2"N:e!@!@(x !@!@A,!@!@e\+!@!@bbCret!N"#Ne!@"@?bbretl"@#@kbbkCblkktmKin:jn:!! om" v#8$Y#@#@bbblk%"#@#@&" :num : & _; ret!'bb#C$q (X&#p(-3'#@#@ #@#@$ )ep#@#@/x p#@#@CP#@3$@ BsrcOC & O!QH!c\4$@=$@q!|srcZ* [| G@$@P$@!retF|*"F:+?P$@`$@!ret>*">:*f O`$@g$@"oh"intXf~t]y'd# 5u`$@g$@!fd4:6 4:f Oh$@&@woh"intXf~t] (VF )V (V )V/ *VL +V ,: -Vf .V0dy4`a#o b# c#] d#  ek#( fv# g#i#T k# = l#$ m#(v n#, o#08VC'd % A  :h$@$@!"* fd:M"  v" ch%s $@&@"  {" :" fd:/#rc:# : ]"<#low#out#%@ st%@%@mid #  Y:f O&@k'@ oh"intXI5Sf7l~t] (l 'l (lF )l (l )l/ *lL +l ,: -lf .l0zy.a%1id2#<3#pid4#.5# 7#8#>9#:H#4<#A=#! % HO>]4 4`a#o b# c#] d#  e#( f# g#i#T k# = l#$ m#(v n#, o#0 ' z  % t :{fbuf cp g ret: %N #&@T'@ $/ !5$! "n ": g $%fd&:(U$w$ :6 QT'@k'@${PP\ f Ol'@'@( h"intXf~t]yo : {rl'@'@$fdz3 zr % z3 Y3[ f '@(@ k !0a :oh"intXI5hf7~t] ( 'y.v%1Tid2# <3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`'  :J ,    v  %V 2'@'@% O 0x0vfmt01% %   % E_'@'@%_ D%xF&   P_'@'@&xQJ&5 '@(@]&O &xv&fmt&%,' 9(@(@L'9O 6x7vfmt80 :%x'8F k .(@dM f (@D-@ oh"intXI5Sf7l~t] (l 'ly.a%1?id2#<3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K'z  #z# :#    % J # #   l  Q:(@(@'  \:(@(@' ?Farg, (@)@' ?(fn?Z(tmp?x(fd::)0: a)@*@(et(elV)el2 a*@`+@)0et)el :`+@r+@0*ZO 97 et+@D-@\*xda*  f:tletg* hatp i:cpj?*!E -@",@,@msg#%$% H3@ :@ 0@ V& Y:' 5@'s 6@yfb D-@}-@bo'7]D%intl >D-@}-@0+num,\+ chI{+ iI p+% % ? Y @ % buf@=f } -@.@int~]ohf" % , X t   *     low`#<`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0k _-@.@+n^+d^,H`A7-`LWbm4,x,,----t`-@-@1.$.@.@Z..;] 9 /@/@B7@intx9 /@C7@jh"intXf7Z~tyZ] (ZIJ#J K#Lh#"Mh# INh#OM#w OMYM#J ZM#%[#\Z# "]h#^h#s3 z3  s cO nz i3   ptr3  3%~ d s1 s2d nz kk x xjqoZ ) s c3 nz i3 /@/@. /@0@.ptr/minMQ/majz/x-h/SF/@K/@`/@/@m/@/@~/@/@/0@80@hh 0@0@!0@h2@/Z""h 0#sth0 maj 1@P1@$R0%m~$p0&p >p2@5@0'=z0e ?30@a1pA1Bh1majCJ2minDM.3 EM3"Fz3`2@2@ZS2@2@P`3@3@`3@3@p`Dhh4`Q4@V4@LL5@d5@h4&'%5@7@4p4'"z35ptr5minM5d z 6.hI6S5@5@0`6@6@m(  qs.$$87BMg6X{6`6@6@i`6@6@^&R 7@C7@6' z6'" z6d3p6 ~&7@=7@&7@=7@)R* b@*nc @+YeM,3*f3,@*9g:@* h:@*k:@*El:@* m:@-q.A* P7@7@h"intXf~t] (O*P7@7@7dst):7src)|7n)d7Pd,Qs-R o  ?7@7@&h"intXf~t]H#7@7@7s"!8T"@8O$o -b7@8@ch"intXf~t][+7@8@k8p*8ch*38c,Qok 8@^8@h"intXf~t]t*3 8@^8@8s1)9s2)D9o{`8@.9@h"intXf~t] (O#A%Oy2<`8@.9@c9:9c0:39:d9 t=d: c?z: dstA: o509@>@gh"intXf~t] (O#d09@i9@:s";"d5;len$dT;  o /p9@9@r;Cn.O;s.C;.O; st0IKi1O<y;OT< ht5O YY  ]:@h:@r<str<3]<3 = c%p:@w:@'=str 3:@:@S=1s1s2:@;@=ɸ=end=˽]̽_ͽ^neg3>3@>out;@  C ;@;@S> end  ;@;@>KendEV;@_>@>D>DO?D3{?FV?negG3@out<@*3`>@>@@s1>@>@@13y>@~A@h"intXI5Lf7e~t] (e 'e0Zzo y , !-# .#  A/~k>@6@@ A/jZ5A"jZAjAil3KBqZiBErZupOe@@@Z@@BdABdAeF4`@@6A@B4ECEGdiHZ?CHZ]C9@A@~A@{C^i:Z:6$@(4 @  1 @  n2@#'A@C@h"intXf7Z~t] (Z'n&(#")o#L*zo  &5'#C(O#  ZaA@A@C2 C`OCgb2ic3C /OA@_B@Dy CNO=DgP2iQ3D,O`B@C@D 5+D:+Oid-OD52Eg<2i=3ES#,@>$O(@/t`C@G@}h"intXf7Z~t] (Z 'Z0|Ooz 3 pid4O# E5O# 6o# 7z# 8 '$ n&(*# ")o# $L*Ao tpids|EsOu3vr`C@C@.Epidp|EpOq;TbC@C@ZEpida|EaOa3SC@D@EgpidQ|EQOROC D@PD@EpidA|EAOlenAoB; APD@lD@ElpD@E@ F{pid|6F;UFotF;FEOF{Kg\rF}A H!{1E@E@Fpid0|0;0o0; "2!;E@eF@G#pid|HG$;hG$oG$;G%;G%G%OG&3pF@F@Hpid|-H;MHomH;H3HH&uOF@)G@Hppid| I;@Io`I;IOI߉I'#L0G@G@I/J|JEJOIJKoiJKzJMNzJ(=3O4@)(:*j.0@0zG@G@h"intXf~t]oG@G@J G@G@J|rH@MN@h"intXf7Z~t] (Z 'Z3pid4O#E5O#6o#7z# 8 o   'n&(#")o#  L*y(V!)#*#+1 H@&H@*K3VK[͙ V 0H@WH@vK3K[C`H@H@K!BKiD3$L[EXH@GI@BLd!nLi3L[L  PI@kI@L!L[MepI@I@2M d^M"doMhM 3J@_K@M_!N6Nh3nN[N0J@J@ b3`K@K@N<N3N#3K@OL@ Ostr"6Osep$VO7.otO!/|3PL@eL@O \pL@sM@O!pidZ|OEZO P""Zo"[z #]zud#)^ouh#_oul_o*P$i`3up[a ?6M@MN@=PU>=|iPM@EN@ AU|PM@EN@>CP!KLP #L-l8@ %Y3PN@S@h"intXI5Lf7e~t] 'ey ##A    3 ##3#0#+o3PN@N@PssP@3/Q [3N@N@eQsQ@3Q7&3N@9O@Q%@%3)R >3@O@2P@kR^=3R=R9=s=Si?3Sos@P@P@SknsSidpZ@@ 3P@P@Tsz3P@P@BTs3Q@aQ@nTi433pQ@JR@Tcsig3TcToldr2U i sPR@R@hU@3UUeH3R@!S@U@G3+V[xVg0S@DS@V{PS@rS@V<@z3VVk3S@S@Ww pidjz@j3:WG!C+w`@!N,@!--D@"Y39S@[@Rk !0a :oh"intXI5hf7~t] (" '/ * ,Oy.v%1uid2# <3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  *  U  ] ' n& (# " )#  L *'8 (8#fd)O# |+O# ,O# dupOS@S@eWkfdOwOS@T@WfdOO(!OT@T@WfdOWiO+X qOT@U@IXfdOuXcmdOY3YiO}YU@DU@sap%argOYPU@|U@ap%argOYNPOU@^V@YO8Z\OZi]ObZ:`V@V@uZ ~8V@W@Z7fd}OZ!iO[GW@W@[fdOK[bufk["[" [#{8[#\ret\ $W@lX@H\ZfdOt\buf\"\" \#{8 ]#*]retH] pX@X@q]fd~O]" ~]" ~O ^#{8W^xfX@9Y@^ fdeO^He"e#{g8^oH@Y@Y@^fdGO_"HG6_""Gz_#{I8_#Q_8Y@Y@_%fdO& ':!OY@[@&`7)R`O`(el`fdO a#{%83a)af 8\aZ@Z@|f8za*0f8a+:,-:O[@[@a7)99(!0 @ ()3O@.168.b78.88. YOL&"S[@]@oh"intXI5Sf7l~t] (l 'ly.a%1?id2#<3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % LC:[@]@b ?@::b \Ab :Bab oliE?6cbD?8@  ?8 V4?`@ 1:4@h2:h@E0:0@13:d@#^@`@h"intXI5Lf7e~t] (e 'e (eF )e (e )e/ *eL +e ,3 -ef .e0sy4`a#o b# c#] d#  e#( f# g#i#T k# = l#$ m#(v n#, o#0o.Z%1p id2#<3p# pid4#.5# 7#8z#>9z#:A#4]4|  43^@^@_c 7)3 3  C3^@^@c {B3 B u3 ^@*^@cN 7) ޾ 30^@:^@c 7)  /  o@^@J^@d  3P^@g^@;d < ̾R3p^@1_@gdDfQDd|QJdposSsd   3@_@_@d{3e|J.efDpe y3_@F`@e 7)xe|xJfz3If{{Drf_@F`@dir f | 3P`@`@f7)f|Jg3RgfDpg`@`@buf}(@ Y3]$`@a@0 h"intXf~t]0]y1|y %!f#7"q#"3`@a@g tv! tz!d $a@Ga@ h"intXf~t] (OF )Oy#da@a@g)d a@'a@g/o0a@7a@h5o@a@Ga@>h8% Pa@d@ h"intXf7Z~t] (Z 'Z'n&(#")o# L*o y  )  pid*|#+ #,3# VBCCpidA|iC3DC 8nvpidm|io3pCj|Pa@Nb@jh&pid|h&i3=iCQiha@a@#H.oi7Ib@Db@Vhaij 3|Pb@sb@iX&GTb@c@ipidS|jVCoutfc@b@b@V#..j7 c@c@Ljqpid}|xjE}O"}oj~zjCk K#.#k7!#.6k7"e9c@d@Tk#.0@ $Y33' d@Pd@"h"intXf~t]oyd}*r d@Pd@kr)37 + @d ? V'h$Pd@d@M"h"2>intXf7e~t]orpc"Pd@kd@kpid!Zk #ZP 2>pd@d@kDpid0Z#l 0ZNl E0Znllen1Zl 1zl 33P :Th ZT Dw(d@d@"h"intXf~t]od@d@l((d@m@"h"intXf~t] (Ooyo'n&(#")d#L*  &    v/ 1&2#3#5&# o6;ppcwd}v!3ppcwd}v!(3i)3FvDlenEdEEGv oid@g@m<h0mhpNmh3mmjugposkm!luhmulnvmwdn 0!!!!H"#f@Xf@(!!!!h"#Xf@f@[!!!!"$f@g@!!!!"%Q}g@g@n&<nv'-pn(@g@g@'}o'd/o@pi33v):d9p";di<3=vc_]pH]}^ib3cv%}g@k@BoZ&<nov*-pud!3'"do'$}o+6(h@uh@r!C,Np"Y"d-|!,p,6p",Tp,rp-(!H, p,)p,4p+@(j@j@!!R"^,jq"t.j@k@!!!,Aq,Uq/}k@m@hq&<q'E)}q*pul'"dq'vq-@+!R"^,j&r"t.vl@m@-!!!(,Zr,nrA+Ym@ n@$h"intXf7Z~t] 'Z (Zoj'om@m@r pid(or:8om@m@r pid7o 9orrVom@m@rm .TO uidTz T Uo pidWo+s Ikm@m@>szn@ n@js {s,n@#n@`%h"intXf~t]on@#n@s{,0n@Cn@%h"intXf7Z~t]o!0n@Cn@s O],!Pn@2o@ &k !0a :oh"intXI5hf7~t] ( 'y.v%1Tid2# <3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`{  O :q  O  O  :   hv# #arg###fp$## k4OPn@n@tfp3#T3ap3%5 t6h<On@n@-tfp;#T;ap=%>OPM/On@ o@Yt%arg.%t8.tn.Ot  [(Oo@2o@targ'%c':'u.!@o@ t@&h"intXI5Lf7e~t] (e 'ey.Z%18id2#<38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3 @o@do@FuYopo@o@ru|3o@o@u d3o@o@u,c3uo@o@cs>u{8o@rp@,v 8Xvpos3vc3voXc3p@p@vc3vp@p@cs>u{U3p@,q@,w neXwstrYw 30q@q@w7strYx/q@ t@>x~0jx<1~~"2zx>V>V)@1$`@b%d@&h@Y3 /A!t@̄@l(h"intXI5Lf7e~t]o (e 'ey.Z%1?id2#<3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#E5Z#6#7# 8a 7id8# 9#:#f;Z# <?Iid@# A#B#fCZ# DI# AX EOyidP#HQcUidV#MW K  z& zres {K#- |#% V 2%"1_3E%t@t@xc8 t@%t@x30t@At@y&_3Pt@Yt@Ky7)^3`t@Au@wy_yH?z3=z" _f ?out8t@ R3Pu@{u@uzQM3u@u@zLHL?"LG3u@u@zFHF?u@v@zsrc%{ D{b{{"{{q {v@v@{  A  X3v@Xw@|7:|"p|Y3`w@w@|u| yp!t3w@Tx@|"}#ZR}hs`x@x@p}g} npos} w}  N3x@jy@~dMH~ Ms~~ M3~$py@y@~y@{@. Nn" 83{@b{@G:%str77%3p{@{@sc$3$&ch&zu{3{@|@c3 E!9 |@u~@V " " Ɓ""6# \'p  "()'  *.",L@}@~@*i3_+E{F3~@~@r E,cGzԃ]?~@@u  \? \3V\v,i^3,c^3!K@@҄ "7)J"J-L?up.msgR +HSE*iW3`# ~~#/+_ z 0^@ @(l3@ك@ k>%k^ Hm _8no,srcq,dstx/߆ A 1!@̄@M "<)"I"i#+/V--@-'.Z@-?/@282 Y3~2!Є@@,h"intXI5Lf~t] (Zoy'n&(#")o# L* (eЄ@2@ d3 msggd hzVi,A, 3E@@T@M3`@@4sLus )1@@` 03Ѕ@@i435u (@Y3 3!@@,h"intXf~t]k !qa {o{3 d {q3 d 3 {   h# # argd#]6^0 +0 3F:OEV{{    # ]#}'|buf||O2V@d@ʈ1V1O41T<3Vrem4OOLp@*@.KVbufK܉%KOxKO(pMuXrN.u`OVHPOQOup e30@W@mmc{(3`@@mK8kn3i3؋3 3@E@ !5"3^#-P@@q!T,$ap,f%.ud"/3%03ul"B03ю"N03&"\13{"q23&i33#3@@& !mR!T$apfn&tS"3J"{"V O"!O""O["#Ov'$O"%3"&™(?@)&ret23 )0 &ret=3J)H'"8~) &len3Ӛ&pad3)e&ret3*@@&ret3)&ret3[*ƍ@@&ret3*g@i@+ret3P)&ret3,@@&ret3.,@?@&ret3*l@@E&retX3؞)-bufl %m])H &ret~3.` }/0K1]) +buf " 3)  &len3*@@+ret13P*b@@!&retH3*@ @?&ret 3ۡ) Y&ret#3*@@w&ret?3N*@ݘ@&retC3*ݘ@ @&retE3)( &ret-3Ԣ)@ &ret3),@@&ret)3h*g@@ &ret^3ȣ)X : ":) T "V*h@@r &retS3 &retY3) &c{ &ret3,@@+retc3P2{ 3 45{6 B3o6!@@[0h"intXf~t]o('On@ @a| K@@ JO n L 23 @r@ rnd33A]@@ 3@b7!@@0h"intXI5Lf7e~t] (e 'e0sytm$".K #3# $3#L%3#&3# Y'3#(3#)3#*3# +3# o.Z%1 id25#<3# pid4#.55# 7#8z#>9z#:A#4@]4 )    +  7 F  7  R   i A G Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec <  c     T   Sun Mon Tue! Wed" Thu# Fri$ Sat% & <' ( AM) PM* `+  ,|@+@${P{p3- 3צ}& @  `0@W@$ __l bu|h o`@{@! $ n0@@M6@@ybb htm @@$ ԋ@Ǟ@ѧ$ ݅ zО@s@str)&zaըtmbi.c. "z3nz\Hni .3..D@@tCEutvG u  3& tm"@W %L@&L@r,3`@b,8! @٣@2k !0a :oh"intXf~t]y{O :qO O :   h# # arg#<O @V@cT;ap;%=lCO`@z@ʫTBapD%EOPN,O@@arg+8+"n+OXlen-O\%O@٣@arg$c$:9 !@q@(3k !0a :o{LRggn:int q{gng :   hA# p# argn#   H!# " #:~r &g@@٬Karg%Kc%: -g@O@H,1T,\ap,%|.l /`0g <gP@q@H;T;ap=%>gP; !@@3oh"intXI5Sf7l~t] (l 'ly.a%1?id2#<3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  '@@ۭ % {%2 %:] &:  % 8 Vz;!!@@Y4h"intXf~t] (Ok !|a o{3 o q3 o 3    h# # argo# "W H#W# !$d# %d# )3@$@arg(Ԯc(   C30@@L!HBWx"BdTBίapBqD d EXF3 U3@@!HTW"TdTTapVqW3P<X!!@@4oh"intXI5Sf7l~A!8~t] (l 'l0y.a.!/H%1`id2#<3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %!&# '#"(s# )#@ *#W +# %  J!-!$!!E)#' l -%!*:P)!@ۥ@Mn!C@@yE)B'DŰ w2@@Dd!P @P@?E)O';dirQ![&@9@Q)e2?@L@S!>:P@Y@y=! = =:q!0`@@/!ѱ5 H>'@զ@5h"intXf7Z~t]o!!@զ@%C O: O>"@@W6h"intXI5Lf7e~t] (e 'eo 3 pid4Z# E5Z# 6z# 7# 8y "HJE !KE# L3#@ }"Mz#D "NU#H U? Ad!3@1@Q"res3}5"3@@j@dev"z!p@ݧ@ڲSؒ$S&%zFpos3q"3@M@%۳%3uppos3"P@¨@%3-supret3$ %l"CШ@@@Q!BG"l@T@l;cmdk#k3ڴpidmS"pzuh"q;"rul!z:"zMJ( <`!YdirX !z_"h J Y h w#"X`@ @W3!YmsgZ"1@ά@!0!2msg3 "NЬ@@>pidMm@ #@f@7h"intXI5Lf7e~A!8wt] (e 'ey.Z%1Cid2#<3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI# Jl# K3# >#Ld V #.@f@j -  -lض -3 "/d,Aw#p@í@8h"intXf7Z~t]#%zo#Op@@"O idOEP#z@@X idO o c#@í@ idOA#Э@@'9h"intXf~t]otd#3Э@@÷nOsnFB#@@^9h"intXf7Z~A!8lt]o#!a@@eax"Oedx"ORiB#@Ǯ@9h"intXf7Z~tyZ]F$$h#%o&A$'##(z#3$) N$! " O  O ptr" @A@..  h#1P@n@Z"0O0O ptr2 2 p#7p@@"6O6O6O ptr8*$G3@@3"$F"FOHO޸$U@Ǯ@"$T"TOC_$Ю@@:h"intXf~t]ot$Ю@ܮ@n$ @@ID$@ز@:h"intXI5Lf~t] (Z%)3 'Zo $$ x% % $ ) *# +z# len,o# %/& num0o# $1&#5 $4z ppb5z# $6o# /%7o# $8o# %%QoldP PoS%PonewRA$>b?5<%Y@\@uYppbzo oleno7I%ovi3Q%3`@@ppbzoi3R%3 \%@*@+ppbzJou$+%3 i3Qarg 3j%b3b` `alenao $co d3newe!"""!#$$3bshm3 "opi3 $3  z $$30@@9$9Իbshm3?p9k% & #%1 "a"V"K"B& 'l#w#(i@˱@k"""&@ #)X "&p ##''Ҽ''#?%@ز@0*{Ţ$9\shm3|retȇ+Y3IF%@Ŵ@9<%4AAc3Aint%9Adc8A% AcA%*Ac)A&HAcGA%MAcLAd@@v%%A@@νc$A@/@; &&/A0@I@\ec.A%P@d@7Hp@@Z%>A@@ c=A &CA@@+ cBAW@@v@$@3%RA0@d@ο cQA ;@B@Sv 1 HH@b@S %WAp@@ cVAE &\A@@d c[A%aA@Ŵ@ c`A G+&9 д@@<h"intXf~t]4&#]д@@str"&""3$]_"&%3 &%'3 o Y3G&&@@b=h"intXf~t] (O'n&(#")d#(J ##$o# L*q &N@ȶ@ M?  &Vdж@@^7 U E&@y@  3R7n3 V&o@@  3&ݿ&o@B@)HU3 o&& &( &oP@@ Jj&o&B@@ A '@w@' ! 3W o'X@w@& &h@Ϲ@n g go]m 6й@@}7;&+@u&,3@&-@I+'@@m>h"intXf~t] (O'&zy#'%d@@s$5'$s1* bit+o tbl,Lidx-33  o oI='@ @>h"intXf~t] (OG'%3@ @Fs1#rs2#n$doIJ['@=@V?h"intXf~t]T'#@=@to")O'"HO$o Jd'@@@?h"intXf~t] (Om'&@@@sstr%len'd( o  TKt'@@?h"intXf~t] (O}'$d@@str#s%R oMK'@@A@h"intXf~t]'2@Z@;s1g'1'1'3Otok3mc43sc43 '@ o   '``@@ s_'_'a@L'@ɼ@@h"intXf~t] (O')@ɼ@s&c'3Wn(d p+R    AAM'м@i@@inth"Xf~t] (O Aм@i@:'::d$dstBqsrcCtDd'}@   o   M'p@y@Ah"intXf~t]yo''3p@y@7)'k:N'@ݾ@Ah"intXI5Lf7e~t] (e 'eyo.Z%1?id2#<3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K '&3@ݾ@ <%%3f)/ dir-M  V dY3'O=(@@Bh"intXI5Lf7e~A!8wt] (e 'e0~y.Z.!/A%1Yid2#<3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> (!("S#Y(## _  DIR&l%"!&"# '#"(l# )#@ *#W +# _2 J!-Q(t@@ksdirss s~ '(i@3@dirhs(]~@@V@dir\s'C'`@@'dirBs(D-;1(JY(P' w 2`(53@ @_dir4sI(*s@@!) _PP) @@Ch"intXI5Lf7e~t] (eo 'ey.Z%1?id2#<3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z([#(\#(^z#!_#  a )`dc(d#(fz#!g#  a(h (3 @@(/3@)?ul2)?(@x( (z"z,H  V  a  i(33@@@(1l(1M)2Z43z)5x(62)G?v@)H?(O@(-@("@@@(mz"nzHor  a Y3cQf } @@Eint~]ohf" % , X t   *     low`#<`#  s llv  M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww  km1km0kV)S@@uRIvRwT VA7- LWbtPm*xi8l,@0@@@% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  I&I$ >  : ;  : ; I8 : ; I8 I !I/  : ; <  : ; : ;I8  : ;I8 .: ; ' @: ; I : ; I .: ; ' @.: ;' I@: ;I: ;I4: ;I.: ;' : ;I4: ;I : ;.? : ;' I@ 4: ;I!4: ;I " U#1UX Y$1% U&41' 1(' I)I*.: ; ' I@+: ; I,4: ; I-.: ;' @..: ; ' I /: ; I04: ; I1: ; I24: ; I 34: ; I41UX Y 54161UX Y 741 84: ;I 9: ; I:4: ; I;.: ; ' < : ;=1X Y> ?4: ; I @4: ; I A4: ; I? < B4: ; I?  % $ > $ >  : ; I$ >  I : ;  : ; I8 : ; I8 .? : ;' I  : ;I 4: ;I: ;I 41.? : ; ' I@: ; I4: ; I4: ; I: ; I .? : ; ' @.? : ;' I@: ;I: ;I 4: ;I: ;I : ;I.? : ;' @1X Y1 !4: ; I"1UX Y # U$41%.: ; ' I@&: ; I'4: ; I(1UX Y )1X Y *: ; I +.? : ; ' I@% $ > $ > $ > : ; I.? : ; ' I@: ; I : ; I % $ > $ > : ; I : ;  : ; I8 $ >  I &I .: ; ' I@ : ; I : ; I 4: ; I .? : ; ' I@: ; I 4: ; I4: ; I4: ; I : ; U 4: ;I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  $ > &I .: ; ' I : ; I4: ; I4: ; II!I/.? : ;' I@: ;I: ;I 4: ;I4: ;I1UX Y1 U4141 41.? : ;' I@% $ > $ > : ; I$ > .? : ; ' I@: ; I : ; I : ; I 4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ >  : ; I : ;  : ; I8 .? : ; ' I@ : ; I  I% $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > $ > .? : ; ' : ; I.1@1 .? : ; ' @ : ; I 1UX Y 1 .? : ; ' I@4: ; I.? : ; ' I@4: ; I % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I$ > .? : ; ' I@4: ; I4: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3xJ /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/et../lib/ext2fsbadblocks.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hsetjmp.htime.hcom_err.hext2_types.hext2fs.herrno.hgetopt.ht@<~Xg[qg^>g˽</6ttz.ZYvNbfkX%Xz]f!7ȰȲ'=Kh@~ u t ֠!X3tXLw"NZ󻑼~z*?ג܃'L~t> JK}<==l~u. 'E.xfiJgfu==׃P!fYh~XY׻/g`Qt/9 #?u+j=~=Z!yfR> Xd<&YZZ dX >Yg?&Yh,?ʕaX"䟟>XYluXYfuRgTM:.S m > l//3Zgg#& .Yu St0䟟ghגJ= .Pv^"/gvgo=z"mt v ../../lib/ext2fs../../lib/etbadblocks.cext2fs.hext2_types.hcom_err.hext2fsP.h@  XjJy?OLz.K =M> tYxti=Wy>w /u<>]:[?(Axtg=uvuf XtxXx?~&\>4KU`>p^fgwttt Ww > wguf  vD/vw.E .%l$'XwhtH /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etismounted.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hstat.hcom_err.h&@S1u!=!=3&XH$g ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cext2_io.herrno.hl'@vAyX /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.h'@1=g.gZKk90=YG.uKhNK1=sxXuA ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h-@}Y/g?LNf~= uZ!LM $ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h/@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJZ: ../../includestrncpy.cstddef.hP7@)Xg[ye_9 strcat.c7@"?; index.c7@*z@tB/@T@04.O.t>>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.hA@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h`C@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.cG@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.hH@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.hPN@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.hS@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k ]D ../../include/systime.ctypes.htime.h`@!<=gw]9 ../../../includeuser.ctypes.ha@"",0",0",0",0 ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.hPa@i+t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hm@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.cn@=gP ../../../include/arch/i386add_intr_handler.cstdint.h0n@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.hPn@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@o@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.hЄ@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io ../../../include/arch/i386../../../include../../include/sys../../includetime.cstdint.hstddef.htypes.htypes.htime.hio_struct.hstdio.h@Bz< \T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h @;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.h@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.hp@?Dx ?Dx =3 puts.cЭ@>(eN ../../../include/arch/i386get_tick_count.cstdint.h@ >{ ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.cЮ@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[  ctype.c@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=8 ../../includestrtol.cerrno.hд@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.h@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.h@$>9LV2z 8 strcpy.c@"JiS9 ../../includestrdup.cstddef.h@@%$T9 ../../includestrlen.cstddef.h@##+.?>\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@(JgKwp@8 ../../includebcopy.cstddef.hм@==? kMY-=]X%k;=-1MK.7Y-=H:'V 6 unlink.cp@&? ../../../include/arch/i386../../../include../../includeaccess.cstdint.hstddef.htypes.hio_struct.hstdio.hdirent.herrno.h@%t? JvN73x<  ../../../include/arch/i386../../../include../../include/sys../../includeposix_dir.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hio.h@gsgrgcg;?+g,02zt4Zd/Yvcgust>T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h @@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@AB 4|@(AB T.4@(AB T.$4@eAB EU.m. J.d44@/D  F AB DV..W.m...B. . b.W.a.t.I.O. J.4d @AB D.4t @gAB T.4 @$AB R.(4 @<AB F.\.z.(4< @sAB IF.p. w.4 @2AB J.`. 4 @AB F.4@AB DI. 4@AB F.4@3AB K.X4@tAB I\.T.Q.~.t...`..N.j.o.S.Z.q.I.b.D44@AB F.S.B.Y.~.N.{.Y._.c.y.D4@AB FN.I..N.c.i.\..[.o.^.| d@zAB Bd @AB F.d4 @ AB A.d@ @TAB BZ.d @ AB A.d @NAB Ad @ AB A.d @ AB d!@[AB Edd!@ AB A.dp!@!AB Y.d!@ AB A.d!@VAB DP.d!@ AB A. d"@ AB F.d#@ AB A. d#@AB FJ.d#@7AB BS.d4$@ AB A.d@$@AB H.dP$@AB H.| `$@AB | h$@?AB DG.,$@jAB FE.t.|.d.|  t&@@AB IG.tT'@AB M.| l'@GAB y.| '@ AB G.'@$AB '@AB ('@AB F].].O.(@8AB ].| (@AB (@AB ((@AB DY.\.j.W.X. )@AB BV. *@AB DB.N.u.`+@AB J. t+@AB F.| D-@9AB A| -@'AB E| /@AB  /@AB FI0@AE Ep2@?AB F5@VAB F7@3AB D|  P7@QAB B|  7@<AB AD| , 7@.AB | X 8@>AB A|  `8@AB F|  09@9AB  p9@AG F :@hAB B p:@AB  :@ AB  :@AB F ;@ AB  ;@ AB  ;@oAB F `>@#AB  >@!AB |  >@vAB FIF @@@AB  `@@AB AFF @A@>AB |  A@dAB F A@oAB F `B@AB E|  `C@:AB D C@1AB  C@1AB  D@0AB  PD@AB  pD@IAB F E@AB A E@AB ON pF@YAB X F@YAB X 0G@AB IFF| HG@ AB HG@AB | H@&AB 0H@'AB `H@AB FH@gAB AGPI@AB pI@AB MFJ@_AB L`K@GAB FFK@AB LPL@AB pL@AB FM@AB F| PN@IAB DN@IAB DN@IAB D@O@AB E@P@_AB DP@%AB P@%AB Q@aAB  pQ@AB MFFPR@WAB DR@qAB D0S@AB PS@"AB S@IAG | S@AG S@AG T@yAB CT@ AB CU@AB F`V@KAB V@RAB AFW@AB OW@AB OpX@tAB LFX@IAB @Y@AB LY@ AB Y@AB E[@"AB | T[@;AB D| ^@AD ^@AD  ^@ AG 0^@ AG @^@ AG P^@AB  p^@AB FHE@_@EAB D_@AB FI P`@AB IFF| `@AB | a@AD  a@AD 0a@AD @a@AD | LPa@AB CLPb@#AB Lb@AB EL c@AB FLc@&AB |  d@0AB | Pd@AD pd@DAB E| hd@ AB | d@7AB Cg@AB Fg@AB Fk@AB F| (m@ AB (m@AB (m@!AB D(m@ AB (n@ AB | n@AB | 0n@AB | Pn@;AB n@!AB n@JAB IFo@"AB | @o@$AB po@AB o@ AB o@NAB Do@AB BFp@NAB Dp@\AB D0q@kAB Dq@jAB H| t@AD  t@AB 0t@AB Pt@ AB `t@AB DPu@+AB u@-AB u@.AB u@AB FKv@xAB D`w@aAB Dw@AB FF`x@AB Dx@zAB Dpy@#AB  y@fAB IFF{@RAB FFp{@EAB D{@UAB FF |@UAB F~@RAB D~@AB II@6AB C@AB @AB I@AB F| Є@bAB E@@AB `@GAB @HAB B|  @dAB FLGp@AB F0@'AB `@AB F@EAB AP@0AB F@uAB C| @ AB @ AB  @RAB I@ AB | x@AB Fx0@'AB x`@AB x@AB x@ AG x@ AG x@AD xО@AB AGx@AB E| | @6AB |`@AB |@@AB FF|@AB | @ AB D@OAB GP@!AB | \ @?AB |  @dAB FGG 0@[AB H @(AB |  @AB  @0AB  @ AB  @0AB  P@ AB  `@`AB FF| !@AB | !@QAB A!@@*AB !p@mAB F!@mAB BC!P@rAB FI!Ш@7AB D!@DAB F!`@AB D!@AB PF!Ь@+AB | #@fAB D| 8#p@AB 8#@AB 8#@AB | #Э@AB | #@ AB | #@AAB LF#P@AB #p@AB #@AB #@AB | $Ю@ AB $@ AB | $@lAB C$`@VAB C$@jAB F$0@`AB F$@HAB L| x%@AD x%@AD x%@/AB x%0@AB x%P@AB x%p@AB x%@.AG x%@/AB x%@AB x%@AB x%0@4AB x%p@AD x%@AB x%@AB | &д@AB F| '@AG 'ж@!AB '@yAB HF'@AB  '@AB FFF'P@lAB FF'@)AB D'@AB MF'@OAB D'й@!AB | @(@AD F| t(@KAB DD| (@-AB A| (@@JAB FI|  )@AD | 8)@AB BD8)`@"AB | )@9AB A| )м@AB F| )p@ AB | *@]AB D| D*@"AB D*@#AB D*@@AB D*`@AB IHD*@AB D*@ AB | * @dAB F*@+AB JI| D+@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdoutabort_badblockssuseconds_tmount_flagsnext_badbuf_usedprint_statusstderrallocate_buffererrnoterminate_addrtest_ptrused2time_endblocks_at_onceline_bufnum_passesmax_bbtest_nds_flagcheck_for_moresys_page_sizetime_diff_formattime_startGNU C 4.2.2forcecheck_mountbb_outputoutput_fileread_buffersave_currently_testingtest_recordtimevalbpattern/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/misct_pattserrcode_tstdintv_usecexclusive_usagelast_blockuncapture_terminatepat_idxset_o_directtest_rotest_rwinput_fileterm_addr__u32time_topen_flagcurrent_O_DIRECTd_flagretvalbb_counthost_devcurrent_blocksave_ptrsignooptindblkbuft_patts_newpasses_cleanext2_badblocks_iteratefirst_blockparse_uintbadblocks.csysvalterminate_envdescrread_basew_flagnum_blocksdo_readflush_bufsbb_iteroptargext2_badblocks_listdiffexclusive_okterminate_intrblock_sizesave_baseuintptr_tnum_savedtv_secnr_patternt_flagprogram_nametest_funcalarm_intrext2_struct_u32_listdo_writesaved_blk_recordpatternsv_flagpattern_fillerrcodeblk_ttest_basemaindone_stringcurrenttotalt_maxbb_listext2_struct_u32_iteratehost_device_nameread_ptrdiff_bufjmp_bufcalc_percentext2fs_free_memext2fs_u32_list_delext2fs_badblocks_list_iterate_beginext2_u32_iteratebadblocks_flagsext2fs_get_memext2fs_badblocks_list_delext2fs_badblocks_list_addremlocext2fs_u32_list_findext2fs_badblocks_list_createext2fs_u32_list_equalhighext2fs_badblocks_list_iterate_endext2fs_badblocks_copyext2fs_u32_list_iterateext2fs_u32_copymake_u32_listext2fs_badblocks_list_iterateext2fs_u32_list_countext2fs_resize_memext2fs_badblocks_equalold_sizeext2fs_u32_list_addext2fs_u32_list_testext2fs_get_array/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/ext2fsext2_u32_listext2fs_u32_list_iterate_beginext2fs_badblocks_list_testmagicext2fs_u32_list_createext2fs_u32_list_iterate_endflushb.cext2fs_sync_deviceflushbst_mtimegid_tnlink_tst_atimest_nlinkblkcnt_tst_inost_blksizeuid_tst_blocksst_modeino_text2fs_get_device_sizeblocksizest_rdevext2_loff_tst_ctimevalid_blkgetsize64dev_tblksize_tgetsize.cst_uidvalid_offsetretblocksst_gidmode_text2fs_check_if_mountedext2fs_check_mount_pointst_bufmtlenis_swap_devicemtptfile_devismounted.coriginllseek.cext2fs_llseekcom_errnew_procreset_com_err_hookcom_err.c/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etpvardefault_com_err_procerrfwhoamicom_err_va__builtin_va_list_et_dynamic_listtable_numadd_error_table_et_listremove_error_tablen_msgssafe_getenvdebug_maskdebug_fet_list_lockstartedet_list_unlockdstrerror_message.cadd_to_error_tableinit_debugerror_messageoopsnextnew_tablechar_setet_name.cerror_table_name/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_managerliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockprevpagesl_pageCountmajSizefirststrncpy.cstrncpy/home/tyndur/tyndur/src/lib/stringstrcat.cstrcatsaveappendstrchrstrchr.cstrcmp.cstrcmpmemset.cdst0u_charu_intendptrpositivedecimal/home/tyndur/tyndur/src/libitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnname/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeouttimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flagsold_posio_resposix_files.cssize_tF_GETFLflags_sizefd_to_filecreatfd_listnext_fdoptresetostrnargcopterrgetoptgetopt.cnargvplaceoptoptumaskmkfifostat_buffchmodinode_numlost_statmknodfstatstat.clstatmkdirtime.cgettimeofdayuser.cgeteuidgetuidgetegidgetgidrunningwaitoptionswait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpiderror_codestrerrorstrerror.csend_messagemetadatayieldsleep.ctextresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuewidtharg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexrnd_seedsrandomsrandrand.caFebaFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.cexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closeio_direntry_type_tuint64_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_topen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cget_tick_count.cget_tick_countphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARisprintisgraphctype.cisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigitoverflowstrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpfromstrcpystrcpy.cstrdup.cstrdupstrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrmemcpy.csrc0doneunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuut u u 0t01u13u3XtXYuY[u[tXsPsSXzRzVttPtt|RRuQuutqtqtoxP;@P/thtt8tRtt5~tDxtDtD<tHtHtH#PPPP/tlhtltl8tlRtltltl/tThtTtT$8tTRtTtTtTaS/t5httxtnttt#PPPPPPXiQQEMPMRQ/V#zVVVnVVPP/thhthth)th8thRthththPP)PuutPuugthiuikuktuu tP V b Ve l Vl p Pp V VRPPP Re p Rw | R R RQ Qe p Qw | Q Q QR Q" a S W c W W Rn S u u ; t V V O Q  Q( I SI O Q S  Q< = u= ? u? n tp q uq s us tp P t\p R tXp Q tTp  ) W) + t+ L WL N tN u Wu w tw Wp  t  ' S+ J SN s S u u = t P S S  S = S P 1 P@ A uA C uC t@ ^ P^ tl@ ^ R^ th@ ^ Q^ td@ ^ ^ W t WtWt@  t S P S P S P SuuKt0FPLMuMOuOtLtLSt St t LtttL; ;StS t t Ltttt~t~t~HNtNW@t@WW1St@t@@ttttttt tttHVH[t[)V)@t@gVgtVVttfPtttttttSP0S07t7ySy(t(@S@EPEsSstSSttuPPtt\ttt~PPPPttuu`tqq{t{vtvtt`55t t ``td dt t` `ttXtX5AtX5t\t\5tStHV\SS0SSVSCvVvSVS5ttpt\S\tpSCtpCvSvtpSStpt`5At`.tdtd5thth<Ath`auacuc*t`4t4ZtZ*`t t *`tt  *t` AVAtVtV t *V`tt  *tt\t\ *t\:t`t`AtdtdAththPPAtltluuztt&P&zt**zt VPV79P;=PMzVQ-9Q=zQPPCZP_zP|}u}utuutuutStSt QQQQQuutuuNtNRP*P@CPPQuQSuSYt\]u]_u_gthiuikukth~~PtPtPth~~RuutuutPtuutuuVt=S=?t?HSHJtJTSTVt::PEEPQQPXYuY[u[atdeuegugotdxxWtWt6W68t8oWdt 88[t [ffot }}PPP00P:?P}SQSRSRS4S8?S?BRBHSH[Q[oS}t`t`B[t`mot`}tptpotppquqsusyt|}u}u\t|PV V04V9FV|R\t`|Q!t\!-V-\t\P((PAAPtp0tpI\tp\]u]_u_t\St\Vt {QPQuutuutuutuutuu?tP5S7=SRQ@AuACuCt@``t@t R.t .t U`W`fPf,W.WPWW*SSStttt`gRQuu@t@tBMVM`P`V5V.W6W;@W@AuACuCWtuuGt  Pt"PR"'t R')t )4PR4APtAGt uu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Suu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt<u<Q9S9<u tt.u,P,.utt>u  )S)+u+8S8>u  >Rttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt uttu !t!#t#ruceQttuttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttutt u PttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P0 Rn8)xRn8)x  R  R  ]  ; ]  ; #LQ#LQ '[f [f'<A<A ` 8@%.8@%y`lBMBP'BP'*3*@&(&(*@&(*@*A$p\\,8KX_r02 (:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)030DL]GIT8"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'D@D-`@` 5x@x\?@F@M@R@(X@@<, ]<f@ uE jR%9E~x+0D`)( ѹp@" =@@D@`@x@@@@@ @@     @@(x@;@H@^@@ m@ t@D@ @ @@@@P@!t@|@(@(@e@'h@ .4@6d@ =x@ Ct@ J|@ R`@ Y@ta\@ gl@ np@ u@ @ @ @ @ d @t @g@  @$ @<< @s@ @  @2& @.@8@ @@ I@R@3]@ k@ z@#@h$@?'@(@@ @ @ )@ -@@6@HS@ `@ s@ { @ @ @ @ 0@,@  $@ ,@ !(@ />EC@SIC@hopD@Ix4@ 8@ H@g@  @@ 0S@Q@a`@ D@  @ @ `V@K)V@R4=8@ HOp^@Y@ cjqx@  c@ @@ d@7#@ .5u@>@ G@ N@ V]@ is@E~@ c @`@$ @@`@ %4CKS\c@yt@ ~@ @ @ 6P@0!.@)o@N14$@ G@-N@ V@Qd`H@m D@0d@ .@pL@Pa@@ @ 0@`@"ж@!E@0a@`@ d@ @O @  C@0 E@? {@UF @OP P@%\ d@0e a@m pF@Yy "@  @( k@ @ '@ 0^@  :@h m@ @f PI@ ^@ P@l @  :@ @a@ 0@ Pu@+( o@- @+< g@N `@V[ A@dh g@} ~@ o@  @  м@ @ Ю@  `t@ A@o @" @ @T @o@$ [@" c@& 0q@k S@ #@7 `C@:8 @@ @H a@O @#Y @Hd `w@ai p2@?p Pt@ w @ `@ !@  @? 0@[ Pd@ @$@ >@! @ p9@ 0@4 0@ `@ @u @/# v@x* '@$; @O @@@e p!@! @ K@ @_ pX@t PN@I P$@ -@' u@- @@ @ @ ^@ @  @  @/" @P@_( '@ 3 @ C д@J 09@9R p@g @ t $@ @ /@ q@j 7@3 @@* ;@  @ @) @ X@I p:@ @_@E n@!S@I@@ $t+@2@0C7@<J0n@[!@VyPD@ @6 ^@  `K@G!@[@!@ *@#@ 0@=x@zC$@jZ@lg4@ n@9u&@@0@'`@ Pb@#pd@DM@@^@ D-@9@@@ P`@t@G@  @RPR@W@Y@ (@ :@ "@*@K2`+@E0t@LP7@QTp@ [J@_bp@x0H@'p@\5@Vn@C@10G@Ш@7@d`@"P@%Y@  P@rp@"@6pQ@@d!@ W |@U]@@Jdй@!p @0};@o`@@A@>@6<@[@;`@`8@4@/)@`x@@@ Ь@+ t@w@%H@&:po@B@G@ Op@W @ d@.l@t@Ap@N 8@>p@@@S@m@!Э@pI@@m0@ ~@RP@!p@m;@ `@G@d@ 'F@Y5h@ < @Q@ YN@Ie(@r@ >@vp{@E@zh@ @dW@0@'@О@@jb@_@ P@y@f@]"`@`1<@8m@ H(@8Pl@U@b@tpy@#{@C@1 @ @H @ @l'@GN@Iu@.P@`>@#4 @ @!n@J/o@"<PL@IU@P(@_G@iT'@Є@b`@@`B@@ @@Y@@@D7@. @d{@R @ P@ (@1 E`$@X@dT@ jP^@p  @ W@T@ym@ PS@"@@Pn@;n@ R@q`@ /@ @O@ @N/`@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startbadblocks.cset_o_directexclusive_usageusageparse_uinttest_row_flagtest_rwv_flagt_maxt_flagt_pattss_flagtest_ndforcemax_bbd_flagexclusive_oktime_starthost_devoutbb_listallocate_bufferuncapture_terminateterminate_addrterminate_intrpattern_fillprint_statusnum_blockscurrently_testingalarm_intrdo_readbb_outputbb_iternext_baddo_writeflush_bufsbb_count.4587num_saved.4583patterns.4474make_u32_listflushb.cgetsize.cvalid_offsetismounted.cllseek.ccom_err.cdefault_com_err_procerror_message.cinit_debugdebug_maskdebug_fbufferet_name.cbufchar_setlibgcc2.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrncpy.cstrcat.cstrchr.cstrcmp.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetopt.cplace.1334stat.clost_statinode_numtime.cuser.cwait.cwait_listrpc_child_exitstrerror.cerror_message.1085rpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexrand.crnd_seedmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cget_tick_count.cmem_allocate.cwait_for_rpc.cparam.cctype.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cmemcpy.cunlink.caccess.cposix_dir.clost_link.cparse_pos_paramslongjmpputcharext2fs_badblocks_copystrcpyasctimeinit_dev_listunsetenvrpc_send_responseyieldsetjmprpc_get_envvarswaitpidtmpfileext2fs_badblocks_list_delppb_from_argvstrtok_rlist_sizerpc_get_responsegetgidprintfstdoutvsprintfrandomlibrpc_rpc_handlerrpc_get_stringungetclist_pushsigemptysetstrerrorgeteuidrpc_get_intext2fs_u32_list_addsnprintfio_split_dirname__strtok_rreset_com_err_hookmknodatolget_parent_pidlio_seekgetenvfchmodlist_poperrnostrtoldgetegidisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelio_get_absolute_pathfgetsgetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirext2fs_u32_list_delperrorcreatinit_waitpidputsdup2ext2fs_u32_copyrpc_send_string_responseislowertolowergetuidrewinddirinit_execvfeofmallocremovelist_is_emptyoptargext2fs_badblocks_list_iterate_end_assertvsnprintfrpcext2fs_badblocks_list_createstrtoul__dso_handleitoaispunctopterrreaddirjvprintfisspacefflushset_com_err_hooklist_get_element_atregister_intr_handlerext2fs_u32_list_iterate_enddirectory_openputenv__umoddi3lseeksigaddsetext2fs_u32_list_create__udivdi3setbufferabortprintf_putcgmtime_rchmodsprintf_putcget_tick_countisxdigitalarmcom_err_vamessage_handlerstrtolstrnlencreate_shared_memoryprogram_namesys_page_sizerenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroy_et_listwriteatoffstatfprintfkillinit_service_registerctimeerror_messagedirectory_createstrcatadd_intr_handlerext2fs_u32_list_iterate_begininit_sync_messagesvprintfmkfifo__deregister_frame_infochdirext2fs_u32_list_equalopen_shared_memoryext2fs_badblocks_list_iterate_beginadd_error_tableext2fs_badblocks_list_add__dtor_end__fseekext2fs_get_device_sizeppb_is_validoptindmemchrext2fs_check_mount_pointjprintf_putcstdinwaitsend_messageinit_envvarsumaskerror_table_namemktime_startlstatferrorsyscall_prandsignalreadcom_err_hookstrcollisupperstrncmpadd_to_error_tablefpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopeninit_executeisalphaclose_shared_memorysigactionext2fs_badblocks_equalfreadstrduplist_createis_directorystrtoullgettimeofdayinit_messagingfopen__bss_startgetoptlocaltimememsetmainremove_error_tableftell__dtor_start__srandinit_service_get_nameclearerrfclosegetenv_name_by_indexgetchartimeopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcstrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnoptresetrpc_get_dwordstderrext2fs_u32_list_testsrandomsigismemberet_list_lockdirectory_closelibrpc_c_rpc_handlerfputcext2fs_u32_list_findoptoptdivmodpreadlocaltime_r__ctor_start__strftimeppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_processcom_err_end__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitdone_stringsyscall_timerext2fs_llseeksigdelsetsetbufmem_allocateatoiext2fs_badblocks_list_testiscntrlfprintf_putsnfprintf_putcgetenv_countfilenoet_list_unlocksyscall_vext2fs_check_if_mounted_exitregister_message_handlertimer_register_et_dynamic_listgmtimestrlenopentoupper__init_execstrchrio_remove_linkfputsext2fs_u32_list_countdirectory_seekclosedir_Jv_RegisterClassesext2fs_sync_devicelist_removefcntlmkdir__register_frame_infoext2fs_badblocks_list_iteratepwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskext2fs_u32_list_iteratejprintf_putsnpackages/e2fsprogs/bin/fsck.ext20000755000175200017520000000000011517101521024032 1packages/e2fsprogs/bin/e2fsckustar tyndurtyndurpackages/e2fsprogs/bin/fsck.ext30000755000175200017520000000000011517101521024033 1packages/e2fsprogs/bin/e2fsckustar tyndurtyndurpackages/e2fsprogs/bin/fsck.ext40000755000175200017520000000000011517101521024034 1packages/e2fsprogs/bin/e2fsckustar tyndurtyndurpackages/e2fsprogs/bin/dumpe2fs0000755000175200017520000171306511517101521016440 0ustar tyndurtyndurELF@@4=4 (@@̃̃̃̓@̓@`QtdSLU=@@t8v@ҡ@ut hp@!@@ÐUthD@hp@ܓ@tt hܓ@ЃÐQSP UWVS] _t&vcvkEE$D$Q:y$M@o,")ċEt$|$ t$D$$p:̓@=ԓ@s& ԓ@sBwҁԓ@rt$<$ád@$$É$Y0Ǎ")čt$|$t$$/oU 5@hM@5h@$dU `@tQRPhLQ@g+fQRPh\Q@S+fU`@tPhTQ@.+ÐPhcj@+ÐUWVS$EURP`CtSjPhdQ@e[^_ÃEPuuQu@Q@EQ@uPS*1ۃVuit5Eu׋]һ@p@]uQhyQ@PhN@`e[^_à u_5d@j e[^_UWVS ӉMUЉEt]11vuE܅t2,5d@Ps$%S@!EsC5d@jjh;S@oF$BF$)xPhNS@s!5d@jjhVS@,F$DF$D)xPhNS@(!5d@jjhiS@F$DTqV$B)~PhNS@ V$fzc~@ PBPBPB PhP@ F$D futi5d@jjhS@:|v0 FH p[_5d@j FP tl5d@jjhS@Pv,A FH(jXZ5d@j NFH(F ;VJ zH9\9jEPURMQV? hR@0ډ[X5d@j)EF@dqF$\`m@&R@PhR@E}E hR@ETf h S@yER@rF$RPR@PhP@35d@j]Ph|S@r5d@j /ZKy? u$`T@,$N ZXa*vK $1eYPhN@5h@X$CHShRBRPQ h9;9u j9PhO@j5@趄$DžUDž$ zP5\@5@h(Q@g  QhR@N]g5h@j+jh8N@$ u$E/Džc~@RhO@PRhRR@P HX$X XX^ WSPhP@Q1ۃ uR@VP2C HP9VPu4R@빐USEu fӋtB8T@u]Éà j輠t@`T@]áh@u˸d@ܐUhl@ÐUVSE8+t [^ËPtX E 9tJU 9u1؅~ωt9t19}19t9t;U t9U rىfUu uvfUvUVS]Ku e[^u SUTًBI9M|zG _,EӐUvUWVS(ƉUMjÃ1߫+t{sECt*1w SOF+e[^_Ív P|EtʉC u܅t9KNjuE1e[^_f |vF+e[^_ËK{ 1UVS]u K SCVuCBȍe[^ÐUvUE 11UE 11Uuuu h+u fUuuu h +ux fUuuu h+u fUuuu h +u fUu uh9+h +ÍvUu uh8+h+qÍvUuu uh+g ÐUuu uh +K ÐU vU vUuu h3+h+u Uuu h4+h +u US];+t +]C<`J@SJuju CB DPBHPQSh+ ]fUM9+t+A<`J@Quju AB(P2jQh + fU/ vU vUvUUVSӅt&ușƉtt1Z[^øZ[^UE@@du fE uE uպE yÍvUWVSEPJZ E ȉEB`uuFH;E u u^EZYEURU܋zr` EeEљEE 1uǃtM;EE1ɋuV(EtuE0EtuE0utEMtM9)ӍCe[^_fE]KEE2uv EuFH;E B)1fuFu+]1Lvv EH9/1}U KEvUE@PLu@L@T f@XfUWVS<}?+t+؍e[^_ËOfA:fEƋQ`UȋG`M؉C0]fCZG$Efc:S`ЃC`O MЋw1 vF9w]SEPURMQVWwGut MuMt$tuGPuuQPRÃu-]tGHUWURjSPQÃhGfUfP:؍e[^_ËG+t e[^fN9tt BRP Nt AQP F t F E PEF Ft FE PEFFTt FTE PΎEFTF$t F$E P觎EF$F0t P&F,t PFHt PFHFLt PtiCHCu^tE PEKt CE PECC SӍ Ve[^ÐUu +f-+w1UE@ÐUE@ ÐUUE 9tÐE9BrEtB MEB 1ÍvEÍvUWVSMy _AQU9w(9s$)ƋI9sCF;]vZ[^_ÍvUWVSu} EE9~w>D;F w5E~%1ۉ+NىV C;]uY[^_ÍvFE} E.+[[^_9fUWVSu} EE9~w:D;F w1E~#1ۉ+NىVC;]uX[^_ÐFE} E-+X[^_8fUSME Ut9u9Qw ]D;Av G+]ÐQ؃QPuRo1]ÐUSME Ut9u9Qw ]D;Av G+]Ð؃QSPRu1]ÐUS]uC+C@RPjs聚]ÐUWVSE]tU9t e[^_fz ;} rxBEU9UUB)EmuFU)‰X9t+UBESPEEUB9r}U EP UP1e[^_ËURUu 9wI9vEH+X؃ NK9rU9UTU EP 1e[^_É9r*)QSjVbmF+UWS}j<>Ã8E CECEC EC+ +tOC=+}tQ 1}Q݌E SvF+e[_ÍvC0+}ufCC+Cx W舌EueCE PEC$ F+e[_fC-+@F+e[_ÉCuPQ|CM tRWu PdE$17PWjsUEu pppp pp0oÐUujuuu ujh +IÍvUMU At PuhVj@QRjjm Ðuhbj@QRjQmUME Q9w;A vRPjQ1Ív)ЋI ÍvUWVS u} 9~w8UD;Fw,~D1C;]t:;PVt1e[^_QvWh/+31e[^_øe[^_ÍvUME Q9w;A vRPjQ1҃Ð)ЉA҉fUME Q9w;A vRPjQ1҃Ð)ЉA҉fUS]u`Ct CE P臆ECKt CE P`EC SF]fUWVS]Mt U;Et Ee[^_Åt;uB;Ct E e[^_ÉыR ;S u)lj}qC9ɉuЃe+u9r,vVuEXZVS9EuFE9p s1xUSEt(A ~11ҋAC„9Y A1[fUEt8+tËU P8UP+t+ [^_Ð~}G,u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS uM ]EEUU>+t+ [^_Ð~}G0u<ȉډ1҉ t + [^_ËEEUUM u}O [^_UU}}M ]u [^_UWVS E8+t+e[^_ÐM UBP$ 1} QTuEu uhM9tx] tM?tFj&SDžtGj=S~…tBPMARSQP$ƃt u|qe[^_þF+"1ھG+1 UUM B tt B9t1ø\+Ð1fUUE B t tB1f\+ÐUUE B tBB5߉B1ø\+ÐUWVS uVJ`t E9vU MD e[^_ËzxQ ؉љ]SVXNQq ;U t0;Qs뫍vUWVSLu>+D hSsÃRPhjS8+ECC\1}щ $ sEC uP}Y_j?s |U EEE@tPCPRs Vǃup} tu sǃuRCX\ hprEt*CE ut~MVG+F+Et"U e[^_Ív+e[^_Ð S/e[^_fF+e[^_Å @E CPhPR$qEiCTEECPshQPRǃ8CTtRhsP{C@P+ hL5qECXCPQhjPRǃCX8+t1+CPuPRUUCTу8EEcsf~8St +f~Lv +VEuNV`MЩFdt}tt D+fEuu}NA whCFLt FX~LNSN(M̋FLtUVXNU̍D C(Et7E9Ct/"+<+C+xЃ5먋CPsPRsF`tCU HN MtC(EЋVU܋FL,Mљ)9UaF+F1CVU~` HEEMeEE1AK st19| Qn‰E`C$E؅u C@E؋s tvEQuuS\SJVjPRQ uDCEԋM9K v=C s1|*H1u@VXSdCP}~*Bdt$C$St1f`f@B 9SwKcE fU uuuuu ju%ÐUVS];+t+e[^fU t3EEEPh`G@jjjS uŋEe[^PpPjSuMC@du>S ȉ1A1w.2Pu dU lEu=PvиɐUUxU MQ;Br;Br1fPE 0U Bt߸ÐUWVS<ÉUЉM̋PBE;+FCBdEE̅Zr slIu؉VshPwMЅ(Cp( skERshPwCEEEUUuJvEȉEEEMЅt!}C$UDuuEԃE E9C u̅t}t C$UDuUȉUWRus0XuCCH;EC$U mCPWjQPRT+F+e[^_fuuVus,u݋C$UL>CPujQPR#+멍vKA+A1q хXC9JƉȃ:A9w.+e[^_ËU̅u1EЅu1B+8c uf1c߃ WfE1UEP,t;P҃H0t"H уutf111UE1UE1ɺUWVSlÉUM@P UP(UsPUā;+C<`J@@dEӃ { 1уOQhẼ uẺEEC0t Pgj@}fs uQr C0PuSǃhEEC0E PeEC0Eut ud]t udMt ude[^_fEEEC,t P#yj@}̥fs ugq C,PuSǃuE PnguE udC CEEEEEUډUvRuhuruuus0oǃzEEċEtZEC$p}t @4PuhuruuVus,+ǃuEE U9SMtEC$0}t @-CPuuVPR%+EZvuEG PeAuEEEEdF+EEDEdC,E P@bEC,?fSJuEPVRQ+E떍vuSH%uS,i\+e[^_ÿF+e[^_ËSXK(y sE;1uEvCu9vRus0/ǃu>C)E}E)ƋM܋QU܋PujQPRǃtESX$CEK1EI1uEHvCu9vRus,ǃuCE)EUE)ƋM؋QU؋PujQPRǃtTCC-F+&Et u8`Et u#`1m1ffUEP,t H0t11Ƀx0UE1UE1ɺUE8+u'@X8+t+ËU t U 1ø+UWVSEӉΉƒE11fEt@At'B tB1 t>tB;G}܉Auڐ]u1҉Ѓ[^_ÉU뻋Mt!UEދMA @A BЃ[^_É}ڍvUWVSE׋EU EU}E]UZ ]J EșMȋ]eÉ_wjVSw$611 t_Ԧ@t*1ɋ]StVPQuuuuS҃ e[^_ÐE+ϐUR Uk]ۉ]EH XPuuw9Et %+1UWVS EUωӃE1 vFt>C ttc C t3jC1RPUEtEFuÐEe[^_Àc 뫍vUE8+uPX:+t+1\+ÐUWVS lj։ˋEU EUA <t'C C USF @F Ce[^_Ív1jA1RPvUWVS,u }E8+PXU؁:+tE+E܍e[^_f}EXEE~̋UUE7vPUr u3iC E׈C UB MtEEPEXu]WVًU؋E뛹U؋EE܅;uuWVU؋EE܃E+uuWVU؋EE܃ UuuE 1RPuÍvUWVSE׋EU EUEUEP UEUB Mȋ]eÉ_wjVSw211 thԦ@uKE+11ҋE)UWPjRjUBtQSVuuuuRЉÃ ؍e[^_f붋UډUMvPuuwՏ9Etx Ɖ»$+넻$+v1UWVS,E UEȉŰU:+MIXMЁ9+t +e[^_Ã}huSEE4QMq 0ugMEUE@ EԃEURUȋM̋E[u}>]ȋũEvE؃M9MtU؍DPډEZtuuuuȋUЋE"E؅eEȋUEfM܋\Ɖ׃RPًUЋE Ep u3fUR UE܃M9MuEUEH1EŰE)EE1e[^_1ɋUЋEquuuuȋUЋER+HEfUuuE 1RPuÍvUWVSE8+umXX;+uUj@u u/Et(WjEPujщƒE8u SKy G+e[^_1v+e[^_ø+UVSE8+ugXX;+t+e[^ÍvƅuPjCE u sx%PuusP9Et%+멾+뢋5Ԧ@fUVS@ X1fCCc tE PVEFue[^UWVSB Z1vCCc w YtEFu1e[^_øF+e[^_ÍvUWVS ]} ;+uSsX>+t+ [^_Ð9{ t+1ɉ4u{ ؃ [^_:f1 [^_ø+붍vUWVSu>+u3^X;+t+e[^_fFHF~1e[^_ÿ+1ɉډǃ s誅x_LFXE PMUEFXFt FE P&UEF V UX=Ԧ@UWVSUc j`.XÃ5Pj`jSd+$Xƃ@C 1}QWECuPasXC CCC hjVc+džvǃubE E t PsFx\Ee[^_fF+ SSe[^_ÐF+t VSfF+e[^_Ë=Ԧ@ο:+뷐UEt Pu hVj@uj8 u hbj@uj8ÐUSU] CEU [vUWVS,E܉U؉Mԋ]pCtp1CttCk+e[^_U܋usS e[^_Ðu Q;Bs;Bs4C5+e[^_ÐQs(uujjuPSǃ sRsPQ)Ct됋CEC_EEECS ;uQs(EPU2s sEP3S E tÃCUtt3Ck+}tRsE03)CtCCCU됅EEEfECS ;utăEEtQs(uU2s sP3S E  EdPs(uujju3S ǃ DE1UWVS+F@Nt}VҋL to;Vt*SA1fACfA 41[^fCSA1fACtC=w)-fAC=wfA뱸+본+문+른+UWVS,E8+UJJE EREE؃Efҍ<} t0}t*} tP}tJ}P} v^+e[^_ÐE9PlGaGE } uEP;P]GRE 듐E$j@UBϋGG G W G 6p BG w GPMAUB;BF1҉¸N1ڋMQEH@ G GF )ȋUBGtMI}}MQ;QEHUB;B|+EB@G G G*G uE G E܅UB;B_$G$u BpGBEG$E܋HUB@ P;Vpj3NMA3ApV=ZYNKK FCG E܋@ CC} I4s C UB;B}C$G eE ?GH9G E )vF1҉¸N1ڋMQAA FAA=-AAw 1fEP;PGUBHMA$w } t }-G!G W B;Wpw W MA;AGw 7 PB3jQRPE+e[^_à s CHC CGWCS+|+E+}+~+F+vUVS u>+F@VFS C uVBC CHCt-‹fPKu VtOvaÉ؍e[^fC Ft&E tH1Q@PB PRFK f1Ff@륻+맻+렻+PEPj VÃuu VV NA )BAXLu,Pv vQxà juv/@XUWVS0ẺUȋu} EPjuEЃ7ŰB;EU+B;Eu5M]9PEPjuPEЄ+fEЍe[^_ÐPEPju)=|+t;M]11 t!9w3r9w-PURjuuuSEPj uu^ŰBKvr9WE19aw9WPURju=|+uEЄ+EЍe[^_ÉEЋEЍe[^_EЁ+EЍe[^_=|+vUEU MUM 1nfUWVS,Eȁ8+'UȋB@MȋQAC PEPjQu}UȋBCH9C tyM]11 Eȋ@EЋUȋRŰE)Eu}RMQjuuBEEȋ@~8M̍ɋMЋDH;D u$QMQj urfe[^_PWVue[^_ø+e[^_ø+θ+ǍvUWVSÁ8+%@@"sQEPjSƃt e[^_fEPS~XZuUM)ʉUE܋UptsJSDžxDž|1щMA t}UUfBfEEE}+EEt u6E3 u6e[^_Ív+e[^_þ++fz CHP9L}EK ɍ HljE: Cp9E| xu=CpCH1v(NJtt !~ ~xDž|EPuxsƃ}uEufFCP fV uvuF+E@D VRPQ,CE@ dC@PujuPRƃ GCEU)B)B MAufFƅdhDžlEPURjSƃhlE܉UUUEC@+E܉EWMQjSƃtpUƃlS KA BAPLPs sQ輳ƃ3fF+zS D;D}DžxDž|PURj Sƃ&EԋU؉x|ƅtpUƃSs 'KA }uUSBBHB C@CMfAuuUVuVj Sd+})} VjS%ƃhlU܉MMME}QuVjSƃ*@XifUVSu>+F@VFC;C|KE t+؍e[^ÍvaÅtjV؍e[^ËF^ C E t K S C xQD@PRB Ph= C C@CfAPujVÃumÅdF+<+2Q 눻+#vUWVSE UX\]uPTu>+aUB@e]SMuNECx|T PuDuFuɋDoSE؉u5] S sM!e[^_à UP Phs@u [뢁'vDI !#r@)ЍB)QRh%r@h@: vkMn#r@=@Q@ɍQ))à VQWh0r@h@袑h@h@` QvgE.X#r@=@nQ@))à QRVht u1 [^_]Ít&$$)ƉfUWVS u} &}$ÍGE$9u>uӃ 1[^_]Ð$e$X )É[^_]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUVuS] >t9u1ҍu[^]ÐUEM 8ut&8t ҍt&u1]ÐUS] Mt1ҍvDDu[]ÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]釁&UWVS ]} &$zu+1-1x@.tn|B< v5؍v؍ftt [^_]fƒ0P$%x@ٞw…u, t&z롍& x@ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$"u<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$HAEEs{xC{$EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]t&]Eu}]t&FED$$W1 f?[D$E@D$U${uɍFD$ ED$E<$D$U@FD$ ED$E<$D$@v'UUE @U]0UW V@S1ۃED$D$$D$ED$E$vt&߃ t;>t[@D$ED$$zu˃1[^_]Í& tED$@D$$E @[^_]Ív'Uu.$@@.@&@ =`@uÐUWVS }1=v@t$$vt&9{u@t$$v$@ƍ [^_]UWVS }1 v9{t+@t$$_vu [^_]t&@t$$Wv$ [^_]UVS@$ƋE@F@11&@;Fw@\$$uu@\$t$$wE D$F$f^[^]w@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$.y\$D$D$ E D$E$ #[]ÍUED$E D$ D$D$E$" UED$E D$ D$D$E$" UED$D$ED$ E D$E$R"Uuv@@@Ít&UWVS,EUMI=@G@@ Eu&)ċE\$#D$D$$OED$ED$C$E\$t$ |$D$$!t&1 &@\$$DstF;~u@\$$HsE;u|;~t)&;nV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$6\$ƋG 4$D$G $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$[$S]u]Í&UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&U(E uu}}]EEEz@t`$É0E{C<$|$ƋE4$D$*s \$@$r]u}]%t&뙐U 0]Ít&U j0]ÐUED$@$fp1tÍv'UED$@$6p1tBÉ'UWVS }1]v<$D$st&@t$$ouԃ [^_]0$VC$K$C@t$$oUWVS 1t&<$D$ st.@t$$bou [^_]Ðt& [^_]É'UE1҅tPÐt&U$x@]]uu1ۉ؋u]]Ðt44$r9E r݉4$rt$$D$&$r4$E r$g맍vUE]utoU1u ]u]ÍvE $er$ƋE $Mr4$D$E D$WE tC$1s롸$tE$q$E $q$҉CthtdE$qD$ED$$E $qD$E D$C$@\$$Ro@1$C$$U]]u$y\$D$$x@o4$u؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít&Ԧ@eU@$mkÍt&'UWVS,EEE EFEEE}&$oEF$o]]x;D$E$EED$D$EE$|$FD$]$EEEED$@$NklED$ ED$E܉D$E$EE,[^_]'UWVSBmD$0@$x@@$"u [^_]ÐD$ D$D$x@$EtЉ‹@ tljB9s&<$n<$D$tt$<$xn4$nnUDNjB B9r[^_]ÐUU]Љ%   Ív'UE]fÍvUU]Љ%   Ív'UE]fÍvU1Uwy@]Ív'UWVS @}t;@1f t$D$<$luv @[^_]f 1[^_]ÍUWVS @} tAЖ@1t&D$E$lut)C<$D$zluuʃ 1[^_] @[^_] UEuE $`UÐԦ@Í&UE$O`U Ð&UWVS,@t)t# t$@uE$_@ty$D$á@$@@@E @@@@@@@@e[^_]ÍvUEeD$x@$T$!D$*@E$2NjE$<$D$D$++<$*<$+C)čt$|$ 4$\$D$".<$)4$D$m@k1Et_f$4$^|$@$U@UD$m@$_kuU@e1&UUuu}}]uLU $_É$-j9r>t$\$<$$~]u}]Í&Ԧ@1f$P1Ԧ@'fUSE$_D$$@ÉD$$$ @[]ÐUEt;8t6 `@1҃wy@T$ D$D$x@h@$mÍv`@1҃wy@T$D$0R@h@$<ÐUU S]G) ʃ)1[]Ðt&Ԧ@獴&UU S]G) ʃ) 1[]Ðt&Ԧ@獴&UU SG,Ћ] ʃ)[]ÍԦ@䍴&UVSUMu t@@B@Bt\1ۅt.Ԧ@[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@@]uu%@@1[]Í&$ti@B$0@D$@@1[]ÐUED$ D$$_1Ít&'UED$ D$$/1Ít&'UD$D$$`@D$ D$$@`@t&P@=@uD@ U=D@]]uu}} G~&Ԧ@&]u}]Ív tՅt4`@d@Ch@Cl@C p@C1t`@Gd@Gh@G l@Gp@1rfKUS]=D@t=G( t#M `@ `@[]Í&[]Ív[뼉'US]=D@t=GH\$$@u`@t$Ѓ1[]Ð1[]v빍Ԧ@ U$nÍUEwE]/t&]Í&'UU ~ÍD$D$ D$D$E$ 1ÐUԦ@]ÍUԦ@]ÍUWVS1ۃ }9~t3 @\$$_uԦ@ [^_]f @\$$^$!uȉ4$Q 1[^_]Í&UWVS1ۃ}9~t3 @\$$^uԦ@[^_]f} tr} t} ft"Ԧ@[^_]ËF [^_]Ë]F 9t!tD$h@\$ D$y@$A^ 1[^_]Ít&]F9tD$h@\$ D$y@$ ^1[^_]ËE cF[^_]ÍUWVS } @1 f9>tl @\$$`]u$.Ƹt> @t$$2_ @>@F@FF t&F [^_]uԦ@fU @tÍ_ @`@$d@$h@$Ðt&UVS @t519pt# @\$$_\u[^]Ít&[^]bf&'U(Eu]}t;${D$4$NjED$t.]Ћu}]fԦ@ލ&Et$ D$D$E $R D$|$4$څt떍t&U(Eu]}t;$D$4$NjED$Bt.]Ћu}]fԦ@ލ&Et$ D$D$E $""D$|$4$څt떍t&UE]uu}} #tEt$|$$t]u}]Í&]u]}]t&Ԧ@ÍUEt&D$ ED$D$E $ÍԦ@Í&UE]u\tVD$ ED$D$E $ t]u]Í$uԦ@ӍvԦ@ UE]t&UVS u ]00 D$*@$#0$ft^ErtDaDED$$#t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$*@$(#@Ԧ@됍&15D$*@$"uLvEwfvEwE+D$c@$"v$Ԧ@UE D$RD$E$0ÐUS h@u(@trl@B(@l@:#(@8 @U::l@D$z@D$h@$>?[]Ð$@E h@;] (@}A(@-t(@c~@[]QA(@-l@ta7D$-U(@c~@$Ltl@-1&?[]Ív$@t&yl@D$E$x:t,(@d@8u$@l@[]Ív(@8uh$@9E$@PE:(@c~@8: @Dl@D$(z@D$h@$ ?U d@(@c~@bC$@U1]É'U1]É'U1]É'U1]ÐUWVS1ۃ }u@t&9ljEtG@\$$TuԦ@ [^_]$Kz@BٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f@\$$,TnU;uݡ@\$$,T [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$Su$ pD$_D$Xz@$_z@1D$ gB3CC@\$$IU[^]&'UWVSE}}Et[^_]1Y&;8t @\$$Ruމ<$1ۍt&;>tV@\$$Ru1D$ D$D$Xz@$_z@AUFF[^_]f뿐UTD$@$rz@@ÐUED${z@D$@$ @D$ B @U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[CM$覽D$4$MuȋE$EL4$;L&D$|$E$=N\$4$Luډ4$MfvD$z@$(Pt$$PftUcv|$E$L4$t&D$E$=Lt xW11vD$xE$Lt@C$%PƋCtrǍ&$z@OƉ뮍F$西EE$KuE#&tcu :F/<$mED$E$vKt8_4$\$q$yOƋGu/볍&|E$jLE[^_]Í&E$]J9|$E$K1>)E4$p v@UWVSM1ɉ‰EE#E$hKËE$IStdfuC.C E\$$_L11vD$xE$FJtXC$UNƋCt+rǍ&CC뗐t&$z@NƉ떍F$载EE$IuE#&tcu :F/<$4mED$E$It8_4$\$$MƋGu/볍&|E$JE[^_]Í&$踹E$mHD$E$ I8$ּ@@E$(H\$D$E$5JaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE@EEEEED$E D$E$WÐt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$hKҍUUE $T$ ÐU]]uu KSA9t BC]Ћu]Í CD$$׽t΋S뷍&U8uu]}u؋u]}]Í}}EE0@$@0t‰EEE@ED$E D$E܉$D$<$tE;Er EtD$E$ E␍t&UED$E D$E$!ÐUԦ@$z@D$ED$n3ÍU`@$Ít&'U]&US$d@]t$D$ $É[]Í&]ED$$:?؃$[]fUWV1S }'`@$st4$ t7`@$t7 [^_]f`@$u`@$t1fʍ&'US$d@]tE $D$ $É[]Ít&]ED$$Z>؃$[]fUSd@]U u$T$.>؃[]Í\$D$ D$$ []Ít&US]$G\$$td@t$ 2[]Ðt&D$m@$=ؐt&UVSD$*@$z@ wD$ D$D$4$5 Ƅw`@D$D$7u@4$$`@D$ D$D$$D$*@$z@[ )wD$ D$D$4$ Ƅwd@ZD$D$-@4$6$d@D$ D$D$@$D$*@$z@ wD$ D$D$4$ Ƅwh@D$D$-@4$h@D$ D$D$$$cĠ[^]Ð`@d@@h@Ġ[^]Ít&D$-@4$ h@vD$7u@4$ `@*D$-@4$ d@U1]É'U]Ít&'UE@1] U]G&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$z@F$Ɖ]u}]Íu \$KS<$18C $F8U|$T$$胼\$ D$D$z@F$tƋC $'8뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$z@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$z@F$4$0딍US$]u$[]Í&Ct$ELED$ D$D$z@C$zD$Ë@ D$E$^C $裬$蛬E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+31҄u뱍vC!C$뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$?$wt&tyvC!C$:vK9Crt$ED$ $osY&{Cft$ED$CC$2sv'U]]u$=U $D$T$ D$^$=]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$2@$12@@EED$ D$D$z@G$RË@ <9}sE<D$@D$E$!C $f$^,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$s_utRu4ttG!9u܍f]v֍ovɍt͉$v胧G!9uIvvE<$ED$ D$D$z@G$Ë@<9}sE<D$C $0t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$/9 )čt$<$99s@a<w%${@vЃ|+uf<$89rE1ۉ$8UT$D$F$˲E$8t$ D${@$D$U$w t Nun1ۉ<$̤e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$7$肧FU$T$蠱$&dËFCFCF C FCFCFCFCF C F$C%C$$D$ D$$D$C%4$蟣v'UD$ {@${@Ít&UWVS] D$*@E$~C$L# D$c@$N84$t$ D$D$<$uNh@D$D${@$q4$ $Ԧ@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$71[^_]áh@D${@$Ԧ@eh@D$x{@$Ԧ@11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$葥~8$t 1҃[]f[]Ít&'UWVS$k1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|4~@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA +@ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@$Ðt&UED$@$Ðt&U؁@]ÍUԁ@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$HwD$$FFF D$D$$ta$(EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأԦ@EE؃<[^_]ÍvEEԦ@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$\$UT$M܉ $4\$E$FU F$E] UMV~HU1fC D$CD$EE$MC K9}MƋVT$D$U$F D$$ 4$qUE ]u$tD$E$~$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]ËtxĦ@t9t)ȉ vt̅uĦ@Ȧ@̦@뵋5Ȧ@9|̦͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$>pk9Ħ@u,Ȧ@9|Qu!Ħ@vWu1]u}]Í&tq $o뛐Ȧ@ȍ&'U]]u1t#1tr$ok9Ħ@t]u]Ít&Ȧ@tȦ@ݐt&Ħ@̍t&US]$xu][]'o&U$]]uUrۉƋEFtM u:3C9Ħ@t؋u]]Ít&Ȧ@9E Ȧ@܍t&U ؃t21빉'US]t$$qU PC9Ħ@t؃[]Í؃Ȧ@[]ÐU$~q@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUMVuS] u t&8utu1҉[^]Í&C)萐US]U t& 8uu1ɉ[]Ðt&B[])ÐU}}]u<$6p4$ott$|$$5z؋u]}]ÐU1M9t :u)]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$Ц@D$E$0ÐUSM] tU&9tu1[]Ít&B[]vÐU]US]D$*@$6t$J1[]f$Xt$,1[]Ԧ@ːUE D$D$E$Í&'UED$D$$Í'U$;@1Ív'UEu1}]$ttL$$Xmfw7D$F|$$wƆ<$i]u}]Ív‰'UE$ɃÍU]7UWVS]$E$葩ƋE D$u@E$ie4$P UP()ԍ\$CHCL$t$$v\$ ED$Y@D$G$4tm3tNe<$ 4$hU$he[^_]ÍtuԦ@t&븍Ԧ@롍&Ԧ@ 뉍&Ԧ@yt&Ԧ@aU8}]] u}$$蒬t|txD$*@E$ED$u@<$EUBU;BԦ@ E$ùU$踹Ԧ@4$Ig<$Ag؋u]}]fԦ@΍&Ԧ@딍&$D$b@tE1ۉ$ht$ D$D$U$ں4$lt&e4$-PUP,)ԍ\$CHC L$t$$tUUC\$ ED$e@D$UB$蟃tB&vt evԦ@ftuԦ@t&Ԧ@ 뷐UWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1UWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS̓@t1ېЋȓ@uX[Ungueltiger PPB! Usage: %s [-bfhixV] [-ob superblock] [-oB blocksize] device ext2fs_badblocks_list_iterate_beginCouldn't allocate memory to parse options! Invalid superblock parameter: %s Invalid blocksize parameter: %s Bad extended option(s) specified: %s Extended options are separated by commas, and may take an argument which is set off by an equals ('=') sign. Valid extended options are: superblock= blocksize= Couldn't find valid filesystem superblock.while reading journal superblockCouldn't find journal superblock magic numbers Journal block size: %u Journal length: %u Journal first block: %u Journal sequence: 0x%08x Journal start: %u Journal number of users: %u Checksum 0x%04x, unused inodes %d %u free blocks, %u free inodes, %u directories%s %s: %s: error reading bitmaps: %s 0x%04lx-0x%04lx%lu-%luext2fs_read_bb_inodewhile printing bad block listBad blocks: %u, %u, [12-Oct-2008dumpe2fs %s (%s) superblocksbblocksizebs Using %s bfhixVo:while trying to open %s %s Journal users: %s while reading journal inodeJournal size: %uk %uM Group %lu: (Blocks INODE_UNINITBLOCK_UNINITITABLE_ZEROEDPrimaryBackup %s superblock at , Group descriptors at Reserved GDT blocks at Group descriptor at Block bitmap at (+%ld), Inode bitmap at Inode table at , %u unused inodes Free blocks: Free inodes: dumpe2fs@@@@@@@@@@@@~@@@@s@@h@@@@@@@@@@@@@@@@@T@+V@p[@[@[@\@0\@\\@\@\@\@]@L]@]@]@]@^@D^@p^@^@^@V@^@V@V@ _@X_@_@W@6W@QW@mW@W@W@W@_@W@_@,`@l`@W@X@X@1X@`@`@`@a@Ta@a@a@b@8b@pb@FX@b@b@b@c@0c@Tc@|c@c@c@ d@`d@d@d@d@e@De@cX@pe@e@e@|X@X@X@X@e@X@f@Y@Y@4f@/Y@`f@LY@f@hY@zY@f@f@Y@ g@Y@8g@Y@Y@Y@Y@ Z@ Z@\g@3Z@JZ@eZ@|g@g@g@h@A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@COMERR_DEBUGCOMERR_DEBUG_FILE/dev/ttyadd_error_table: %s (0x%p) Unknown code remove_error_table: %s (0x%p) remove_error_table FAILED: %s (0x%p) ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_ Filesystem volume name: %s Last mounted on: %s Filesystem UUID: %s Filesystem revision #: %d (original) (dynamic) (unknown) Filesystem features: (none)Filesystem flags: unsigned_directory_hash test_filesystem (none) Default mount options: Filesystem state: Errors behavior: Filesystem OS type: %s Inode count: %u Block count: %u Reserved block count: %u Free blocks: %u Free inodes: %u First block: %u Block size: %u Fragment size: %u Reserved GDT blocks: %u Blocks per group: %u Fragments per group: %u Inodes per group: %u Inode blocks per group: %u RAID stride: %u RAID stripe width: %u First meta block group: %u Flex block group size: %u Filesystem created: %sn/a Last mount time: %sLast write time: %sMount count: %u Maximum mount count: %d Last checked: %s%d month%s%s%d week%s%s%d day%s%s%d:%02d:%02dNext check after: %sReserved blocks uid: (pwd.h not supported)Reserved blocks gid: (grp.h not supported)First inode: %d Inode size: %d Required extra isize: %d Desired extra isize: %d Journal UUID: %s Journal inode: %u First orphan inode: %u Default directory hash: %s Directory Hash Seed: %s Journal backup: inode blocks type %u Filesystem magic number: 0x%04X Check interval: %u (%s) Journal device: 0x%04x MNTOPT_MNTOPT_%ddebugbsdgroupsuser_xattracluid16journal_datajournal_data_orderedjournal_data_writebackContinueRemount read-onlyPanicUnknown (continue) not clean with errors%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x(unknown os)LinuxHurdMasixFreeBSDLitesFEATURE_noneclearFEATURE_%c%djournal_checksumjournal_incompat_revokejournal_async_commitdir_preallochas_journalimagic_inodesext_attrdir_indexresize_inodelazy_bgsparse_superlarge_filehuge_fileuninit_bguninit_groupsdir_nlinkextra_isizecompressionfiletypeneeds_recoveryjournal_devmeta_bg64bitflex_bg@.@.@.@.@.@@.@.@.@.@.@.@.@.@D@.@.@.@.@.@.@.@.@.@.@.@.@.@.@.@.@@.@.@.@.@.@@.@.@.@.@.@.@.@.@D@r@@@@@@g@@@@@@@@@$@@@@@@@@@@@@@@@@@r@@@@@@g@@@@@@@@@$@HASHALG_HASHALG_%dlegacyhalf_md4tea%08X-%04X-%04X-%02X%02X-%02X%02X%02X%02X%02X%02X %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt illegal option -- %c option requires an argument -- %c waitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %d..:/%s: errno=%d console:/stdinconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createX @ @ @H @ @ @ @ @ @ @ @8 @ @ @ @ @ @h @ @ @ @ @ @rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZ@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@M@@@@@@@@@@@@B@@O@O@@B@@@@@@M@M@@@@@M@@@M@$@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@$@@@@@@@@@@@#@@K#@@@Y$@__PM%%02i%m/%d/%y%03i%I:%M:%S %p%H:%M %H:%M:%S%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 )-@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@-@-@*@,@*@*@*@,@,@*@*@*@,@*@*@*@*@J*@,@z,@R,@*@,@*@+@*@*@*@*@*@*@*@+@+@*@+@+@*@*@+@*@+@*@*@^+@T+@*@8+@*@*@*@*@*@*@*@*@*@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@@@@@@ @#@&@)@,@/@7@>@G@P@[@c@d~@B~@k@@8~@@@@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d wdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK REGDRV tcpip%02x:%02x:%02x:%02x:%02x:%02x%d.%d.%d.%dtelldir: Nicht implementiert IO_ULINKlwIO_LINK zR| \'AB E<d_AB Eؓ@S@ @+j@[@[@Z@X@TU@|S@8Y@X@Q@V@T@l@t@t@t@t@t@ t@@t@`t@zu@u@u@u@u@u@u@u@u@v@v@v@ (v@2v@@?v@Gv@Tv@_v@iv@sv@ v@@v@v@v@v@v@@.[@@Z@v@v@v@tx@{x@x@x@@x@@Px@x@@x@x@@ x@x@x@x@x@c~@GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@,@y@'h@;@Pp @ @sN@GuO܈@d@wX@4x@` }@9}(@0[X@i Ģ@H@lE@X @0 @i@Ь@@\@nЮ@]@3'@>@Q+@@@@@<] @.P@-@ @@4@@@  @g#@!@M<@6*P@y@6@;@7l@@@0@@d:@ @@|@5 @@@40@Q@`@* @(P@P'@-@.@@/@?/@&!0@$1@%1@*7@f,08@.:@S/p:@0:@2`;@3;@19p?@A<B@>C@K>C@>?D@J`@`D@AD@kB`E@9ECE@ CE@]EF@9wIPG@uMJ@'rPL@_Gj*main[program_namemdevice_namehex_formathinitialize_ext2_error_table_rBinitialize_ext2_error_tableet_ext2_error_tableRIext2fs_u32_list_findext2fs_u32_list_testext2fs_badblocks_list_test#ext2fs_u32_list_delzext2fs_badblocks_list_delext2fs_u32_list_iterateext2fs_badblocks_list_iterate9ext2fs_u32_list_countfext2fs_u32_list_equalext2fs_badblocks_equalext2fs_u32_list_iterate_end2ext2fs_badblocks_list_iterate_end\ext2fs_u32_list_iterate_beginext2fs_badblocks_list_iterate_beginext2fs_u32_list_addext2fs_badblocks_list_addext2fs_u32_copyBext2fs_badblocks_copyext2fs_badblocks_list_createext2fs_u32_list_createE' 6ext2fs_get_block_bitmap_rangeext2fs_get_inode_bitmap_rangeext2fs_set_block_bitmap_range7ext2fs_set_inode_bitmap_rangeext2fs_compare_inode_bitmapext2fs_compare_block_bitmapext2fs_resize_block_bitmapHext2fs_resize_inode_bitmapext2fs_clear_block_bitmapext2fs_clear_inode_bitmapext2fs_fudge_block_bitmap_end(ext2fs_fudge_inode_bitmap_endvext2fs_allocate_block_bitmapext2fs_allocate_inode_bitmapXext2fs_set_bitmap_paddingext2fs_copy_bitmapext2fs_free_block_bitmapext2fs_free_inode_bitmap;ext2fs_bg_has_super<ext2fs_super_and_bgd_locQext2fs_update_dynamic_rev<ext2fs_flushext2fs_closemPext2fs_free_dblistLext2fs_u32_list_freeext2fs_badblocks_list_free&ext2fs_free+ext2fs_write_ind_blocksext2fs_read_ind_block Next2fs_llseekuOjext2fs_set_alloc_block_callbackVext2fs_get_free_blocksext2fs_new_blockext2fs_alloc_blockAext2fs_new_inodedext2fs_set_block_alloc_stats_callback/ext2fs_inode_alloc_stats2ext2fs_inode_alloc_statsext2fs_block_alloc_statswext2fs_crc16xhet_list_locket_list_unlockremove_error_tableadd_error_table0add_to_error_tableZerror_messageC_et_listU_et_dynamic_list# }Perror_table_namef}_com_err_va%set_com_err_hookereset_com_err_hookcom_errLcom_err_hook-[ list_super2X list_superOe2p_string2mntoptae2p_edit_mntopts3e2p_mntopt2string"dprint_fs_errors!Edprint_fs_stateHJe2p_is_null_uuide2p_uuid_to_stre2p_uuid2str209{e2p_string2ose2p_os2stringie2p_jrnl_string2featureLe2p_string2featuree2p_edit_feature2e2p_edit_feature]e2p_jrnl_feature2stringe2p_feature2string6e2p_string2hash e2p_hash2stringM4huuid_unparseuuid_unparse_upperuuid_unparse_lowerYuuid_unpack isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper?%errnoQ]init_memory_managerfreeZmallocrealloccalloc'dstrtol>ostrncpy-+^strncasecmp strcasecmpomemmovedstrcat]dstrchrdstrcpyomemcpymemset9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoul4librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEtimer_cancel8timer_callbackytimer_register rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*#nsyscall_psyscall_vagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars<htonlhtons$ntohlQntohs~hstrerrorgetprotobynamegetservbyname3inet_ptoninet_atongethostbynameinet_ntop]inet_ntoaherrorh_errno*7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<kill=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreatR6Plgetoptoptargoptindoptopt+opterr=optreset<getuidgeteuidgetgidgetegidGlvwaitpid,waitXwait_child_addqinit_waitpidxstrerror'Zrpcsend_message:nyieldR,io_split_filenameio_get_absolute_pathZio_split_dirnamedget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"nset_rpc_handler#5yadd_intr_handlerJa)vfprintffprintffprintf_putsn+fprintf_putc;4g]asprintf_putcvasprintfasprintf}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr# Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen6*_exit2abortGatexit{exiti 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf{ gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeF0vprintfcprintfprintf_putsnprintf_putc8sprintf_putcQvsprintfsprintfa_assert;~]snprintf_putcvsnprintf!snprintf&!Pdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read $ysyscall_timer%dinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name*lio_seekW,string_to_ip)register_netcardmac_to_stringip_to_stringV.create_shared_memoryopen_shared_memoryclose_shared_memory /ysyscall_putsnq0mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical62nwait_for_rpcv_and_wait_for_rpcc3ppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execv19list_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_create<strcspn>ostrncmp>dstrcmp?ostrdup`@ostrlen(AQd__strtok_r strtokkBomemchrECrunlinkCoaccessYE=seekdiryrewinddirtelldirreaddir3closedir_opendir4wI io_remove_linkio_create_linkuM__udivdi3rP__umoddi3fQ@@q@h"intXI5Lf7e~t] !(e 'eoy.Z%1H id2# I@3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFz>HII3Ic-vl3d@@k@@q<b7IY+,3 t@+@+0oint7h"XI5df7}~t] !(} '})}0y.r%1f id2# I@3f# pid4# .5# 7# 8# >9# :Y# 4<# A=l#!0YO>] 4r= dB kT ,Kx 8}  J7 b  c # T #  # l # , # 4 # O # c# C #  # s s P( Q# S T# O3 Rv U ]h ^# _#M `# a# b# d e#x f#P g# h# i#B j# \: c k C' D# E# F# G# H#  I# J# K# L# M# N#  V#$& W#( X#d Y#hX Z#lH [#p l#t  s9  # # #p # T #i #c #w #~ #  #$ #(* #, #0 #4Z #6 #8- #: - #< #>6 #@ #D1 #H #L #P #R% #T #X #Z #\ #`% #d #h #x !# "# '# (# )# -# .# /#Z 0#J 1# 2# 3# 4# 5# 6# 7#& 8# 9#j :#V ;# <# =# ># ?#i @#d A# B#b C# D#( E# F #  s 0 s 0 s?  s  s  sBCDh E  2   #  # 7# %   t z $ CK # _F D%#  E' #  F= # ! GX #  I} # p K # q L= # 5 N # n P #$ Q #(  S #, K U- #0  V3 #4   ` 2 $ "K #  # # _F $f# i %7# v , #  3 # 7 47# 9 57#  6 # = 7#X 8#\ = C    <7#  =7# K >#  ?#K z 77K  K z 7 7K    s K ! %7! z  K = z - K X z 7C K } z 7^ K z 7  K z %% K z  2  K  z 7 K - z 7  C sH_N T A_ $K # ioz # 97# Ff# ‰# 2}# 7# , @ # # Ǐ#$ G 7#( ##, ~.#0 ˵#4 l#8 T#<  #@  #D 9#H r#L ԩ#P t Չ#T #X ש#\ nowص#` #d # 4# z # Z# (v#f@gpDJ V7 wD| xP} K C  * K C  K C K C   . so .K TC 5 T5 :vC 5 7` a#  sc  # # # A # b# # # #$ #( %©#, Ŀ#0 ǩ#@ ɩ#D ̩#H I ͩ#L b#P |#  i $j# k# ^l#m  s+ sv զm6* <fs5C {5@ g7o nr}!8 "7^ ?* fs>C {>@ #$4t@@2%VC@@^&aB&bB%;@ @ &num:% @@&fsC <'7O(Z\tp)g*blk* )K )%*fmt%N% L@@s'{J'Jf' K'KK*pM78*iNa*jO+< @0@SE,X,N- @0@.c/<H@X@X,X,N-H@X@.c%e@@'Oc7<'*:c7Z&strd%x'C d>0_Y]% ]2^>1buf`f2`f22 `f1p`f1arg`f2`f1lena72b705fs4C 26K 1buf71str81i9}1jsb: 0s 0 sO0fsC 2 2K 1ino2$G73  fsC 4i"' "z* "k * "`* "C* "* "f"f"G 7"7" 7">7" 7"7"* ". #5#3p* fsoC io@ "C q7"Oq76 7@+@7I7%7IF8K g9fsC :7tu: * tu8.7H:7tu:7tu897:7tu9c7;g,,<=0>>>.'.(.4>@?Ltu; ,=?~. >. ;,+=.5G .>i .I .T ._ .j% .uE .e . >. . >>. .D .f @0, < =P. . +@@,/,$Aop,,BY,g=.r ?~v?.# >fC$fC<'7Cb 7%}C 8%C t CO RD2 V EB/%@EF0f\@E 17`@\ ,@@h"intXf~t]2  #]# 3#o 2 # *#2 d > ,@@A < <m et end<  " @@ gg!{T@WLd@ O `T@ @h@oh"intXf~t]yx8VCtdp p $:# num:# $G:# _# :#w q 7 qC $:# bbC# ptr:#s tt g  ptrk pk  $Gm ptrk ppk 'Pm$Gm ptrk pk I7 m$Gm ptrk1:@"@-bbCYblktlow::mid:#m:$@:@WbbCblkt:<@E@#bb͘blk͂ :H@@zbbCblkt*:1i:Z @@xbbCblkt:@@Nblk_bb C:@@9blkYE:@@DfbbDCc2:@k@pbb11Cbb21C9?:l@u@bb1>bb2>#x@@@2"Nle@@(x @@y,@@\+@@bbCret!NH"#N @ @qbbretYl @@bbkCblkkt-m}in:jn:S!Pom"v#0$@!@bbblk%"$@@&$G :num :N& _mret!'bb#C$(P&#h(-3'@@ @@$)ex@@/x x@@CP@;@BsrcOC$&0OOQz\<@E@|srcZ*0[|FGH@X@retF|*$GF:+?X@h@ret>*$G>: y h@@oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd%tztK $CS#_FD^#E #F # !G) #IN #p Ks #qL #5Ns # nP #$ Q #(S #,KU #0V #4V \ ` $"S##i#_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\    Y <:#=:#K>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# C#2V#:#, H#ƃ# I#$G :#(  #,~ #0o#4l̊#8T͠#<#@#D#H,#LԱ#Pt C#T#Xױ#\nowx#`#dv##K ##(0#e  f @g p & 7= Si 'i2OS 'uS S '  {o S ==0 =:Sh@@'& 2numVoutv S@@S& 'numVoutv RS@@7& 2numVinv S@@& 'numVinv S@@bm1 bm2 =S@%@bm1 bm2  S(@C@/H}~(~& ySD@_@[}w(w&x s`@i@r nl@u@m _fSx@@(d ende2ei\S@@ pZ end['[p'IS@@7fsF cYG^retHJendJ ,J 56S@V@Rfs3 Y4^ret5R 7end7 ,7 /X@a@map. *Sd@m@;src( 0) $p@y@g# !p|@@   @n @noh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd%tztK $CS#_FD^#E #F # !G) #IN #p Ks #qL #5Ns # nP #$ Q #(S #,KU #0V #4V \ ` $"S##i#_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\    Y <:#=:#K>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# #2V#:#, H#ƃ# #$G :#(  #,~ #0B#4l]#8Ts#<ϙ#@љ#D #Hӥ#LԱ#Pt #T֥#Xױ#\nowx#`ܫ#dv##K #B#(^# f @g p pn$ :#num :#$G :# d#  :# ino'#blk2#:# $ $:#fs % #$G &'#7 ''#  (:# )j#S< '<2"S] 'HSs cS 'y  {o H Bv# C2# D:# E:# 7 F:# G#S< =<="^ =:Hn# Gino K'# L#pm62fs5 {5H:@@a:b: $:@@2<fs# ^P#:~8C:@@Kfs= {>H\?< ?@<6A<bBK PD2td!`D2!CD2!D2"EV"yEV!F2;!F2Y!G:y#%@<@I$$:%@@fs &sbP'wS(fs ){H)P2)"H'S6(fs )"6"o6":":"$G:"SjS@ @fs *iH^!S"-݃ ޱtH"!2k "!: +QNJ@+"g@,f-`%2 -C%2 -%2!-&:;!.x@@,$$$$/x@@01`$$2003 Z!000*4sS @n @!5fsr !-tS "x 1 p @#@ oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd%tztK $CS#_FD^#E #F # !G) #IN #p Ks #qL #5Ns # nP #$ Q #(S #,KU #0V #4V \ ` $"S##i#_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\    Y <:#=:#K>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# !#2V#:#, H#ƃ# '#$G :#(  #,~ #0M#4lh#8T~#<Ϥ#@Ѥ#D #HӰ#LԱ#Pt !#Tְ#Xױ#\nowx#`ܶ#dv#'#K #M#(i# f @g p pn$ :#num :#$G :# o#  :#s ino'#blk2#:# !$ $:#fs % #$G &'#7 ''#  (:# )u#SG 'G2-Sh 'SS~ nS '  {o 'H Bv# C2# D:# E:# 7 F:# G#SG =G=-i =:Sy# Gino K'# L#{g SptrvpvRdp @ @I"Lcu" @ @i' @ @!tx" @ @n @ @#P @?!@"$bbOn"!@'!@U !@'!@!tx".!@:!@W .!@:!@#[@!@I!@0#%bbZ &:A&'@'()#()#))#*%L!@#@\#$fs #!@!@"t !@!@!tt!@!@$ !@!@!tt!@"@& !@"@!tt"@:"@( "@:"@!tt"@#@6"@"@E8 "@"@!tt"@"@Gc "@"@!tt""@#@I "@#@#"#@#@: #@#@#}e #@<+@ oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd% tzt K $ CS#_F D^# E # F # ! G) # IN #p Ks #q L #5 Ns # n P #$ Q #( S #,K U #0 V #4 V \ `  $ "S# #i#_F $#i %:# v , #  3 #7 4:#9 5:# 6 # = 7v#X 8v#\     Y  <:# =:#K >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# #2V#:#, H#ƃ# #$G :#( Ƀ#,~ʎ#0#4l#8T$#<J#@J#Dҙ#HӰ#LԱ#Pt #TV#Xױ#\nowx#`\#dv#r#K ##(#e  <e$S#fs  #!#end!# ,"###$#%S#&\# f @g p  S '2S 'S$ SD 'D*P l {o lS ==x =:a#  {c S$Gptrvppvg SEptrvpvg:xnrV 8ӻ !:":S#@<#@##9 #$X<#@G#@$% $H#@S#@@$% $ST#@#@l$d#σ$#$S$&neqS'end'%#d;%'I:nrV 8v!:(Q"#@#@g%)map! %*i#%*j#%+j#@#@),,|-#@#@.%/AnrV 8v!LAH(k#@R$@&0i.&0vj2p&)numj:&*il:&+$@)$@t,*1 &-$@)$@25/nrV 8v!LA(*]T$@$@&0[$'0v\2f')num\:'*i^:'+$@$@f,1'-$@$@23#?S$@%@'0&; (0$<SE(0=()num=(4in>v3L0S%@s%@(_0&, (0$-S()0.u))num.)4out/v5t%@%@)# ):nrV 8v!:'SP$Gptrvpv$S%@&@ *#$S7*#}ޱ*#(ޱ*#& 8+!S6$GkX+6k+6+7,,,8.&,9p&@&@,,-p&@&@.R,$FS&@<(@p,#$BS,'fsB ,#C--'endCe-#,C-#YD^-#CD1.&retE!G 6HSQ.6$GIk.78K,,8P27h`,,8..:Q'@b'@b,.-Q'@b'@2:7jE,,8..:'@'@lq,.-'@'@.:/9'@'@m,.-'@'@2: $S<(@c(@/&src %0$ ~Sd(@(@F/:%y&endz%,{%Y|^ &ret}5/(@(@r/#- /#.:/&arg.$s:(@)@ 0# 60#2x09E)@)@,a1W0-)@)@.l0k:ivj23L:)@)@00J10vK2p1)numK:1*iM:2+F)@S)@U, ,$x:)@)@2# K2#29j)@)@,1|2-)@)@.2$/:)@*@2k# 3#2J39*@*@,13-*@*@.35*@*@3#3::*@P*@,.-:*@P*@;:tx:a*@w*@,.-a*@w*@;:tx9*@*@,.-*@*@2:<r S*@<+@40$S444neqS)bm1  4)bm2  4*i 25= +@+@, ,++@$+@, ,K!2 <+@<@oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {  ( #   #~-3  h# # M # # #  # x# P# # # B # :-r 's# t# u# v# w# x# y# z# {# |# }#  #$ &#( #d #h X#l H#p #t p# # # E# ~# D# # #9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d  #h   #x  ! # "# '# (# )# - # .# /# Z 0# J1 #  2#  3# 4# 5#  6# 7# &8 # 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F # { % { % {? { { { % {BCDh Ed? %O U t& $C. #_FD9 #E #F # !G#I)#p KN#qL #5NN# nPn#$ Q#(S#,KU#0V#41 7 ` $". ##D #_F$#i %:# v,b # 3 #74:#95:#6 # =7v#X 8v#\    4 <:#=:#K>]#?]#. b & :vk:. 4 . & : k:.  h d { . 9 : &  . &  . & : . )& :v . N& : /. n& 9 9 T. &  t. & ]:v. & ]:  d {H_A_$. #io& #9:#F# #2V#:#, # #ƃ# #$G :#( #,~#0(#4lC#8TY#<#@#D#HӋ#LԱ#Pt #T֩#Xױ#\nowx#`ܯ#dv# #& #F#(b#f@gp pI$ :#num :#$G :# #  :#w ino #blk #:# $ $:#fs %#$G & #7 ' #  (:# )#. " " . C .. YI. y y_L֩ #  #  #  #T #t #xC  #|  # # # # # # #| !# "# ##4 $# %#  {o  H Bv# C # D:# E:# 7 F:# G#. @ @ &b :Lltz`$ . #fs!#" ## # L$# #S% #Y& #'# #_( # i)#$ *:#(ptr+#,,:#0 -#4v1#82v#<s3:#@4:#D5#HT# Gino K # L#  {. h# v : { . H$Gptrvppvg . rptrvpv. 7 $Gptrv <!<. <+@z+@E5"fs;q5#i=:5$|+@+@51%wh5&v&v!:+@+@5%wh&6&:%:E6':d6(. +@O,@6%wh6#fs6). P,@p,@6*wh*{:+J. 8wIh,|K ,L. +(. zwh|"blk bbI). p,@/@7\-whB7.ino\- y7*: /. 7/@:R80,@1234r84+818e2V2J304b84n9 )Z. /@3/@/9*wh.ino\* y(J. 4/@F0@[9"fsI9'K. 95HO202$3`4<:5xT9202$34<1:6H/@/@Ve2[7/@/@4g]:5Hb2[34gq:6r/@0@]2228/@0@202$7/@0@4<:9H#0@70@a:[:7#0@70@4g:)t. H0@&4@:;fsr';;inor G;- sy;-s:;,{u,vu/uZ</Ku</v. <<:w~/8w==ptrxe=/YLy:==iy:=/4y:>0"1@)). (4@5@>;fs>;ino >- y>bufy/$G:P?,M/. ?=t?). 5@5@?.fs.ino * y)R . 5@8@?;fs %@;ino  \@-  y@- :@,{ ,v / @A/K A=ptrA/. A/YL:{B=i:B,:/4:B=io& "C)m. 8@8@ZCF.fsk.inok * ly)e+. 8@9@C;fs*C;ino* D< ,~/-. zD) . 9@:@D ;fsE;ino jE-"E< ~=i:F/. %F$ :@~:@oF%whF6H<:@K:@s2[7<:@K:@>gtx6HR:@g:@2[7R:@g:@>gtx9Hn:@y:@2[7n:@y:@ g!k. :@<@FH!"fsi G%ei:)G&jH!?wlh'm. yG'n(G5Y 202$3 <5r 2228;@;@202$7;@;@4<G6H;@;@ 2[7;@;@ g5  202$384<#H6H <@(<@#!2[7 <@(<@4gOH9H(<@8<@2[7(<@8<@ gh W <@?@hoh"intXf~t] !(Vy%d% t $C# _FD# E-# FC# !G^# I# p K# qLC# 5N# nP#$ Q#( S#, KU3#0 V9#4 `8 $"# ## _F$# i %:# v,# 3# 74:# 95:# 6# =7v#X 8v#\ CI  <:# =:# K>]# ?]#   x : v k :    x :  k :  d  ' : '  C 3 ^  :I   x : vd   x :       8   ] : v 3  ] : dI*=<@9=@cH ;HK;xH7 <:I5<_II<=@=@I GIvG]HJ7 H: K5Hv)K@Y=@s>@IKW WuKvW]K7 X:L5XLt>@?@L M2MjM2 MptrMargN ?@F@oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' { %7 {BCDh Edt%t[ $Cc#_FDn#E #F # !G9 #I^ #p K #qL #5N # nP #$ Q #(S #,KU #0V #4f l ` $"c##y#_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\  $  i <:#=:#K>]#?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {H_/ 5 A_ $c#io[ #9:#F# H#2V#:#, X#ƃ# N#$G :#( #,~#0t#4l̏#8Tͥ#<#@#D#H1#LԱ#Pt H#T#Xױ#\nowx#`#dv##[ #7#(S# f @g p%+ <B cn$ 7nBTc$ 7zc$ c$ 7L # # # '#T #t #xC #| # # Y# # # # Y#| !# "# ##4 $# %Y#  {o  c1$ M1MS$ M:= i { c$Gptrvppvm6Bfs5$ {5X0QVaPVbPVc47 $Gptrv Ofs$ !Wc?@?@/N"fsV$ [N#~V zN!ac?@?@N"fs`$ N#@`[ N!ic?@@@1O "fsh$ ]O#@h[ |O$!B@@@@O%fs $ O&P B7P%i X{P'bg":(#:)$:P*p@@y@@-++$Tc@@bF@PZ&_FPnP&Pn5Q&9Q:Q& Q:Q&i RVUR&RyR,SZ'fsU$ )VcsS-iW6T)+XT(mY:(M Y:)dY:T)PZBU-blkZBGU)0[ZU'cp[.IA@/iPc++|0h1i@@&A@m++|2A@&A@3U1iA@A@8++|2A@A@3U1iaB@B@i++|2mB@B@3U1iB@B@++|2B@B@3V4+5VV6"E@ME@++6SE@E@*+++7ihE@E@++|2vE@E@3tV2-F@QF@8gd<NV74MF@QF@C+C$ 9@cdF@F@V,_F=n,9=:, =:,i >V ,>y,?Ze^ F@G@.oh"intXf~t] !(V0dy%= HBOT,3x8V J:b]sA v #T##l# , #4 #O# v#C##    P ( Q# S T#O3RU ]2 h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck2 C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F"#   %  % ?   "  2 BCDh ERGdz%ta $Ci#_FDt#E #F$ # !G? #Id #p K #qL$ #5N # nP #$ Q #(S #,KU #0V #4l r ` $"i###_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\ $ *  o <:#=:#K>]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* H_5 ; A_ $i#ioa #9:#F# N#2V#:#, S#ƃ# T#$G :#(  #,~#0z#4l̕#8Tͫ#<#@#D #H7#LԱ#Pt N#T#Xױ#\nowx#`#dv##a ##(;#f @g p+1 BH it* 2t=Zi* 2i* i* 2  o i* HH;* H:%jZ #erri#AiF@_G@Vfs@* WZ@dWBiWrbCAh D~E=W r-:`G@G@Wbfs(* X(tPX )^ h*= G+:,vX!rb.bAcv G@Q@~oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' { %7 {BCDh Edt% t [ $ Cc#_F Dn# E # F # ! G9 # I^ #p K #q L #5 N # n P #$ Q #( S #,K U #0 V #4 f l `  $ "c# #y#_F $#i %:# v , #  3 #7 4:#9 5:# 6 # = 7v#X 8v#\  $   i  <:# =:#K >]# ?]#c [ :vk:ci c [ : k:c  d { c n: [  c [  c9 [ :$ c^ [ :v? c [ : d c [ nn c [    c [ ]:v c [ ]:  d$ {H_/ 5 A_ $c#io[ #9:#F# H#2V#:#, X#ƃ# N#$G :#( #,~#0t#4l̏#8Tͥ#<#@#D#H1#LԱ#Pt H#T#Xױ#\nowx#`#dv##[ #7#(S# f @g p%+ <B cn$ 7nBTc$ 7zc$ c$ 7L # # # '#T #t #xC #| # # # # # # #| !# "# ##4 $# %#  {o  c1$ M1MS$ M:=sas#  {c  { c$GptrvppvI:nrV 8v!:g c'ptrvpv"TcG@`J@X#fs$ X$:Y$:'Y%i XFY%j!V~Y&>":Y& ":Y!#V&$cZ&b%Z&%Z!l&:%blk'B ['(Bt`&.)7k[(;dH@(bH@(yH@)G@ H@7d**+H@ H@,)7H@MH@?**+BH@MH@,-*.,)I@I@Y**+I@I@/[0?J@MJ@*+?J@MJ@,:&fs$ :Efs$ 1MPc`J@J@[2fsO$ [3Q::\3R:c\1CcJ@J@\4fsB$ 1>cJ@J@\4fs=$ "cJ@P@\#fs$ ]$:Z]$:z]%iX]&]&9^%buf^&c^&>:X`& :`!l:&:a%cntV$a%blkBa'BtD&B[b&.7b&37c5!O@5P@-L**.,6/m*.,7K@K@#*+K@K@/Uc7K@K@+*+K@K@,7L@L@-*+L@L@,-8*8uc.P,)L@L@=*+L@L@,)'N@;N@n*8c+0N@;N@,7N@N@'*+N@N@/c6h*.,9P@P@*+P@P@,1HcP@P@c2fsG$ c19cP@Q@?d=4fs8$ :4cQ@Q@kd4fs3$ q Q@R]@oh"intXf~t] !(V "d (Vz )V4 (V)V@!*V +VM ,:!-VU.V0dy%4`9!a#*b#c#d# '!e#f#[!g#Ai# k# l#$ m#(Jn#,yo#0 d %G At$C#_FD#Et#F# !G#I#p K#qL#5N# nP#$ Q0#(SU#,KUz#0V#4`$"###_F$#i %:# v,# 3>#74:#95:#6D# =7#X 8#\  <:#=:#K>]#?]#   : k :  7  : 7 k : =  dT n  : nT  z   :   :    : 7     *  * U  ] : 6 z  ] : 7[d @bufA#vB#"C:#(DV# e EV# 8LY$M:#devN:#9O:#"P:# KQ#RY# S#ig ptrp $Gptrpp Q@TQ@d# d^)*e1e5#ZeSTQ@Q@e5P#evQ]eR=fTf: Ttp TfiU:fl Q@S@fp g5#=gv]fg7 :gbuf7g$Gvg ,hS :thh.R@US@yS@h }i5~#'i:Fizii tpi:i.!|S@S@iI   j5#djwj pS@T@j  nj5n#jokvo]Gk T@TU@k`  kv]k7 :3l!buf7kl5#ll llcp9m:YmTU@qU@m " vm"7 :#buf7 tU@V@mj  n5#4nv]hn7 :nbufnn$Gv=o xoS :o$.V@$ EV@X@o2  CpvC]:p7 D:p!bufDp5F#5qGUq G2 XHqcpIqiJ:rjJ:ArB  X@X@mr " vr"7 :#buf iX@8Y@r  rrNs!args5#stmp]send t 8Y@Y@Nt  ztKt$G:#u!buf7Ou5#{uuS vu :Y@$Z@v59#-v;Kvi<:^v%iY@Z@E&|'Y@Z@(tt&$Z@Z@qv $v5%#v'v(wi): w%UZ@lZ@1&&'`Z@lZ@(tp !,Z@Z@>w +jw!+:w5-#=x.qxZ [@[@x x5#yGy)it[@[@$&|'t[@[@*{y)i[@[@&&|'[@[@*y%i[@[@'&|'[@[@+ [@R]@yD_Fy9:z" nio,5#Kz::zst]@-&&.+-&&.+)1\@Z\@&&'I\@Z\@*z)i\@ ]@ &|'\@ ]@+%i$]@4]@ &|'$]@4]@+/G!s @08 Y:1@6 c! T]@]@ oh"intXf~t]yd%t!GT]@]@z l!Eu argEk F{ ' ]@j@!oh"intXf~t] !(V0dy%= HBOT,3x8V J:b]sA v #T##l# , #4 #O# v#C##    P ( Q# S T#O3RU ]2 h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck2 C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F"#   %  % ?   "  2 BCDh ERGdz%ta $Ci#_FDt#E #F$ # !G? #Id #p K #qL$ #5N # nP #$ Q #(S #,KU #0V #4l r ` $"i###_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\ $ *  o <:#=:#K>]#?]#i a :vk:io i a : k:i  d  i t: a  i$ a  i? a :* id a :vE i a : j i a tt i a    i a ]:v i a ]:  d* H_5 ; A_ $i#ioa #9:#F# N#2V#:#, S#ƃ# T#$G :#(  #,~#0z#4l̕#8Tͫ#<#@#D #H7#LԱ#Pt N#T#Xױ#\nowx#`#dv##a ##(;#f @g p+1 BH it* 2t=Zi* 2i* i* 2  o i* HH;* H:%0"6 %7H# d"8H# k&9# ;:#!=k"!,;fs* #!d#!^#":#9:#l! i#!!#!"# !##$$v#(:d* t^=:v;! !# "v#:* t:v i$Gptrvppvi37 $Gptrvg i]ptrvpv !:]@]@X{!fs* "("t"^"h="G:"vxlj#!=:]@_@{$3';t{$h;={$G<:{%ctx< |&ret>:q|'\">:|&i?:|'9?:-}'!?:l}'K?:}'@t}#>":`@Xb@~k$!t@~$h=_~$G:~~%ctx~&ret:'\":5&i:y'9:'!:'K:%'t](!:)Q"t)h=)G:*ctxإ+ret:,\":+i:,9:,!:,K:,t-"1iXb@j@Q.fs&* .ino'2Հ/9(:/b)Q/!/d/0v0i2:0r3:80ret3:1 4~25i33ctx62!7:m4"d@4~"5h@4"d@5c@Kc@RO6667%c@Kc@6687c@Kc@92S&j1`$kAD2l^o0blkm=2!m=_0opn:ׅjoV:k0+6666|;`<,<<<s<<ۇ<>73Oh@bh@6F8Oh@bh@R="ij@j@!fs * !ino 2"9 :"b  "!"v3xljp#" j@mm@($h"intXf~t] !(O0]y= ABHT,,x8O J3bV ^ #T##l# , #4 #O# ^#C##n n  P ( Q# S T# O3RqU ] h^# _# M `# a# b# d~ e# xf# Pg# h# i# B j# \:ck C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l~#t n9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F# n no n? n n! nBCDh E]d tzt K $ CS#_F D^# E # F # ! G) # IN #p Ks #q L #5 Ns # n P #$ Q #( S #,K U #0 V #4 V \ `  $ "S# #i#_F $!#i %3# v , #  3 #7 43#9 53# 6 # = 7o#X 8o#\     Y  <3# =3#K >V# ?V#S K |3od3SY S K |3 d3S  ] n S ^3 K  S K  S) K 3 SN K |3o/ Ss K |3 T S K ^^y S K    S K V3o S K V3  ] nH_ % A_ $S#ioK #93#F!# 8#2O#3#, H#|# >#$G 3#(  #,~ #0d#4l#8T͕#<ϻ#@ѻ#D #H!#LԤ#Pt 8#T#Xפ#\nowq#`#do##K # #(%# f @g p ,2 S^ '^2DS 'jS S ' no S ==% =3#~3W|  }'J# j@k@fs {HCcrc!b"> !K'3"a#Nk@k@fsM Չ#{MH$"WI%U %"V%C#VH&iX'!0#X'!"X''(d)fs *"gSk@+m@]fsf ,+sbh8t`bgi>L(j3uikH,K!:#u3!"v3!w3-~./. 0(11ъ0<2+il@ul@^/J/>-I.X3|#C3,m@mm@fsB B#{BHx&% pm@@%oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' { %7 {[$ !| &"#j&##%$#&%#Z& ,&-##.#&0#$1# {% 7 $8#$9#&:#D$;#M$<#7|BCDh Edc % s y t J $ CR #_F D] # E # F # ! G( # IM #p Kr #q L #5 Nr # n P #$ Q #( S #,K U #0 V #4 U [ `  $ "R # #h #_F $#i %:# v , #  3 #7 4:#9 5:# 6 # = 7v#X 8v#\     X  <:# =:#K >]# ?]#R J :vk:R X R J : k:R   d { R ] : J  R J  R ( J : R M J :v. R r J : S R J ] ] x R J    R J ]:v R J ]:  d {H_ $ A_$R #ioJ #9:#F# #2V#:#, G #ƃ# #$G :#( #,~#0A#4l\#8Tr#<Ϙ#@ј#D #HӤ#LԱ#Pt #T#Xױ#\nowx#`#dv#9#J #_#({#f@gp pm$ :#num :#$G :# #  :# ino& #blk1 #:# $ $:#fs % #$G && #7 '& #  (:# )#R ; & ;1 !R \ & GR r bR  & xL # # # '#T #t #xC #| # # 9# # # # 9#| !# "# ##4 $# %9#  {o 9H Bv# C1 # D:# E:# 7 F:# G3#R Y < Y< ?{ < :e0"6 %7< # d"8< # k&9# ;:#!=k" =Z$4R #fs5 #ino6& # 7# N8:#d%9:#:%::#I@;#j%0f %g:# &h:# &i:# %j:# :%k:# &l:# #m< # &n< # D%o#( $p#,m# G3ino K& # L#  I {#$'buf(#$):#%*:#Z+:# &,:#9-:#$.< #%/v# I R $Gptrvppv%.:.fs- ino-& g R Xptrvpv#R pm@m@m ptrv!$G:ċ"&:R#$&:$eh %$`R m@wn@&S&^&$_]'I@atlZ(8$R xn@n@}a&S&blk< 'R P)ix nj%$R n@o@ڌ&S&*9:&`$<+I@ix ex %%R o@t@r&S& &9 :&`$ &,I@j,}$)eh )ix 2ex ,R )blk1 '$< PR+$:)op:1-&.(//0@1%$#R t@u@&S&"Ց&9": ,I@$7cp%)eh& k,'R 2t@t@|ix< 0X'`$FX(.%VR u@ew@ &S&T &_%U:?3blkU< ^'`$WT,XR G4%v@%'%R hw@w@I*S&3blk< (5&R w@x@ڔ&S&':P,< <,I@d'`$T4%x@(#R x@~@&S&ĕ,R ,$1 ,%< ڗ,$< ,&< E,g$:,b'`$L,I@,}$Z)eh ә,& ',%:f,q& :'$!Z4%y@5.y@y@/A6y@y@7M5+z@Lz@`>//6Az@Lz@72z@z@,{G ,%!8z@z@/!/6}@ ~@,%4%#R ~@=@h7&S&&9:&`$,I@E)ix yeh ,R 4"6y~@%z&SR @@@9~&S&Qe&&R< & IR< ŝ&9R:)ecTR U,TR ~,%U:۟,g$V: ,&W:,#X:L,D%Y:n,$Z< +I@['`$\P's$]'$^Z4/&܀@4%@6@I@+$9%$@҅@Y!S&:i: ;.@A@/A6@A@O&u#S&?R ?x:5:i::eh 4"@@p//07;:@W@G//6C@W@1=@!@//6@!@1)' @@+oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd%tztK $CS#_FD^#E #F # !G) #IN #p Ks #qL #5Ns # nP #$ Q #(S #,KU #0V #4V \ ` $"S##i#_F$#i %:# v, # 3 #74:#95:#6 # =7v#X 8v#\    Y <:#=:#K>]#?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# 8#2V#:#, H#ƃ# >#$G :#(  #,~ #0d#4l#8T͕#<ϻ#@ѻ#D #H!#LԱ#Pt 8#T#Xױ#\nowx#`#dv##K # #(%# f @g p ,2 S^ '^2DS 'jS S '  {o S ==% =:'0S @K@sfs/ 3blk/2buf/v''SL@@ufs blk2bufvSK+D' @ۈ@,h"intXf~t]yoG :M'{r@ۈ@fdz3Kzr" ='z3 8Y3f+x1 ܈@@`-oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd% tzt K $ CS#_F D^# E # F # ! G) # IN #p Ks #q L #5 Ns # n P #$ Q #( S #,K U #0 V #4 V \ `  $ "S# #i#_F $#i %:# v , #  3 #7 4:#9 5:# 6 # = 7v#X 8v#\     Y  <:# =:#K >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# 8#2V#:#, H#ƃ# >#$G :#(  #,~ #0d#4l#8T͕#<ϻ#@ѻ#D #H!#LԱ#Pt 8#T#Xױ#\nowx#`#dv##K # #(%# f @g p ,2 S^ '^2DS 'jS S '  {o S ==% =:(_S] v^2$(e{c vd2'xv  w'k:i vj2'܈@ @fs ͤ!  old  ':V v2num: l'S@ۉ@ !fs 8"2X"I2!num:ȥ!map Z#ret^$b2%@@&I&=&1'N(":܉@@!fs  !map G"{!Hf$i#:$blk$2(`$2§(C$2֧($2(%:)S{@@E&n&b%+̊@ۊ@C&F&: ['S@@P!fs J"(2j!map Ψ#ret^ $i22%@@&& S$Gptrv*ppvg Sptrv*pv 'S@@P!fs |"(2ɩ"b#ret^ (Sj(v2$buf +r(X@,Pe&o&c-.{/}0new=X%_@m@&1_@m@.2w(P:3fsN 3mapN 4{OH5iQ:5inoR'6#~:|  }''X:AV  W' a(jS@@+c!fsg W!dirg'w7)h:!mapi #retic8D(k'$il'ë('m')@@*9&&1@@:.%{@č@[92&)@@H&&%4@@@&4&('.) @W@/oh"intXf~t] !(V0dy%= HBOT,3x8V J:b] k #T##l# , #4 #O# k#C## { {  P ( Q# S T#O3R~U ]' h^# _# M `# a# b# d e# xf# Pg# h# i# B j# \:ck' C 'D# E# F# G# H# I# J# K# L# M# N# V#$ &W#( X#d Y#h XZ#l H[#p l#t  {9 # #  # p# T# i# c # w# ~ # #$ #( * #, #0 #4 Z #6 #8 -#: -#< #> 6#@ #D 1#H  #L  #P  #R %#T  #X #Z #\ #` %#d #h  #x  !# "# '# (# )# -# .# /# Z 0# J1#  2#  3# 4# 5#  6# 7# &8# 9# j :# V;# <# =# ># ?# i@# dA#  B# bC# D# (E# F#  { % { % {?  {  { ' {BCDh Edd% tzt K $ CS#_F D^# E # F # ! G) # IN #p Ks #q L #5 Ns # n P #$ Q #( S #,K U #0 V #4 V \ `  $ "S# #i#_F $#i %:# v , #  3 #7 4:#9 5:# 6 # = 7v#X 8v#\     Y  <:# =:#K >]# ?]#S K :vk:SY S K : k:S  d { S ^: K  S K  S) K : SN K :v/ Ss K : T S K ^^y S K    S K ]:v S K ]:  d {H_ % A_ $S#ioK #9:#F# 8#2V#:#, H#ƃ# >#$G :#(  #,~ #0d#4l#8T͕#<ϻ#@ѻ#D #H!#LԱ#Pt 8#T#Xױ#\nowx#`#dv##K # #(%# f @g p ,2 S^ '^2DS 'jS S '  {o S ==% =:%.:Vfs- ino-' )J:H  I')Q:O  P'fs #)fs )S@@[)fsL !O%oldR)%(@@Ƭfs ino'( 0:H (:t!{:"+@@#I#>"V @@#u#i$!8)$'"s@w@1#%@@##K)5@Ï@V&fs4 &ino4'04:(%:fs$ blk$2)5:3 v42d)<:: v;2( fs  '(:ď@W@̭fs9 blk92. 09:j!{;:"Vӏ@@;^#t#i"@@>|##"@@G#%D@W@@##0) X@@1h"intXf~t]yBH)O)<vX@@crc;v̮H;len;Ocp=   A k * k@ d1*Z*@@1oh"intXI5Sf7l~t] !(l 'ly.a%1?id2#I@3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4Kz 2  #z# :#    %  2 # *#   2 l *Q:@@A *\:@@mN*?Farg+@@*?ůfn?tmp?-fd:9:) :;*a@o@detel el2+*ap@@0etel*:@@Z+9 +e@@da= Kf:tletg} !*hatp*i:cpj?!+@"@@msg#%$% H3|@ *:t@ *0x@ V&8 Y:' 5l@'*6p@31+Z*@%@3o7]D%int;+>@%@num, chI0 iI pY% % ? (+m@ % buf@[w4p+Z*(@X@3+!0+:oh"intXI5hf7~t] !( 'y.v%1Tid2# I@3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  :+,    v  %+2(@4@l +00vfmt0>1% %   %_+E_4@X@_T+DijxF  ]+P_X@l@xQ-+l@ @@+lvfmtٴ>%L+9 @X@/9+67vfmt8z+:%[ 8F kc+.@ 5+,X@@4oh"intXI5Sf7l~t] !(l 'l0zy.a%1Jid2#I@3J#pid4#.5# 7#8#>9#:H#4<#A=P#! % HO>]4V %| | = SBZT,3x8l J:bs 9  # # #p # T #i #c #w #~ #  #$ #(* #, #0 #4Z #6 #8- #: - #< #>6 #@ #D1 #H #L #P #R% #T #X #Z #\ #`% #d #h #x !# "# '# (# )# -# .# /#Z 0#J 1# 2# 3# 4# 5# 6# 7#& 8# 9#j :#V ;# <# =# ># ?#i @#d A# B#b C# D#( E# F#  | % | % |?  |  |  |+h`sg`fgfij:jj:+j:*:klmk  a W,s`ff+:I,}s|`f|fi:+:*:mi,?DD+>lhrA:minA:numA:buf@l@tmp@H @ J%y,quidZff,*gid)Zf)f+X@@oH sb`ffG :bufH strJ tm K%8 .n7@˶KVCr` t w ۸ Է*S  q0 Ѹ  !O@Λ@ g\!q@@- ~"@!@#2 # %X |O$+D@@g %sC`&b7f7,,Ģ@E@7oh"intXf~t]y%x8V,*:V#O2# % ,4:Ģ@f@ O23r *:3 f5#8 ,6ranum7:V,NrEcpMr,UracpTr ,a:h@ڤ@-str`ۺ ,`-ok`{K cpbrbufbr 2 br negc: *:dV+ rce:n)@֣@n:E\@@oV{ ,%ܤ@E@ *:$Vüf&# ,(:buf'@%xx,@ 9/,H@@?8oh"intXI5Sf7l~t] !(l 'ly.a%1?id2#I@3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  -H@@- fY -Zɽ V9~,@ @8oh"intXI5Sf7l~t] !(l 'ly.a%1?id2#I@3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  -@ @ fB -Zx VFk:-, @@9oh"intXf~t]y%= HBOx8V$/ :- # 1- # ^-# C-# J# z  M-: @-@@ uukľcp@i:z- ~inkuu~ptr!@tmp"r-:0@@uu9kout9t$/;dF:@@=]S:@@gr $-G2@@2 uuFk;bufH= @8%% O5;-, @@#:h"intXf~t]yok--3 @l@}str,rcpp. i/3 k-rl@@  -35 oskretr ' x-@m<-,@ά@n:oh"intXf~t]y%x8V%B.  :# *:V# O2# 2.:@@: O2r .: *:@Q fF} ,rnum::V .z:@}@ O2yr .y:m *:y@ f{F ,|rnum}:,rcpr,rcpr-:@@I stru[. - - 5h.:U-@cprbufr2 rneg:-*:V.:rc :@@X {J.R:@@]strQ[.Q -Q  q.@>@ : *:VRfF .% ,:bufEp@ .[@@ά@E Z:2 *:ZVtf\F .^% ,_: buf]E@%Uxex.U@@x .Ov@#>.,Ь@@;oh"intXf~t]y%.num:#O2# % .0:Ь@_@( O2/rT p1 ,2r num3: { . `@@5Tnum:ap!buf"T@%dx{tx.d`@0%?~/.@Y@<oh"intXI5SfX/6e7w~t]y%$/2:-3l#1-4Z#^-5Z#C-6Z#J7# H  A@@ c=A!)0CA@߯@@ cBAl@@@@3/RA @T@ cQA +@2@Sv 1 H8@R@S /WA`@w@. cVAZ0\A@@y c[A 0aA@@ c`A;AV020@@=87Ԧ@intAu120@@=h"intXf7Z~t0yZ] !(Z1I1J#2 K#1Lh#$GMh# Nh#C OM#p0OM1YM#2 ZM#v[#$\Z# $G]h#1^h#1s30z3 0 s cO nz i3  1 ptr13 1 13v~ 0d s1 s2d nz0k1kx0xjqoZ &1 s c3 nz i30@Ű@1а@s@;ptrgminMmajp -' hS@@`:@@@m`@{@~`@{@/ȱ@@1h1h F@]@!1@@BZ"$Ghn#sth maj ̲@@$ %m ~$ &i0> @_@'1=z(^0?3H1@apA' Bh!majCminDM0EM$GFz%`>@J@ZSS@X@P`I@K@`@@p `' Dh`@@L@@' h&J`@@p>'$GzptrminMZa1 z ' .hS@@0`@@m(  qs.$$0 7BMX`C@H@i`@@^&O1 @@'1 z'$G z>a13p^ ~ָ@@ָ@@)R*0bЙ@*k1cԙ@+V1eM,3*1f3@*61g:ؙ@*0h:ș@*1k:@*B1l:@*0m:@-1q.AD220@@E@h"intXf~t]2#]@@qstr"2"B"3$]2%3  C&6/'3a o 8Y3D!232@1@@h"intXf~t] !(O+2*@1@dst)src)n)d0H d,Qs-R o  Z3Et232@@4@>Ah"intXf~t] !(Om2#Aya243@@@qs12s22n3d ` us17Cus28a  o  o V2%3@4@s1$s2$us1'us2(,E232@@ٽ@Ainth"Xf~t] !(O2A@@ٽ@y2:2:4:ddstB2srcCftDd%}@   o   fF232@@XBh"intXf~t]2#@@Ks"w2"2$o F232 @N@Bh"intXf~t]2+ @N@p*ch*3c,QoUG232P@}@Bh"intXf~t]2#P@}@,to"X2"w2$o G232@@Cinth"Xf~t] !(O0A@@2:2:4:ddstB[srcCtDd%}@@   o   jH232 @@Ch"intXf~t] !(Om2#A2%Oy/1< @@t2:c0:34:d t=d- c?z dstA o5HK3/@q@(Dh"intXf~t] !(O93#d@)@s"'"dFlen$de  o 3/0@@Cn.Os.C.O st0IKi1O&y;Oe x t5O YY A3]@(@str23]43 c[30@7@8strN33@@I@d1s1s2,3P@l@F3ɸend˽]43̽_ͽ^neg3(23Qout@ N CT3 p@@dF3 end *N%3@@KF3end 3EV@@F3D2D`D3FVnegG3outR@`33 @C@s31P@q@1F323yfJ543@>@]Eh"intXI5Lf7e~t] !(e 'e"40Zzo y , _F-# 9.#  w3/3k@@e3jZFGjZ5jil3\4qZz5rZup3e@@3dA9dA3F4 @@43E09E3GdiHZPCHZn 449@>@^i:Zp36@h54@  >1@  32@Kg43@@@}Fh"intXf7Z~t] !(Z'J(#$G)o#P44*zo  Z4&'#4(O#  4a@@@2 4`O4b2ic3 o4O@@"y 4NON4P2iQ3A4,O @@ +b4+Oid-OZ4524<2i=3,4#@~4$O@L53 @@>Gh"intXf7Z~t] !(Z 'Z"40|Ooz 3 pid4O# 55O# 46o# 57z#  58 '$ J(*# $G)o# P4$4*Ao 4tpids|5sOCu35v 5r @Z@?pidp|5pO5q;5b`@@kpida|5aO5a34S@@gpidQ|5QO5RO5C@@pidA|5AOlenAo5B; E5A@,@40@y@{pid|G5;f4o5;5O5{5K g\ r}A H!51@@pid0|50;40o50; "52!4;@%@-#pid|Y$5;y$4o$5;%B;%5%5O&9530@@pid|>5;^4o~5;B35&4O@@ppid|15;Q4oq5;BO5߉'c5L@@e3J|$5JOZ4Koz5Kz5MX5Nz(}53O@)h5:*5.@0N865@@Hh"intXf~t]o.6@@$6 @@|,O6@ @Hh"intXf7Z~t] !(Z 'Z3pid4O#55O#46o#57z#  58 o   'J(#$G)o# P4 4*y(V_F)#B*#6+1 7@@;C3g6͙ V =6@@C366C @@_FBiD356E6@@Sd_Fi36 S*@+@_F607e0@@C0do$GdoBh 63@@__F'BG636@I@6 63 @g@I@O636#3p@@str"Gsep$g w6.o_F/63@%@ 6\0@3@!pidZ|5ZO"GZo"5[z #5]zud#i6^ouh#_6_oul6_o;$i`3up6a 66@@ @NU>=|z@@J6AU@@>C _FKBL #6-l@ %8Y3DQ)78@F@Jh"intXI5Lf7e~t] !(e 'ey58"3oF88&Z 8' ?8(# 7 6 8!6# 8"<# ]7#3# =$3# 59%<#  6 7) 7*6# !9+<# A9.3# U706# 9 4 p856# 576<# -873#W87n77.Z %1~ id2# I@36# pid4# .5# 7# 8z# >9z# :A# 4] 4+9@{?3y@ h7)@6@7( 7.S@@M@)$7-SU#73P@v@tQF82/78S@@~77S@@ 6?7<@ @U_F;i=3 H9-@@-_F 7Ei 3 Bw83@@73srcdst8 8f3@@#8eipeb8@@_FIi3i( 8ɸ@ nI@6fѾ7 ҒN7p6X 8 7@ 8@!ipZ@ 59@  Z "#z7@@G73$srcG<$dst6t$G8Nres6 M% T&87p6@@iporesr6*!bufq@'8T@F@=$strSi(@@V)*@+@X)"+"6+ "65+, 9 %@,8 %@,N8 %@"B{+,7k@,7.%@"+,80@-8&3`@. 8.8 Y3SN:8P@@~Lh"intXI5Lf7e~t] 'ey 9#A c::   3 ;:9#':#93#0l:9V9ob93P@@sl9s:3 93@@Cl9so:39&3@9@l9%:%3 W:>3@@2@I^)=3ul9=:=si?3]H:os@@@9nsidpZ@@93@@l9s93@@ l9ss93@a@Li43;:3p@J@xcsig3>:coldr i;: 9P@@F:3r9/:9H3@!@:G3 9[VE:g0@D@t:{P@r@<:z39k3@@w pidjz:j3G!9+w`@!9,@!v:-D@ 4"8Y39U6;8@@M+!0+:oh"intXI5hf7~t] !( " '@!*M ,Oy.v%1uid2# I@3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * ; : D; : ' J (# $G )# P4 4 *:'8 /;(8#fd)O# :+O# ;,O# dupO@@CkfdO:O@@ofdO;OO@@fdO:iO  :O@@'fdOScmdO:iO[@D@sap%argOP@|@ap%argO:PO@^@/;O8:\-i]O@::`@@S W;~8@@7fd}O!:iO:@@fdO) bufI "7 i "K #UD8 #'; ret  $:@l@& ZfdOR bufr "7  "K #UD8 #'; ret& U'p@@O fd~O{ "K~ "='~O #UD85 @f@9@^  fdeO He$Ge#UDg8 FoQH@@@ fdGO "HG "$GGX #UDI8 #FQ :8@@ %fdO&) ':O@@nM09O(:lL;fdO#UD%8)p af 8:@@|f8X* f8+:,-b;:O@@nM9)9(h;0 @ (p;3O@.:68.b78. 88.8 YOLW;8@@]Poh"intXI5Sf7l~t] !(l 'ly.a%1?id2#I@3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K g % ;C:@@ ;@: ;Ah ;Ba oliE?$D?(@  ? 8 V4?d@<1:$@;2:l@;0: @x;3:h@X;8@7@eQh"intXf~t] (Oz )Oy;#d@@=;)d@@i;/o @'@;5o0@7@"Y;8@@@Qh"intXf7Z~t] !(Z 'Z'J(#$G)o#P4 4*o y ; )  pid*|#;+ #;,3# 4 2<BCCpidA|iC3;DC <nvpidm|io3;pCF<|@@>@&pid|;&3;CX@{@# .7I@4@V aj 3;|@@c@.X;&#<Tp@@ZpidS|;VCoutf@@@V# .7;@@qpid}|5}OG}oH5~zh;C  K# .7!( #@ .7"A<9@@# <0@ $8Y3[N<8@@@Rh"intXf~t]oyd,9*r@@@ )3 ++ @d ? V[[I5@@@!Sh"2>intXf7e~t]orpc"@@[@/pid!Z[ #ZP Y<2>`@@zDpid0Z 40Z 50Zlen1Z 51z< 33P f<:Th ZT Da\u<5@@Sh"intXf~t]oo<@@[(\<@@Sh"intXf~t] !(Ooyo'J(#$G)d#P44*  & V= = < 9=</ I=1&]=2#=3#!5&# o6<ppcwd}<v=3}<p=pcwd}<v=(3i)3B=Fv!DlenEd]=E=E<Gv o<i@@I@hhp=h3f=jugposk=luh]=mul<nvzh <wd  !!!! "#@H@(!!!! "#H@@[!!!! "$@@!!!! " 4%=}@@*&I@V<v'<pv(0@@'}'4dn=@pi3<3<v)=:d9p$G;di<3<=v&=_]pH]}<^ib3<cv%=}@t@Z&I@<v*<pud=3'$GdJ'<}]+6@e@r!C,N"Y"d-|(!@,,",,-!, ),)R,4r+@@p@!!R"^,j"t.~@ @!!!,,/=}@@&I@'|M}7*pul'$Gdb'<v-@8+!RP"^,j"t.f@@-!!!,,+_>5@@Uh"intXf7Z~t] 'Z (Zo->'o@@ pid(o0=8o@@C pid7o 9oo5>Vo@@m =TO uidTz >T P>Uo pidWo  >k@@D>z@@ {_g>5@@4Vh"intXf~t]oW>@@,3e`y>5 @3@uVh"intXf7Z~t]o>! @3@X3 O]`>>@@"@V+!0+:oh"intXI5hf7~t] !( 'y.v%1Tid2# I@3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`>?  O :4?  O  O  :>   +?v# >#arg#>##fp$## k>4O@@{@fp3# 3ap3%>5 t>6h><O@@fp;# ;ap=%>OP?/O@@%arg.%O2.(n.O^  ?(O@"@~arg'%c':caG?>0@@Wh"intXf~t] !(O+!|+o>?3 o 4?3 o 3 >   +?# ># argo# |? &W H'W# ?(d# )d#R?-30@@arg,c,+ r?>3@[@aH= =ap=q>? ``?@TA3 Ws?e3`@@! Hd dapfqg3P c?>@Z@lXh"intXI5Lf7e~t] !(e 'ey.Z%18id2#I@38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K ?3 ?@@M ^<Yo@@y @3@@ /; d?3@>@ ,c3  @6@cs>u{@8@@@3!08_!pos3!c3!o&?3@@!c3!/;@@cs>u{?3 @|@3" ne_"strY"A3@@"7strY#?/@Z@E#~?0q#I@1~~$G2z#>V>V?)@:$`@b%d@ &h@8Y3 dN@>`@@Yh"intXI5Lf7e~t]o !(e 'ey.Z%1?id2#I@3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#55Z#46#57#  58a 7id8#29# A:#s@;Z# ?<?Iid@#2A# AB#s@CZ# 5DI# AX @EOyidP#MAQcUidV#Z@W K 4  z@& zres {K#2A |#%@/; V-@2%$G1l@3E/;%`@g@#c8p@u@#A3@@&$/;$K_3@@R$nM^A3@@~$_/;$H?%)3D%$G ?_kA ?out8@ @R3@@|%/;QAM3@@%/;LHL?$GLAG3@.@%/;FHF?@0@+@&src,&2K& Ai&/;&G&A&@vAJ6&@@5'  A  X+A30@@'7/;A'$Gw'^A3@@'u/;' @yp!@3 @@'"/;#(#ZY(Ahs@:@w(/;g( @npos(J6w) @N3@@@#)d/;MO)KMs)='M3)$A@@)/;A@V@ *55*2U* Au*/;*G+A83`@@N+:%str7/;7@%3@@z+c$3+/;$&ch&zu{@3@e@+c3+/;',AE!>Ap@ @], "0,"2," A-"/;=-#?- @\' J6-$G-()' J6*5.$G,S.@h @*i3f.+AE@F3 @" @y. /;E.,cGz.@]?0 @ @.u 0\?'/4\3]//;\}/,i^3/,c^3/!%AK @6 @/ "nMJ0")J%0-@L?up.msgR +U@SE*iW3g0#J6~0#/;0/+?_ z 0cA@ @\ @05@l3` @)@1 AkE1}$ke1 Hm _E@n@o,srcq1,dstx1/041 A 1!%@0@@2M "I@02")P2"?p2# @2+<@V-?-@-'.Z@-DA/@2 828 Y3gA> @H@]h"intXI5Lf~t] !(Zoy'J(#$G)o# P44* <e @@2 d32 msggd 5hzV;i,A, 3AE@@3AM3@@;3s4Lus <1@H@g3 033 @:@i43345u A(@8Y3 hB>P@E'@D^h"intXf~t]+!q+{o>?3 d {4?3 d 3 { >  +?# ># argd#]'CCBOCBCBA5B 0B0 B3KB:BOJBVlCBB{N N vC N#B ]#B}'B|buf|C|OB2VP@@3B1V3A1O;4 B1[4AB3Vrem4OOBL@z@4.BKV4bufK4*BKO5wBKO/5pMuXqBN.u`BOVO5BPO5 BQOup dB3@@5m>m5c{5C3@J@&6>mR6O2r6n36Pi3636 C3P@@7!B<7"C3e7#C-@@x7! ,7$ap,f&9%C.ud"B/39%C03ul"3C039"?C03-:"[B13:"bC23:&i33;#B3@E'@-; !>mY;! ;$apfu<&tZ>"3Q@"9{@"  OA"C!OA"4"ObB"B#O}C'B$O"C%3D"C&D(B?@)p&ret23E) &ret=3QE)'"O2E) &len3E&pad3F)e&ret3G*5&@a&@&ret3G) &ret3bH*@A@&ret3H*%@%@+ret3P)8&ret3H,&@'@&ret35I,m @ @&ret3I*@@E&retX3I)P-bufl %Bm])&ret~3J.}/0RJ1]) +buf " C3K)8 &len3L*&@&@+ret13P*@@!&retH3L*K#@p#@?&ret 3L)hY&ret#3M*#@#@w&ret?3UM*$@-$@&retC3M*-$@Y$@&retE3M)&ret-3M)&ret30N,'@5'@&ret)3oN*@@ &ret^3N): "B:N)T "BV%O* @ @r &retS3O&retY3O)0 &c{PP&ret3P,=@J@+retc3P2{ 3 45{6 B~kC>P'@-@ah"intXI5Lf7e~t] !(e 'e0sytm$".%E#3#D$3#&D%3#D&3# 3D'3#D(3#C)3#D*3#D+3# o.Z%1 id25#I@3# pid4#.55# 7#8z#>9z#:A#4@]4 )  D C D D D E E ,E D CD E !D Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec E =E D D .D C D Sun Mon Tue! Wed" Thu# Fri$ Sat% ZD& D' D( AM) PM* :D+ D,C|P'@(@hPwD{P{PgDPlD3PE3QD}&@  D`(@)@9QD__FEbu|BEo )@;)@eQ Dn D@)@[)@Q6wDD`)@j)@QbgDb htm p)@z)@QDԋD)@)@RD݅Dz)@3-@ARstrmRDzRCStmb9Si.%Tc.NT$GzwTnzTCUCHHDi .3..gDD@-@-@4UtC`UEutPDG U  3& tm"@1E%L؁@C&Lԁ@r,eD3 @b,l>>-@.@c+!0+:oh"intXf~t]y>?O :4?O O : >  +?# ># arg#B<O-@.@Uc ;ap;%>=l>CO .@:.@V BapD%EOP?,O@.@.@:Varg+O2+fVn+OVlen-O?%O.@.@Varg$c$:VnH?>.@1/@Hd+!0+:o>?LRggn:int 4?{gng : >  +?A# >p# argn# }?  H!# " #:~S?&g.@.@WKarg%Kc%:\E-g.@/@IWH,uW ,Wap,%W>.lLE/`0gWt?<g/@1/@WH; ;ap=%>gP8opE>@/@/@doh"intXI5Sf7l~t] !(l 'ly.a%1?id2#I@3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K yE'@/@/@X E%KX UD%vX K>%:X eE&:X  % 8 VzoE>/@x0@yeh"intXf~t] !(O+!|+o>?3 o 4?3 o 3 >   +?# ># argo# E "W H#W# ?$d# %d#E)3/@/@Xarg(Yc(NY EC3/@K0@Y!HBWY$GBdY BZapBq2Z>D da?EXF3RZEU3P0@x0@eZHTW$GTd TapVqW3P qE>0@1@ foh"intXI5Sf7l~E8~t] !(l 'l0y.aE/H%1`id2#I@3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %_F&#N'#$G(s# )#*#+# %  E-F$!!|M#' l -%E*:P/;)!0@0@Zn-FC0@0@Z|MB'Z/;D [ 4 w20@0@'[DFP0@1@S[?|MO'[dirQ![0@0@Q)e20@ 1@S>F>:1@1@[/;=!K=='=:F0 1@1@[/;/!\5K\ drg451@1@gh"intXf7Z~t]oMF!1@1@i\4 Ob4 OrF1@7@wgh"intXI5Lf7e~t] !(e 'eo 3 pid4Z# 55Z# 46z# 57#  58y PGHJE _FKE# NL3#@ GMz#D GNU#H U? AdxF31@1@\tGres3\5\F32@*2@\dev$GzF02@2@]S>ؒJ]ISj]Iz]pos3])G32@ 3@]>]0^I3uppos32^ 4F3@3@E^>I3q^supret3I % GC3@3@^Q_FBFl3@6@^;cmdk^#k3_pidmJ_FpzuhFq;GrulFz~_yGz_5JhI@_dFYdir_pFz`Fh J Y h wFX 6@6@*`W3[FYmsgZ:G16@7@V`_F0[F2msg3 ^GN7@7@`pidMtF'G7@&8@hh"intXI5Lf7e~E8wt] !(e 'ey.Z%1Cid2#I@3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#KJl#='K3# GLd V 4 G.7@&8@` /;-` K-la ='-3 G/dHub?5#JY;@;@gdYppbzdodKoeleno)e0Johei3Q 4I3;@F<@eppbzeoei3RI3e:JP<@<@f+ppbz@k"""&#)"&##'g'g'g'h#?pJ ?@h?@"h*UDŢI9Nhshm3nhretȇh+8Y3{J+Kp?@B@mh"intXf~t] !(O'J(#$G)d#P4(2 ##B$o# 4*q KNp?@?@h Mh 4  KVd?@?@h7 U i J?@9@@Mi yi C3RSKin3j Jo@@@[@@+j Wj C3wjJݿjKo`@@A@jHjC3 kB oBkJ&J(kk JoA@|A@k kJBolJBA@A@l AKl dKA@7B@vl' l C3l Bom[KB@7B@JRm Jh@B@B@pmn gm Bgom<m 6B@B@m7J+Ħ@J,3Ȧ@J-̦@v|K32B@zC@nh"intXf~t] !(OpK&zywK%dB@zC@*ns$VnK$vns1*n bit+o tbl,Lidx-3n  o o:}K32C@C@/oh"intXf~t] !(OK%3C@C@ns1#ns2#)on$d_oo}K32C@D@oh"intXf~t]K*3C@D@~os1)os2)oo ~K32D@ZD@oh"intXf~t] !(OK&D@ZD@ pstr%7plen'dbp(up o  ~K32`D@~D@%ph"intXf~t] !(OK$d`D@~D@pstr#ps%R oMK32D@RE@}ph"intXf~t]K2D@*E@ps1pK1kq1qK3qtok3rc439rsc43Lr K@ o   K`0E@RE@_r s_K_aЦ@K32`E@E@ph"intXf~t] !(OL)`E@E@rs&rc'3rn(d1sp+R    AL8E@E@7qh"intXf~t]yoL'3E@E@PsnM'kL8E@ F@qqh"intXI5Lf7e~t] !(e 'eyo.Z%1?id2#I@3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K (L&3E@ F@|s I@%s)%3f)sdir-t  V d8Y3ԁtL8F@IG@Hrh"intXI5Lf7e~E8wt] !(e 'e0~y.ZE/A%1Yid2#I@3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> ?L!UL"S#L## _  DIR&l%"_F&"#N'#$G(l# )#*#+# _2 E-LtF@2F@1tsdirssKs~ ^Li@F@cF@]tdirhs7L]~pF@F@tdir\s/LC'F@G@t'dirBstLLD-uhLJuFLP'Su w 2L53 G@:G@qu_dir4sL*s@G@IG@u_F) _?MPG@J@Vsh"intXI5Lf7e~t] !(eo 'ey.Z%1?id2#I@3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z5M[#M\#L^z#_F_#  aWM`dcMd#Lfz#_Fg#  aLh M3PG@H@u Mu3NvwM?uliM?vLH@Lv Lzv$GzvH@  V  a  L33H@J@wL12w M1wM2 x43@xKM5xL6xiMG? $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < %  I&I$ > $ > : ; I  : ;  : ; I8 : ; I8  : ;  I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;' II&< '  : ; !I/.? : ;' I : ;I: ;I.? : ; ' I  : ; I!: ; I"4: ; I# $.: ; ' @%.: ; ' @&: ; I': ; I(4: ; I )4: ; I*4: ; I+1X Y ,1- .41/1X Y 0.: ;' 14: ;I24: ;I3.: ; ' 44: ; I5 6.? : ;' I@7: ;I84: ;I94: ;I:4: ;I ;1UX Y<1= U>41?41 @1UX Y A1UX Y B1UX YC4: ; I? < D&IE4: ; I?  % $ > $ >  : ;  : ; I8  I&I&I .? : ; ' @ : ; I 4: ; I .? : ; ' @ I!I/ $ > 4: ; I 4: ; I? < 4: ; I?  % $ > $ >  : ; I$ >  I : ;  : ; I8 : ; I8 .? : ;' I  : ;I 4: ;I: ;I 41.? : ; ' I@: ; I4: ; I4: ; I: ; I .? : ; ' @.? : ;' I@: ;I: ;I 4: ;I: ;I : ;I.? : ;' @1X Y1 !4: ; I"1UX Y # U$41%.: ; ' I@&: ; I'4: ; I(1UX Y )1X Y *: ; I +.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I : ; I .? : ; ' @: ; I4: ; I4: ; I 4: ; I!.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.: ; ' I@: ; I.? : ; ' I@: ; I 4: ; I !4: ; I"4: ; I#1X Y $1%.? : ; ' @&4: ; I '.: ; ' I (: ; I): ; I*4: ; I+ : ;, U-4: ;I.1X Y/ 04111UX Y2 U3414.? : ;' I@5: ;I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I4: ;I.? : ; ' @: ; I1X Y 1 !41 "1X Y #41$: ; I%: ; I &.: ; ' ': ; I( ) *.? : ; ' @% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < '  : ; .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$.? : ; ' I@%: ; I &: ; I ': ; I(.? : ;' @): ;I*4: ;I+1X Y,1- .41/.? : ; ' 0: ;I112413.? : ;' I@4: ;I 5.? : ; ' @64: ; I71UX Y 8 U91X Y :1X Y ;41 <.? : ;' I@=1X Y% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I  41!.? : ; ' I@": ; I#4: ; I$.? : ; ' @%: ; I&: ; I '4: ; I(.: ; ' I@).? : ;' I@*: ;I +.: ;' I ,4: ;I-: ;I.: ;I /4: ;I0 : ;11UX Y213 U44151UX Y 61X Y 7 81X Y91X Y :1;: ;I<4: ;I =4: ;I>41 ?4: ; I% $ > $ > : ; I  I$ > &I  : ;  : ; I8 ' I I &I!I/ .? : ; ' I@: ; I.? : ; ' I@4: ; I4: ; I4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I 41 .? : ;' !.? : ;' I@": ;I#: ;I$.? : ; ' I@%: ; I&: ; I'4: ; I(4: ; I)4: ; I*1X Y +1,: ; I -4: ; I. : ;/1UX Y 0 U11X Y 2 34141UX Y5161X Y71X Y84: ;I9.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I .: ; ' I@ : ; I !4: ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' .? : ;' I : ;I: ;I4: ;I.? : ; ' I : ; I : ; I!4: ; I".: ; ' I@#: ; I$: ; I%4: ; I&4: ; I'4: ; I ( : ; )1X Y *1+ ,41-1UX Y . U/4101X Y 1.? : ;' I@2: ;I34: ;I4: ;I 5 : ;61UX Y71X Y8191X Y:.? : ;' I@% $ > $ > : ; I  I : ;  : ; I8 $ > &I ' I I &I!I/  : ; I8  : ; I 8 .? : ;' I : ;I4: ;I: ;I.: ; ' I@: ; I4: ; I.: ;' I@: ;I4: ;I4: ;I 4: ;I: ; I : ; .: ;' @!: ;I": ;I #: ;I $ : ; %1X Y&1' (41 )1X Y*41+41,4: ;I-1UX Y. U/4: ; I 04: ; I? < 14: ; I?  % $ > $ > $ > : ; I I&I.? : ; ' @ : ; I : ; I : ; I% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' : ;I.? : ;' I : ;I: ;I4: ;I 41 .: ;' I@!: ;I ": ;I #.: ; ' I@$: ; I%: ; I&4: ; I'4: ; I(.: ; ' I ): ; I*: ; I+4: ; I,4: ; I-.? : ;' I@.: ;I/: ;I04: ;I14: ;I 24: ;I34: ;I 4 : ;51X Y6171X Y8 9 U:1UX Y; U<41=.? : ;' I@% $ > $ > : ; I  : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ; I&I' II& : ; I8 < ' .? : ;' I : ;I.: ; ' I@: ; I: ; I4: ; I4: ; I U!4: ; I".? : ; ' @#: ; I $.: ; ' I %: ; I&4: ; I' (.? : ;' ): ;I*.? : ; ' I@+4: ; I , U-1UX Y .1/104114121X Y 3.? : ; ' I@% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 <  : ; ' : ;I.? : ;' I : ;I: ;I4: ;I.? : ; ' I@ : ; I!: ; I"4: ; I #4: ; I$4: ; I%.? : ;' I@&: ;I'4: ;I (.: ;' I@)4: ;I*: ;I +4: ;I,4: ;I- : ;.1UX Y/10 U1412 3: ;I4 : ;51X Y6 74181X Y9.? : ; ' @:4: ; I;1X Y <41 =1X Y >: ; I ?4: ; I@1UX Y % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ; ' I@: ; I: ; I .? : ; ' I@4: ; I% $ > $ > : ; I$ > .? : ; ' I@: ; I : ; I : ; I 4: ; I? < % $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' : ;I.? : ;' I .? : ;' @: ;I: ;I : ;I .? : ; ' I@!: ; I": ; I#: ; I $4: ; I%1X Y &1'.: ; ' I@(4: ; I)1X Y *4: ;I+ : ; ,1UX Y - U.41/ U04: ; I 1 2.: ; ' I 3: ; I4: ; I54: ; I6 7: ; I 84: ; I91:41% $ > $ > : ; I  I : ;  : ; I8 I !I/ $ >  : ; : ;I8  : ; : ;I : ; : ;&I' II& : ; I8 < ' .? : ;' I : ;I: ;I.? : ;' .? : ; ' @: ; I: ; I : ; I!4: ; I"1X Y #1$ U%1X Y &: ; I '.? : ; ' @% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I & &I I !I/ $ > 4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I &I .? : ; ' I@.: ; ' I : ; I.: ; ' @4: ; I4: ; I4: ; I4: ; I1UX Y 1.? : ;' I@: ;I4: ;I4: ;I.? : ; ' I@: ; I.? : ;' @: ;I : ; I 4: ; I ! : ; " #I$!I/ %$ > &4: ; I? < '4: ; I?  % $ > : ; I I&I$ > .? : ; ' I@: ; I 4: ; I 4: ; I I !I/ $ > 4: ; I 4: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I &I '  I.? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I.: ; ' @: ; I4: ; I4: ; I? < 4: ; I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I I !I/ $ >  : ; : ;I8 .: ; ' : ; I4: ; I4: ; I.: ; ' I : ; I4: ; I &I.? : ; ' @: ; I4: ; I1UX Y 1 U411UX Y1 41!1X Y" #4: ;I$.? : ;' @%: ;I &4: ; I? < % $ > $ >  I$ > : ; I : ;  : ; I8 &I .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I.: ; ' I : ; I: ; I1X Y 11X Y 4: ; I I!I/ 4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' @ : ; I : ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' @ : ; I : ; I% $ > $ >   I: ; I$ >  : ;  : ; I8 I !I/ .? : ; ' I@ : ; I4: ; I.: ; ' : ; I.? : ; ' @: ; I 4: ; I 1X Y 1 414: ; I &II% $ > $ >  I$ > .? : ; ' I@: ; I4: ; I 4: ; I &I : ; I I !I/ 4: ; I % $ > $ >  I$ > : ; I&I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I.: ; ' I : ; I.? : ;' I@: ;I: ;I4: ;I4: ;I4: ;I1X Y11UX Y: ;I : ;I 4: ; I I!I/ 4: ; I % $ > $ >  I$ >  : ;  : ; I8  : ; I8 &I .? : ; ' I@ : ; I 4: ; I 4: ; I: ; I4: ; I4: ; I I!I/ 4: ; I % $ > $ > : ; I I$ >  : ;  : ; I8 I !I/ .: ; ' @ : ; I 4: ; I &I.? : ; ' @: ; I % $ > $ > : ; I$ >  : ;  : ; I8 I !I/ .? : ; ' @ : ; I 4: ; I  I&I% .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I $ >  : ; (  : ;  : ; I8  I  : ;  : ; I8 .? : ; ' I : ; I4 &I.? : ; ' I@: ; I.1@1.? : ;' I@: ;I4: ;I: ; I 4: ; I: ; I 4: ; I U4: ; I U 4: ; I !4: ; I "I#!I$: ; I%&&&I'.? : ; ' @(1X Y )1*1X Y +!I/ ,4: ;I -4: ; I?  .4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I .? : ; ' I@ : ; I 4: ; I4: ; I 4: ; I? < 4: ; I?  % $ > $ > : ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I@ : ; I 4: ; I 4: ; II!I/ .? : ; ' @: ; I : ; I .? : ; ' I@% $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3| ../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../lib/etdumpe2fs.cbitops.hext2fs.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hext2_types.hext2_fs.hcom_err.hext2_io.hjfs_compat.hkernel-jbd.hgetopt.hext2_err.ht@3gZ gIsJg;"0o; Xhz%z4~f==<|<gh2=ɽ,(t<1vhh. uL=gu=!u=uY-== " v/Gv.WZ"tțP&tgtyܭ}v~%&50~~-6>q e( !O! ext2_err.c,@! sX1zug/xXogv ../../lib/ext2fs../../lib/etbadblocks.cext2fs.hext2_types.hcom_err.hext2fsP.h@  XjJy?OLz.K =M> tYxti=Wy>w /u<>]:[?(Axtg=uvuf XtxXx?~&\>4KU`>p^fgwttt Ww > wguf  vD/vwz>wgxq.hxg. vXvk(^t w.w?"kJ>z>y>z>! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etclosefs.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hext2fsP.h@MZ4zX^[=]E7X vf 5> huuuYuap#u=hwuuiJ~hnY  hiZ0u+Xu gl~ "w7It-q#_KK tguv tguv tguv tguvuuuvu fYuwtguwtw fwA ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etgen_bitmap.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h#@9=E.C>=>0u=ghgXvuwuQvuYxJf=uug= 3$g=uftg=\=u~Jh <0v.urLJg0|<?wftuw f.w.uutvw<JwXfYc{J!uظ- X˭%L,1!Ԡ !qlo&@1=$&mJhilm"Dt[uguguh+`M$yXmfg0~< "gOky1st=oXmfp=Yz>Yxo=n5uKhaYK>K>lޱ+u <% tugG<w?Jw#><wJx0hu=gU</ufȑw7)<xgxtb>xXyXihhiv>r< gtXtYQivhr< gtXdxtxtxJ+gImfguzfgu  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/et../../lib/ext2fsunix_io.cext2fs.hstddef.htypes.htypes.hstat.hcom_err.hext2_io.herrno.hQ@k=*ux.`.>rkvtu0q Xx Ȝ Mpu <JiKLiZttj=*2S X|<gggzg'b \svf gw<!Y=mfsgK{Xu%R!inFJQ4U=v<fzz"u/M$VLr"gKX=!w/g}vtXoKt=t$p t|uuvKfYuyyf f^tuuvJs?y. v X=tZ=uNpxt .pa=pl|"tguztguz~ zfzz<J=z<=uuuvg#g@6t XXzv[KtkzX@YV9 ../../lib/etbitops.ccom_err.hT]@K,L! /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etblock.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h]@-|XOY<֠C<Cu6<u\h t==tK0u>et. =w= fh!OY>C>Au8<"u\h t=K0u>ct.J?= ffJ~zx tggggw!yg Ȣȉ#~zz~g><ί` /uuu>gZp gvhX)/~XUJY qȏggZK~JC>u֭ux.<~"~u tKgp'<ZxMgsK"u>zigh ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etcsum.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.hj@Zdf!0Qzzhfj\.L} JO>liXJftww._!XyJ5 /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etextent.cext2fs.hstddef.htypes.hext2_types.hext2_fs.hext3_extents.hcom_err.hext2_io.hext2fsP.he2image.hpm@kv) <iʑu2gguqy]u "uxtw=XYhifYg f[t%t]t|t  ~g ~v'J0gvAg=t @uv~,w//uM=tx=t׫?zuv=wLׯMȣaX 0h t~u!#"!  gutg tl)x!uv).~<8!=&@u!6Xp<g~+twAg它w guwȟuYuwuw֢\xȻxf=hwjYgigw#=-MfYvxfuu^uhxtu 9  /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/ext2fs../../lib/etind_block.cstddef.htypes.hext2_types.hext2_fs.hext2fs.hcom_err.hext2_io.h @/ ;KW<<vf   ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includellseek.cext2_io.herrno.h@vAyXo ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc.cbitops.hext2fs.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h܈@g*uVXZlK= <yf<~x!t zn~"cit .}7}kfKg>~x!=sJ Zj|h x Xtxh f!wpzxXZȕcKNUI}~v!=X~vvl\d ../../lib/ext2fs/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/include/sys../../lib/etalloc_stats.cext2fs.hbitops.hstddef.htypes.hext2_types.hext2_fs.hcom_err.hext2_io.h@g*uX u}uNY>x fvJw}tg/? v J~Y fvJhJ ../../lib/ext2fscrc16.cext2_types.hcrc16.hX@;myX J /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeerror_message.cstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.herror_table.herrno.h@D[BXxdtu!gtWt/gOu2]ftgYK{6p.J%ktMpt"mtUwguhYpXltXzt'.X=~th0 f "=`-wK!t Jy K- et_name.ccom_err.h@ tKY]> /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includecom_err.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hcom_err.h(@1=g.gZKk90=YG.uKhNK1=sxXu~~< $ q~)u>KLL/LL=3z<AMtv""zfcv"uM/rgq%=%ccyt)\KMJAWwtC' ../../lib/ext2fsuuid.cext2_types.h @fkx+1Xk=uuuAwdZG ostype.c @,]dux 8A ../../lib/ext2fsfeature.cext2_types.h@u dtMYgt 億p ֱu dtMYgt 億p ֗uuPJ/m+.Lurt6 +RK J_#R_37]f.;X.u tuuRt;g=~.oXoX JfoXoX JS  hashstr.cЬ@/.utR[xt^Ȣsn /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunparse.cstdint.huuidP.h@3B gzJgzgm /home/tyndur/lbuilds/work/e2fsprogs-1.41.3/env/includeunpack.cstdint.huuidP.h\@&=uuu ctype.cЮ@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDZ: ../../includestrncpy.cstddef.h@)Xg[ye_K ../../includestrcasecmp.cstddef.hbsdtypes.h@@3=L=]d$Z3zi=e"[91eu;K8 ../../includebcopy.cstddef.h@@==? kMY-=]X%k;=-1MK.7Y-=H:'V 9 strcat.c@"?; index.c @*z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h@@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h @t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.h@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf  ../../../include/arch/i386../../../include../../include/sys../../include/netinet../../includenet.cstdint.hstddef.htypes.hsocket.hin.hnetdb.hio_struct.hstdio.herrno.h@(<>ʯʯA7yy5ZV>1b v< .SA7k~Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c@=gP ../../../include/arch/i386add_intr_handler.cstdint.h @ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h@@3g==hwfA\jg;"xg;KW ../../../includeasprintf.cstddef.hstdarg.hjprintf.h0@,K #ugKs/ %JY^JDI <9uv[1 fA\u ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h @??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.hP@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io\T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h-@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.h.@%u>:J>?8us@qwLNwfA\ ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h@/@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h/@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h0@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h1@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h1@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'\ ../../include/arch/i386../includenetwork.cstdint.hnetwork.h08@-==t{o>i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h:@?Dx ?Dx =3 puts.cp:@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h:@ ic?9 fi='=% wait_for_rpc.c`;@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h;@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.hp?@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.hB@$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncmp.cstddef.hC@$>9LV2z = strcmp.cC@)J;iu-/S9 ../../includestrdup.cstddef.hD@%$T9 ../../includestrlen.cstddef.h`D@##+.?>\ strtok.cD@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h`E@(JgKwp@6 unlink.cE@&? ../../../include/arch/i386../../../include../../includeaccess.cstdint.hstddef.htypes.hio_struct.hstdio.hdirent.herrno.hE@%t? JvN73x<  ../../../include/arch/i386../../../include../../include/sys../../includeposix_dir.cstdint.hstddef.htypes.htypes.hio_struct.hdirent.hio.hF@gsgrgcg;?+g,02zt4Zd/Yvcgust>T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.hPG@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hJ@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.hL@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@(AB T.4@6AB U.4@7AB V. 4 @AB FN.(4@AB F.K.Y.4@cAB B^.4@D  F AB D\..p.. f.. c..Y..`.Q.[.i.b.s._.u. w.'. S.I.O.O.`.R.^.V.p..P.=.z.t. _.| ,@cAB Dl.@AB H.| @zAB B$@AB F.<@ AB A.H@TAB BZ.@ AB A.@NAB A@ AB A.@ AB @[AB El@ AB A.x@!AB Y.@ AB A.@VAB DP.@ AB A.  @ AB F.@ AB A. $@AB FJ.@7AB BS.<@ AB A.H@AB H.X@AB H.| h@AB T. @AB T. @AB T. @AB T. @AB S.@AB S.(@AB Q.D@AB Q.`@ AB A.l@ AB A.x@ AB V. @ AB V. @VAB DB. @FAB y. X@ AB A.d@ AB A.p@ AB A.|@ AB A.| @@AB E@QAB  @AB F@.@&AB $@AB F.C. @^AB Df.| `p @vAB Df.` @WAB Db.`@!@ AB A.`L!@AB Ep.| #@ AB <#@ AB H#@ AB T#@9AB #@MAB F #@rAB Fd. T$@nAB F`. $@WAB DA.%@WAB DA.t%@3AB D_. %@(AB Fe.&@lAB EE.<(@'AB ]. d(@%AB [. (@HAB b. Y.(@AAB Z. )@uAB Fm.)@BAB Z.)@BAB Z.*@zAB De. *@AB Fv.|  <+@>AB A |+@"AB  +@+AB  +@AB F P,@ AB ( p,@AB Fs.i.X. /@AB Q.( 4/@AB FQ..g.$ H0@AB I|.~. (4@vAB Fa. 5@AB Q.( 5@AB F$.H. 8@AB Q. 8@AB Ea. 9@AB Ie. :@^AB D_. :@mAB Fb.|  <@IAB Cn.$ <=@AB Fr.^.$ =@AB Fr.^. t>@ AB FJ.| t ?@2AB t ?@,AB t ?@/AB  t @@AB FR. t @@AB FW.t dF@!AB W. |  4F@AB H. a.4`G@JAB n.|  G@AB FG.`J@LAB J@AB J@AB  J@AB FU.P@/AB P@AB Q@AB | tQ@<AB tTQ@AB F(tQ@ AB Fn.w. D. tS@yAB FI.t|S@/AB  tS@eAB FR.,tT@@AB F{.s.\.U.^.tTU@AB S. (ttU@AB Fe.S. q.0tV@AB Fc.t.h.._.tX@AB S. tX@AB Fy. t8Y@AB BH.tY@dAB Et. t$Z@eAB Fn.tZ@qAB F(t[@AB FX.N.O.,t[@~AB FP..o.G.I.| T]@?AB [. W.| P]@AB AS.0P]@OAB F. S.m. B.. (P`@XAB F. V.. HPXb@MAB Ir.$. @.z. 6.. g.. g.. Pj@2AB h. |  Lj@AB Fn.Lk@.AB D Lk@oAB F.L,m@AAB D| pm@?AB m@AB Fxn@lAB Ba.n@AB B,o@AB F#.Z.. t@TAB E. u@uAB FU.hw@AB R.(w@MAB FI..m.8x@BAB In._...x.*.c.$~@%AB Bb..4@@AB I.u.~.,.k.. @AB F_.(ԅ@KAB F}..l.|  @+AB `.L@GAB `.| d@GAB y.| ܈@1AB  @AB Fw.$܉@;AB FD. Y.$@AB Fd.t. @AB FT.(@AB F.o.M.| @1AB  @AB Fe.@AB N. ď@AB Fe.| X@4AB B| H@AB H@AB (H@AB DY.\.j.W.X. H@AB BV. Hp@AB DB.N.u.H@AB J. H@AB F.| @@9AB A| p(@ AB G.p4@$AB pX@AB (pl@AB F].].O.p @8AB ].| 8X@N AB F@.. R.]. R.h. R.@AB L.| Ģ@AB Ec. h@rAB FP.ܤ@iAB DJ.| H@lAB c.| ,@XAB BV.| ` @!AB `0@AB D.@ `@;AB DD.^.|  @LAB Bd.l@QAB B_.| $@AB Ec.$@AB Ec. $@AB F~.$@AB R. $@AB De.$@@AB De.| Ь@AB Ec.`@WAB D|.|  L@_AB EI..@L@AB L,@AB LD@AB | \@nAB A| Ю@AD @AD @/AB  @AB @@AB `@AB @.AG @/AB @AB @AB  @4AB `@AD @AB @AB | `@AB `а@AB FI`@AE E` @?AB F``@VAB F`@3AB D| ( @AB F| \ @QAB B|  @@~AB F @tAB F|  @@AB F| !@<AB AD| L! @.AB | x!P@-AB A| !@AB F| ! @AB F| "@9AB "0@AG F"@hAB B"0@AB "@@ AB "P@AB F"p@ AB "@ AB "@oAB F" @#AB "P@!AB |  L#@vAB FIFL#@AB  L# @AB AFFL#@>AB | #@@dAB F#@oAB F# @AB E| L$ @:AB DL$`@1AB L$@1AB L$@0AB L$@AB L$0@IAB FL$@AB AL$@AB ONL$0@YAB XL$@YAB X L$@AB IFF| %@ AB %@AB | %@&AB %@'AB % @AB F%@gAB AG%@AB %0@AB MF%@_AB L% @GAB FF%p@AB L%@AB %0@AB F%@@AB F| T'@&AB T'@@ AB T'P@&AB T'@ AB T'@AD T'@ZAB FT'@qAB FT'@9AB T'@AB T'@AB F T'@AB IFFT'@?AB DT'@vAB | (P@IAB D(@IAB D(@IAB D(@@AB E(@@_AB D(@%AB (@%AB (@aAB  (p@AB MFF(P@WAB D(@qAB D(0@AB (P@"AB (@IAG | X*@AG X*@AG X*@yAB CX*@ AB CX*@AB FX*`@KAB X*@RAB AFX*@AB OX*@AB OX*p@tAB LFX*@IAB X*@@AB LX*@ AB X*@AB EX*@"AB | ,@;AB D| L,@AD L,@AD L, @AD L,0@AD | ,@@AB C,@@#AB ,p@AB E,@AB F,@&AB | d-@0AB | -@@AD -`@DAB E| -@ AB | .@7AB C.@AB F.@AB F.@AB F| .@ AB .@AB .@!AB D.@ AB .@ AB | ,/@AB | X/ @AB | /@@;AB /@!AB /@JAB IF/@"AB | 00@iAB FF0@AB FI0`@!AB | l0@$AB l0@AB l0@ AB l0@NAB Dl0@@AB BFl0@NAB Dl0 @\AB Dl0@kAB Dl0@jAB H| x1`@AD x1p@AB x1@AB x1@ AB x1@AB Dx1@+AB x1@-AB x1@.AB x10@AB FKx10@xAB Dx1@aAB Dx1 @AB FFx1@AB Dx1@@zAB Dx1@#AB  x1@fAB IFFx1`@RAB FFx1@EAB Dx1@UAB FFx1p@UAB Fx1 @RAB Dx10 @AB IIx1 @6AB Cx1@ @AB x1` @AB Ix10@AB F| l4 @bAB El4@AB l4@GAB l4@HAB B|  4P@dAB FLG4@AB F4@'AB 4@AB F4P@EAB A4@0AB F4@uAB C| 5P'@AB F5(@'AB 5 )@AB 5@)@AB 5`)@ AG 5p)@ AG 5)@AD 5)@AB AG5@-@AB E| 6-@6AB 6 .@AB 6@.@@AB FF6.@AB | \7.@ AB D\7.@OAB G\7/@!AB | 7@/@?AB |  7/@dAB FGG7/@[AB H7P0@(AB | \80@AB \80@0AB \80@ AB \80@0AB \81@ AB \8 1@`AB FF| 91@AB | 491@QAB A492@*AB 4902@mAB F492@mAB BC493@rAB FI493@7AB D493@DAB F49 6@AB D496@AB PF497@+AB | l:7@fAB D| :08@rAB E:8@AB D:@9@uAB D:9@IAB |  ;:@AB  ;0:@AB  ;P:@AB | |;p:@AB | ;:@AAB LF;:@AB ;;@AB ; ;@AB ;@;@AB | <<`;@ AB <<p;@ AB | <;@lAB C<;@VAB C<P<@jAB F<<@`AB F< ?@HAB L| 4=p?@AG 4=?@!AB 4=?@yAB HF4=@@@AB  4=`@@AB FFF4=A@lAB FF4=A@)AB D4=A@AB MF4=@B@OAB D4=B@!AB | d>B@AD F| >C@KAB DD| >C@>AB A| >D@JAB FI| 0?`D@AD | \?D@AB BD\?0E@"AB | ?`E@9AB A| ?E@ AB | @E@]AB D| 4@F@"AB 4@@F@#AB 4@pF@AB 4@F@AB IH4@ G@AB 4@@G@ AB | @PG@dAB F@H@+AB JI| 4AJ@'AB E| hAL@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEstdouts_mmp_intervalh_i_fsizes_journal_inumi_gidold_desc_blocksi_mtimeprint_bg_opts_journal_devs_startbaseext2fs_struct_generic_bitmapi_file_aclhurd1hurd2__s32bytes_writteni_sizes_jnl_blockslinux1linux2struct_ext2_filsysbg_inode_bitmaps_mmp_blocks_free_blocks_countext2_ino_text2_group_descs_mnt_counts_algorithm_usage_bitmapl_i_reserved2i_links_countjournal_superblock_ss_dynsuperstruct_io_channell_i_gid_highext2_image_hdrino_itrs_lastcheckprogram_namebg_flagsi_dir_acls_sequenceext2fs_group_first_blockh_i_fragimage_ioblk_tbadopts_checkintervalparse_extended_optss_maxlens_prealloc_dir_blockss_feature_incompatbg_checksumh_i_gid_highGNU C 4.2.2s_errnos_reserved_padrefcountext2fs_block_bitmaps_free_inodes_countl_i_blocks_hiread_errorext2_dblists_min_extra_isizepriv_datanum_fieldss_rev_levels_headers_blocks_count_his_prealloc_blocksunix_io_manager/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/misc__u16i_faddrh_i_mode_highh_sequences_first_data_blocks_usersblk64_terrcode_tbg_inode_tablelist_bad_blocksi_generationget_alloc_blockfragsizeh_i_uid_highs_raid_strides_def_resuids_frags_per_groupblk_itrs_wtimes_first_inos_creator_osblock_nbytesbytes_readprint_ranges_log_groups_per_flex__u32block_maps_blocks_counttime_timage_dumpheader_onlyl_i_file_acl_highretvalprint_bg_optsjournal_header_sjournal_header_timage_headerwrite_errorprint_badblocksi_modeuse_blocksizeoptindbg_itable_unused__s16bb_lists_paddingbg_free_blocks_counti_dtimes_nr_userss_max_transactioni_uidprint_numberext2fs_inode_bitmapprint_inline_journal_information__dummy_hstruct_io_managerh_blocktypei_atimeoldbits_feature_ro_compatext2_super_blocks_hash_seeds_free_blocks_hiext2fs_test_bits_log_frag_sizeoptargs_inodes_counttokenforcedo_usageprint_journal_informationi_blocksumask__u64bb_iteri_flagsext2_badblocks_lists_jnl_backup_types_first_meta_bgdiffbg_free_inodes_counts_firsts_max_trans_datas_last_orphandgrp_text2_inode_cacheext2_inodestruct_io_statss_inodes_per_grouplist_descreserved_gdtuse_superblocks_mkfs_timeapp_datas_minor_rev_levels_default_mount_optss_inode_sizes_last_mountedgroup_desc_count__u8h_i_authorl_i_uid_highs_max_mnt_counts_r_blocks_count_his_blocks_per_groups_want_extra_isizen_msgshex_formats_reserved_char_padext2_struct_u32_listosd1s_volume_names_def_resgidinode_maps_desc_sizes_def_hash_versionl_i_versionbg_used_dirs_countinode_blocks_per_groupext2fs_group_last_blockjournal_superblock_tdumpe2fs.cstderri_ctimes_reserved_gdt_blockss_block_group_nrosd2s_journal_uuidbg_block_bitmapprint_freeinode_nbytesmainbg_reserveds_r_blocks_counts_mtimenextext2_struct_u32_iterateet_ext2_error_tables_log_block_sizeorig_supers_raid_stripe_widthext2_struct_dblists_feature_compath_i_translators_magic/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/ext2fs_et_listinitialize_ext2_error_tableinitialize_ext2_error_table_rext2_err.cext2fs_free_memext2_badblocks_iterateext2fs_u32_list_delext2fs_badblocks_list_iterate_beginext2_u32_iteratebadblocks_flagsext2fs_get_memext2fs_badblocks_list_delext2fs_badblocks_list_addremlocext2fs_u32_list_findext2fs_badblocks_list_createext2fs_u32_list_equalext2fs_badblocks_list_iterate_endext2fs_badblocks_copyext2fs_u32_list_iterateext2fs_u32_copymake_u32_listbadblocks.cext2fs_badblocks_list_iterateext2fs_u32_list_countext2fs_resize_memext2fs_badblocks_equalold_sizeext2fs_u32_list_addext2fs_u32_list_testext2fs_get_arrayext2_u32_listext2fs_u32_list_iterate_beginext2fs_badblocks_list_testext2fs_u32_list_createext2fs_u32_list_iterate_endext2fs_resize_block_bitmapnew_real_endext2fs_allocate_inode_bitmapext2fs_set_block_bitmap_rangeext2fs_free_inode_bitmapext2fs_set_inode_bitmap_rangeext2fs_set_bitmap_paddingext2fs_resize_inode_bitmapext2fs_generic_bitmapext2fs_copy_bitmapext2fs_clear_inode_bitmapext2fs_get_inode_bitmap_rangeext2fs_compare_block_bitmapdescrext2fs_fudge_block_bitmap_endnew_endext2fs_allocate_block_bitmapext2fs_compare_inode_bitmapext2fs_clear_block_bitmapext2fs_free_block_bitmapext2fs_fudge_inode_bitmap_endoendext2fs_get_block_bitmap_rangegroup_shadowret_old_desc_blkgroup_blockret_super_blkext2fs_flushwrite_backup_superbuffer_blkblockcntwrite_idxwrite_primary_superblockcheck_idxret_new_desc_blkret_meta_bgtest_rootsuper_shadowsgrpclosefs.cgroup_ptrcache_sizeext2_inode_cache_entext2fs_super_and_bgd_locwrite_primary_superblock_onlynew_supermeta_bg_sizeext2_db_entryext2fs_closeext2fs_bg_has_supersortedcache_lastext2fs_update_dynamic_revnumblocksold_superext2fs_badblocks_list_freeext2fs_u32_list_freeext2fs_freefreefs.cext2fs_free_inode_cacheext2fs_free_dblistgen_bitmap.cext2fs_compare_generic_bitmapext2fs_fudge_generic_bitmap_endext2fs_fast_test_block_bitmapext2fs_fast_clear_bitdescriptionext2fs_free_generic_bitmapext2fs_allocate_generic_bitmapext2fs_mark_block_bitmap_rangeext2fs_set_bitext2fs_get_generic_bitmap_startext2fs_mark_generic_bitmapext2fs_get_generic_bitmap_endcheck_magicext2fs_unmark_block_bitmap_rangeext2fs_fast_set_bitext2fs_warn_bitmap2ext2fs_resize_generic_bitmapext2fs_set_generic_bitmap_rangeinit_mapADDRext2fs_set_generic_bitmap_paddingext2fs_test_generic_bitmapbitnonew_sizeext2fs_test_block_bitmap_rangeext2fs_clear_bitext2fs_make_generic_bitmapext2fs_clear_generic_bitmapbase_error_codeext2fs_copy_generic_bitmapext2fs_unmark_generic_bitmapext2fs_get_generic_bitmap_rangeext2_inode_scanoffset_superi_crtime_extrai_ctime_extraext2fs_inode_scan_flagsimage_inodefs_uuidext2fs_write_inodeext2fs_get_next_inode_fulloffset_inodetemp_bufferimage_reservedcheck_for_inode_bad_blocksfs_device_nameext2fs_read_inode_fullinode_bufferdone_groupcurrent_inodeget_next_blocksforce_new_groupext2fs_open_inode_scanfs_netaddrext2fs_set_inode_callbacksave_get_blocksext2fs_write_inode_fullret_scanmagic_numberext2fs_write_new_inodeextra_bytescurrent_groupext2fs_get_next_inodei_extra_isizei_atime_extraext2_inode_largeext2fs_read_inodeimage_devicebytes_leftbufsizegroups_leftcurrent_blockfs_blocksizeold_flagsinodes_per_blockfs_reservedext2_struct_inode_scanoffset_blockmapi_crtimelarge_inodeblocks_leftext2fs_check_directorynum_blocksfs_deviceget_next_blockgroupi_pad1fs_netaddr_typeext2fs_inode_scan_goto_blockgroupblock_nrclear_flagsdone_group_datamagic_descriptorfs_hostnameext2fs_get_blocksinode.ctemp_inodei_mtime_extrainodes_leftinode_buffer_blocksbad_block_ptrext2fs_close_inode_scanoffset_inodemapimage_timecreate_icacheset_flagsi_version_hiext2fs_flush_icacheoffset_reservedio_channel_read_blk64io_channel_set_optionsio_channel_write_byteio_channel_write_blk64io_manager.cio_flagsgroups_per_blockold_ioext2fs_open2ext2fs_get_data_ioret_blkopenfs.cret_fsio_optionsext2fs_openext2fs_rewrite_to_ioext2fs_descriptor_block_locext2fs_set_data_ioext2fs_mark_super_dirtyext2fs_div_ceilnew_ioref_offsete2_blkcnt_tread_bb.cref_blockmark_bad_blockread_bb_recordext2fs_read_bb_inode__s64skip_this_inode_bitmapext2fs_read_block_bitmapext2fs_read_inode_bitmapsuccess_cleanupext2fs_test_bb_dirtyext2fs_write_inode_bitmapino_cntskip_block_bitmapext2fs_write_bitmapsblock_bufcsum_flagrw_bitmaps.cnbitsblk_cntdo_inodeext2fs_test_ib_dirtyinode_bufext2fs_write_block_bitmapdo_imageskip_this_block_bitmapdo_blockext2fs_read_bitmapsfind_cached_blockaccess_timeerror_outunix_private_datast_blksizeflush_cached_blocksunix_set_optionst_blocksunix_write_blkfree_cachest_mtimewritethroughstatraw_read_blkalloc_cacheinvalidateunix_io.cst_gidst_modest_nlinkeldestretval2reusest_atimessize_tunix_read_blk64dev_tunused_cacheext2_loff_tactualunix_closein_useraw_write_blkgid_tuid_tunix_read_blkunix_get_statslocationunix_write_byteoldest_cacheunix_cachest_ctimereuse_cacheunix_opennlink_tunix_write_blk64unix_set_blksizeblksize_tst_uidunix_flushst_devmode_tstruct_unix_managerst_rdevbitops.cerrcodeext2fs_warn_bitmapdind_blockbcountlimittind_bufblock_contextxlate_funcnew_blkblock_iterate_indblock_iterate_tindxlatedind_bufext2_extent_handle_text2fs_block_iterate2blocknrext2fs_extentblock_iterate_dindtind_blockchangede_lblkext2_extent_handleextent_erroutbsizeabort_exitreal_privateext2fs_block_iterateinodes_per_grpext2fs_set_gdt_csumold_unusedcsum.cend_inofind_last_inode_ingrpext2fs_fast_test_inode_bitmapstart_inoold_csumgrp_noext2fs_group_desc_csumext2fs_group_desc_csum_setext2fs_group_desc_csum_verifyext2fs_extent_insertextent_pathext2fs_extent_header_verifymax_lblkextent_node_splitei_leafnew_uniniteh_entriesext2fs_extent_deleteext2fs_extent_freeupdate_patheh_deptheh_generationext3_extentorig_heightnewextentnewpathmax_uninit_lenorig_opext2fs_extent_replaceorig_lengthext2fs_extent_get_infoend_blkei_unusedeh_magicorig_lblknew_node_pblkmappedmax_entriesee_start_hiext2fs_extent_gotomax_depthmax_lenext2fs_extent_openleaf_levelext2_extent_infoext3_extent_headernew_node_lengthdonelog_flexnew_node_startcurr_entrygo_downext2fs_group_of_inotocopycurrextent.cext2fs_extent_getee_blockgoal_blkmax_pblkentry_sizeagainext2fs_extent_fix_parentsret_handleext3_extent_idxee_lennew_rootext2fs_extent_set_bmaplogicalei_leaf_hieh_maxbytes_availnewehee_startvisit_numcurr_levelnum_entriesei_blockextent_uninitretryext2fs_write_ind_blockind_block.cext2fs_read_ind_blockoriginllseek.cext2fs_llseekext2fs_new_blockext2fs_get_free_blocksext2fs_fast_unmark_inode_bitmapext2fs_test_inode_bitmapext2fs_alloc_blockstart_inodeext2fs_fast_test_block_bitmap_rangeext2fs_set_alloc_block_callbackgoalext2fs_fast_unmark_block_bitmapdir_groupcheck_block_uninitext2fs_new_inodefailcheck_inode_uninitext2fs_fast_mark_block_bitmapext2fs_inode_alloc_stats2ext2fs_group_of_blkext2fs_mark_bb_dirtyisdirext2fs_block_alloc_statsext2fs_mark_inode_bitmapext2fs_mark_ib_dirtyfirst_unused_inodeext2fs_inode_alloc_statsext2fs_unmark_block_bitmapext2fs_mark_block_bitmapalloc_stats.cext2fs_set_block_alloc_stats_callbackext2fs_unmark_inode_bitmapext2fs_crc16crc16_tcrc16.ccrc16_table_et_dynamic_listtable_numadd_error_tableremove_error_tablesafe_getenv/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/etdebug_maskdebug_fet_list_lockstartedet_list_unlockdstrerror_message.cadd_to_error_tableinit_debugerror_messageoopsnew_tablechar_setet_name.cerror_table_namecom_errnew_procreset_com_err_hookcom_err.cpvardefault_com_err_procerrfwhoamicom_err_va__builtin_va_listls.clist_superprint_featuresprintedsecslist_super2flags_found/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/e2pprint_mntoptsprint_super_flagsinterval_stringprint_userprint_groupmntopts.ce2p_mntopt2stringskip_over_wordskip_over_blankseptrfnume2p_edit_mntoptse2p_string2mntoptmntopt_listprint_fs_errorsprint_fs_statee2p_uuid2strtime_midtime_lowclock_seqe2p_is_null_uuidtime_hi_and_versione2p_uuid_to_struuid.ce2p_unpack_uuide2p_os2stringos_typeostype.ce2p_string2osos_tabe2p_edit_feature2clear_ok_arraymask_errfeature.ccompat_typejrnl_feature_liste2p_feature2stringe2p_jrnl_string2featuree2p_edit_featurecompat_arraytype_erre2p_jrnl_feature2stringfchare2p_string2featurehashstr.ce2p_hash2stringe2p_string2hashhash_listfmt_upper/home/tyndur/lbuilds/work/e2fsprogs-1.41.3/src/e2fsprogs-1.41.3/lib/uuiduuid_unparse_loweruuid_unparse_xuuid_unparseuint16_tuuid_unparse_upperfmt_lowerunparse.cunpack.cuuid_unpackisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetmallocliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountcallocl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_locknobjla_lockprevpagesl_pageCountmajSizeendptroverflowstrtol.cstrtolstrncpy.cstrncpy/home/tyndur/tyndur/src/lib/stringstrcasecmpstrncasecmpu_charstrcasecmp.cmemmovememmove.cdst0src0strcat.cstrcatsaveappendstrchrstrchr.cfromstrcpystrcpy.cmemcpy.cmemset.cu_intpositivedecimalitoastrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunction_Boolinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexntohlnet.cntohsp_aliasesgetprotobynameip_strs_protoh_addrtypehtonlNO_RECOVERYinet_ntopfamilyhostenthtonss_nameservicesprotocolnetshortproto_aliases_tcpNO_DATAserventTRY_AGAINhostshortinet_ntoahostlongservice_aliases_imaph_aliasesip_stringp_protosocklen_ts_addrnetlongservice_aliases_ircgethostbynamep_nameinet_ptonin_addr_tprotocolsh_nameh_errnoip_qherrorin_addrAF_INETinet_atonHOST_NOT_FOUND/home/tyndur/tyndur/src/modules/lib/posixprotoentservice_aliases_https_aliaseshstrerrorh_addr_lists_portgetservbynameSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarmsignal.csigprocmasksigset_tSIG_BLOCKinitializedoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementfdopenpreadfd_list_elementF_GETFDnewfdfile_flagsold_posio_resposix_files.cF_GETFLflags_sizefd_to_filecreatfd_listnext_fdoptresetostrnargcopterrgetoptgetopt.cnargvoptoptuser.cgeteuidgetuidgetegidgetgidrunningwaitwait.cstatuswait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpidstrerror.csend_messagemetadatayieldsleep.cresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listpositionio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcasprintf.casprintf_putcasnprintf_handlervasprintfasprintf_argsbuflenputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorbuf_sizeremaindertempulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexaFebtime.caFrigmtime_rdatestrctime_stringnstrtm_wdayBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDectm_houraThutm_monDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTtm_yearaSattm_mdayaJanaWedaSepaAprmonattm_ydaylocaltime_raTuetm_mintm_isdstLASTstrftimetime_ptrtmp_yearsaJulaSunaNovaJuntm_secaAugasctime_bufaMonlocaltimesprintf_handlervsprintfexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_putcsnprintf.cdirectory_closeio_direntry_type_tuint64_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seek/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_tcur_bytemac_to_stringip_to_stringregister_netcarddevice_numbernet_devicenetwork.cip_bytesstring_to_ipdriveropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncmp.cstrncmpstrcmp.cstrcmpstrdup.cstrdupstrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontmemchr.cmemchrunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcc__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu(t()u)+u+^t(EPJYP(ERJYR`auacuct`~PPuutPRWUWWWtl.tlWtlth.thWthPPPP.LPS.S36SWSt`.t`6;t`Wt`uuCtP PRS CSQCtlCtpQ Q,>QV CVWQW CWPP P1>PPPPDEuEGuGtDTPPDlRRDRQRVQVDRRStSuQuutqtuqtuPP.DPtuMtuPD_tl_-S-tl%KSSMtlMiStltltlStlNtuPWtugOS SSmvP17PNSSGkSrSMSS1gS%SNth$P$thPthPthNS8S8WPSPSgS%SKSSNtutttu2tt2GtuGrttrtutttuMtuMtttu,tt,1tu1YtuYtutututu~PPPQFKQM^Qtu Mtu) 9 P< P Pt P P P P P { W W MWL S S td Mtd t` Mt` t\ Mt\AtutuMtuctu tu Mtutu tu Mtu S S MS  S Q S StuMtutu MtuVMV tX MtX S S SQ SPPPS]SuuctP,t,.P.ct 8R?SPacP*S.QSScSdeuegugytuuztt&P&zt**zt VPV79P;=PMzVQ-9Q=zQPPCZP_zP|}u}utuutuutStSt QQQQQuutuuNtNRP*P@CPPQuQSuSYt\]u]_u_gthiuikukth~~PtPtPth~~RuutuutPtuutuuVt=S=?t?HSHJtJTSTVt::PEEPQQPXYuY[u[atdeuegugotdxxWtWt6W68t8oWdt 88[t [ffot }}PPP00P:?P}SQSRSRS4S8?S?BRBHSH[Q[oS}t`t`B[t`mot`}tptpotppquqsusyt|}u}u\t|PV V04V9FV|R\t`|Q!t\!-V-\t\P((PAAPtp0tpI\tp\]u]_u_t\St\Vt {QPQuutuutuutuut !u!#u#>t@AuACuC^t`auacuc~tuutuutuutuutuutuu tuu0t01u13u3PtPQuQSuStPbbjSjltlStyQuutQtuutuut u  u tuutuu@tP@QR3S6=S@AuACuCt@OOt@iit uuAtAtAt jjtAy ytA tAtAththAth[t`t`<At`]Q Q4AQSAStlAtltpAtpDEuEGuGjtDTTjtlmumouotlWtWtWV,VVV P .VFVS S  P7kSkrPSSP  PSPS&S&)P).ShS.tLFtLtP.tPFtPtp.tpFtptl.tlFtlth.thFthx|td|Rt\ -t\-Vt\uutStStSPPPPPuuvtStkSkmtmvSxyuy{u{txStStuutuutVtVtuu t PP !u!#u#+t,-u-/u/7t89u9;u;qt8EEqR8EEEPEGt GKPKgt ggPiot ooP8P Pqt8WWitiqtuuuwuwttQtSVPPuu6tVt/V/6tWt 0W06t 6tpSQ89u9;u;t8RRVtVt8RRWt Wt 8MMtpdSkQuutQtPt Pt PR tuuWtMQMWt$P$.t ..P.Ot ORPMR3 3WtXYuY[u[tXmmStuutPtP(t((P0KPKtPPtPt 0t0vvtt tV-VVS,SSt`t`V0t`9<t`<>VBvVvt`Vt`tp0tptpPd|Puu t W MtMZWZtW tt  t t t t  tt ttFMtM^^t t t CFPPP PFKWsW W*Mttgtt ttFMtttt tttt !u!#u#GtHIuIKuKmtpquqsustpQtQtpRRuutQtQtPt Pt PPPuuqtEVEHtHaVadtdnVnqtFWFHt HbWbdt doWoqt HtHddqt"DSdmStuuuwuwttQtQtPt PRRRuutQtQPt PRRRuuvttStvtxyuy{u{ txPtPtPtPt Px tx StSt SVV Vuu>tP>t<S@AuACuCbt@JJbPdeuegugtdqqQdqqR{{PPuutPVW Wuu4t45u57u7t4HHSSSWtWStS4 t MWR_rRtRRPRPRRR RxRRMWtptpMUWP W PWMOPPP3zQ*QQMWtd? tdtduutuu tP}VPVV VuxPPPP'tptp tpFtptp tpVtpYtp tpYtptp tpY|S SYtp tp  u ut ##t t t t  WWiV]  ]t/ /StS] qttt -;t~t~t~t~-7SSR1ShS-;t~\t~t~-;t~8t~8vWt~NSt~t~t~-;t~t~t~t~-8VVVV-;QQQ'QQ-9W PW<BPjtPtWPPWuub t  b t  t b   S t = S= G tG Z SZ b t V V D VG b V S= C SZ b S tp b tpd e ue g ug  t u u t  t P t  t  t  t Z Z t  t   M tM Z  Z t    t tdM tdZ tdH e td td S> V SZ q S VK e V th thZ th P P P P  PM R P P P P P P V VZ ] V  Q/ M Q Q & Qe g Q Wc m Pm WZ W P tlV tlZ tlZ e tl u u t u u Et  S t *S*-t-;S;>t>ES  V t +V+-t -<V<>t >EV R P R R P-R5>RCERHIuIKuKtHbbStStStSHllt t HbbVtVtVtVRQPQQQQuuBtSt@S@BtDEuEGuGtD\\tDrt rt zzt jtPorPPP*/PMUPozPPjvS2zSLztptpztprztptpztptpuuIt6R66t6IR3W36t 6@W@Bt BIW2V26t6?V?BtBIV 1S16t6>S>BtBISLMuMOuOtLrr|V|tVtVtVtL^^rQtr{QS{QtQSQtQSt St QSQtt Ld dtlLjjthuutVtAVADtDaVaeteVtQtQSQt@QS@DQtD\QS\`t S`et e~QS~Qtt  tlthuuttt qt {t VPnVv{V}VVV'W'+P+oWmSmoW;?R?CPCPRuu2t2R2Q45u57u7`t4CC`R4CCLPLNt NUPUWt W`P`auacuct`ooR`oo{P{t Pt uu%tVtVt%Vt t %%tP P()u)+u+t(ttt(ct ciit t t (ttt(Q Qctc ^t^ t t(\\ctctttt(@@MVMtVtVtV^t^VtVtWPWPWWWW1W14P4WPIWILPLWPWitTtT'[tTtTRtTiyPP0R0hPhjRjpPpzRRPRctXtX ^tXtXtX>BPi~VV [VVtptptp3tptptpctptp^tptpQtptp^tpptpPxyPctptp[tptpPuutuutS"t"]S]`t`S--t PTYPu}PPzQPQPuu"tt"tt "t "t uutPSSSWSRtP&Q&tLtTJtTWltTvtTxQ2JQfJtXWltXvtXtXVVWlVvVVP!.PinPPPPPOOPglPqvPPhWJWWlWvWWt\Jt\Wlt\vt\Q!dQQQQWlQvQQtdJtdWltdvtdx{P@JPuutPtPtPRRRQQQuutuu't()u)+u+ t(<P<QSx~SoSs~S S(?R? t(]Q] ttAetdt t ttetdttt ttettdtt ttWtWtdtt tWWWPWPWPWWW\P\eWeqPqW P dWiqWxWWPWPW W P )WQWPWzWz}P}WP Wtetdttt ttettdtt tdt@ t@<VxVV#VVP VZqP V<V<xtXxt\eVeVdVtXQt\Qt\ tXHQQQtXQtX t\<VxVVVR V VtHHetHdtH t`Ot` t`<VVV V4eVeqRqVtptpPP{PP9tptp  u  u C t ! ! * P* , t, C PC C tD E uE G uG W tX Y uY [ u[ k tuu<tP5t5:P:<t''5t 5<P33P::PP ,P13P<=u=?u?t<cPcvtlvyPytl<LRQLNSQNSVSVSV<tttNRRZWWW\QQuutPthRWWtt`t t`t t+tl+.PR.tltltlFsSVSVSVSVpQQQnPPPPPuuat P atl R ath Q YWY[Q[aWWS[aS 0PDSP[aPXV[aVdeuegugtdrrPtPtPtuRPPuutPWWRVVQSQSttht thuu<t<t  Vt7VW78t W8:t :<VWF Ft <tqqt< tX<tX/6SqS/:tpqtp/:t\\t\t\t\4<t\/:t`it`/6SLqSS<S<=u=?u?Yt<MMWPRWYt \]u]_u_xt\mPmxth\pRpW$,W.xW\ppstsvt`t vxt`\xt\  .t.[ [xt*S24ShjSotSvxStlPR4P<xtlSV.2SVAaSVjoSVtvSV+VajVxyuy{u{vtxvtxt tHttHVWPRVWtHWvtHx `t`j jvtx"t"jjvt`tPjvtPP S APU\PnP(SjvPPP$$P;SPejPtT,tTjvtTtX,tXjvtXt\,t\jvt\xyuy{u{txPRt uu tP t PtP tt  t  t t  SS RQtpPtpP tp !u!#u#t 00@P@ItIXPXtPt @@It Iggt t t  t 3FSISS@GVZ^V^^P^VV@BPPuu tPP S V u  u q t % P% b Wd o W % R+ H R\ \ Pi i P! ` Sd m S# a Vd n Vt u uu w uw tt  S t S P t S t St  W t W t W t W V V R V P P P P u u t   V  t , V, / t/ V  S + S6 S  W% - W4 6 WC W  tpb tp  tp tp u u : t  ) tH t : t  + 3 :  W P W W  W! ) W+ 3 W8 : W P4 tp  tp+ 3 tpuu?t  #P#(t(:P:?tuutuukt3P3kt\<R<ktX<Q<ktT<<\S\`t`{S{tStkS>^W`}WWkWL`t`ut`t`]t`dkt`L`tputp KtdKtp]tp)PDQPPP 1PL]VcoVo|PRVkVL`thuthKth]thL`tlutlktllmumouotlPtXlRtTlQtPlVtVtVtVWWWWt\t\\t\%t\t\tltlct`tl,tlPx~PSSSS"SStdtdtd3tdththBthuu t t t t/t1 * t t t ? t 1 t1 @  @  t1 t1 @ @  t1 t1 @ @  tVjVLV  V VPPP P  P P!t}/<t}JLt}[8t}Ct} t}@ o t}t t}  t}* Y t}^ t}  t}?  t}t} & t}& 1 P1  t}VjVPRVRVV/V  V@ t V* > VR> ^ V V  Vtl /tltlt  tl tl tl ? tl  SVySVt SV  SV SV SV ? SVth /ththPRtht  th th th ? thtd /tdtdt  td  PR  td td td ? tdW /W~Wt W W W ? WV/V  V^ V V  V?  Vt~/t~ 1 t~ t~ t~0 t~  t~t~/t~ 1 t~ t~ t~ W2 W W t~ W  t~ P PS S 1 Sa S S?  St~/t~ 1 t~ t~ t~< t~  t~t~/t~ 1 t~ t~l > t~> D PU ^ t~^ z P  t~  u  u F tuutP"S&SSRtp_VVP.WWuutQtuuOtOt6W8@WBMW%Btd,BtheRRR R,#V,4S8>S,BtlPQuQSuStPccQtuu?t  !P!?t44?t @AuACuCt@TT]S]ataStS@t  u  u tt3P=XPUrVtuuuwuw8ttVt8VtSt8S89u9;u;)t8PP)t8vvt t t )t 8qqtmmt)vWWW)WSPST,SmS}SSS)SV VVVvVVV VVV)VPPPPPPPP PPP$)PQ}Qgpt`ptXt`tXt`tXt`tXt`tXt`tXt`&tX&4t`4,tX,Ft`FKtXKht`htXt`tX/t`/tXt`tXt`)tXvtp)tp,-u-/u/t,CCVtV,Nt dSSSSPPSSS SS&S&2P2JSbzSuu tP tLR tHVt VWtWt VW tW t VW tW t VW tW t VW tP - P- tP P tP u u  t    Rt  u  u a t 2 P2 S tHS X PX a tH| - VW0 C VWS S , S0 B SF O Sd e ue g ug td P S S S P S V P VR V V V V V PVP2V?GVGMPMVPVPVP&V-2V7<V{VPVPVPV**VQ\V\PVPV tlY tl&tltl t~Y t~]&t~*t~ t~ t~ t~ t~ t~ <t~glt~t~ t t t tY t &t2<tt t t <ttVt tB t t  W &t2<tt"W"t t t t V <tt WY W WW*=W t4 t &t2<tt t; t &t2<tt WY WC WI R WY W&W=WuutVtV t V0EtSS-SS?hRmRRS S PS #P#-SSPSPSSSuuttt  t~tt~ t t~tt~``tptptPPPPPPPkSPSPS,SSPSpSuzPPPS*5S5;P;`S|SPSPSSSQvSvyPyS1t~pt~t~R;t~pt~t~Ept~t~Rpt~t~'tpttuubtbt`WdeuegugtdtdEVEat avVvst sVt Vt Vat\mst\zt\t\t\t\ SE]ShmSsSSS SPmuP ]SmsSatlmstltlVatlstluu+tPtP+t,-u-/u/st,;;TPT[t[bPbstVYPuuGt  Pt"PR"'t R')t )4PR4APtAGt uu1t  1R1t45u57u7t4NNt4rrt 4tt4N NYWY[t[WtWtWtWtW4NNXVX[t[VtVtV{SSSuu;t#P#/V2*V-;VR;tXQtTRQR;tT+W)S-tp-tl-thq-t`6;t`<=u=?u?t<VVt<VVaWact cWt  W  t W<VV`V`ctcVt V  t VS Suu,t//WtWt,WllqPRqt t ,//VtVt,VsSPSPSPSPS*S*,PztltlHt\,t\,-u-/u/t,@@t,fft ,[ [twVVvtltlQxWWJSOvSSuu1t  1R1t45u57u7t4YYVtV4YYt 4YYtt4 t uutuut99StS99t PRt 99WtWuu4t4R2V24t 1S14tuut u u tuu t!&R7>R>DPDKRv}P}RPP!&txVjtxj}P} tx  u ut 'V')t)VtVtVtV)R/HSHRRRTSTlRlSRSSSuu|t%%,t,NN|t|}u}utuu`tPP<P"+P<RR_qPqQ0GPGVQV[P[`Quu9t  9RP#P&6P7Suu t u u0t 0R!P#.P01u13u3Dt8BPDEuEGuGtD``oPotD``Vt Vt D``WtWD\ \tpuu0t"t|uuN t##N tt -->t >RRN t kSytpR tp  tpF b tp tp  tpRW - WUV - V{ V V N VPtR- tF b t{ N t8tR- tF b t{ N tUS S - S SS S  S{ S S N S>VtR t tF b t t  tW h W WyS SSlSQR\S3 3 S S Q S/VV V VR RTltl\ tl tlF b tl  tlP Q uQ S uS i tuutEVEGtGoVoqtqV@@Gt GDSGnSqS@GttejPjqttttPttuutt tHHht ht 11hthtWW WVV VjSSSSS SCtpQVPXtptp tpj~SSSuut,,SSSnPv{S{}t}PWnRRuult+R+0t0?R?DtDSRSXtXgRgltPDSPSXt XgPglt uuXt?V?AtAXVXt uu!t  !R$%u%'u'tuutStStuuLt<V<>t>JVJLt;S>ISLMuMOuOtLYYiPitP^mSSSuutMVMOtOxVxztzVHHOt Ot HHOtOLSOwSzSHOttnsPszttttPttuut-V-/t/XVXZtZV((/t /mmt ((/t/,S//S(/ttNSPSZttttPttuut {ttt EE^t^ss{t{t ttttt7W{WWW7V{VVV7SSS>kSs{SSS7tpR)tp)6R6StpS^R^{tpRtp7tlP)tl)6P6StlS^P^{tlPPtlPtlSSSSuutuu~tFQFntn|Q|~t,S,.t .BSBaRnzSz~R>QPQaPprPtvPx~PFaQ|~QuutQt Q tSt SR S RPPPPPQ Quut>V>@t@_V_ataV=S@^SaSUZPZattttPtt99PZZPPuutStuu_tPR]VQ\S`auacucrttuuuwuwtuutuuntttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt~uRuR\\~uRu R\\~u XSX\u\~SYV\mV2W2BupBZWZ\up\~Wttuuu VVWupWupWupttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQtt<u<Q9S9<u tt.u,P,.utt-u-Q+S+-u ttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVtt&u&R01t13t3=u0<<<P@AtACtCfu@^^fRpqtqsts}up|||PttuRttuWuWuVVttqu33VuV``qu^W^`u `oWoqu ]V`nVttuuttuttu//uhu`hu`hupupWFWWhVjlPtt~u  ~u**Du Dff~u   MWMQuQ~W  JVJQuQ~VGSf~SttuStt6uPu P 6uttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttutt;u=u=LL_u_;u)u )LL_u _;u ddu=u=vv.u.;<APpPPttuttu !t!%t%'u01t15t57uttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPttiu  5S5>u>iS  :V:>u >iVpqtqsts+upVu+Vp+u p+uS+S01t13t3Qutt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttru""rQ$:S=rSttuttuttuttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttKu7V79u9KV6S69u 9KSKQtt>u  )S)+u+8S8>u  >RttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qtt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_PiKP1iK1ZrGeMi%KyMi%K  - c AO  ; L 9~#LQ#LQ '[f [f'<A<A .FxhhxFU5'5s|2(200o0o --8MCMYx Yx jv;Lzz@ZOZxzzpsxsxjxjx, ,  !  !     @ t  [@   ^   z e x K o ^ .,  r r '08:[z)iz)szsz/J:Jc|/U - `/U - z`p N {   N {  S  S/ R\l/ R\lRT*3*@&(&(*@&(*@*A$p\\,8KT`~X_r02 (:(:@O/25;/hp8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp)030DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@L'M@M-M@M5 5p@p\?̓@̃Fԓ@ԃMܓ@܃R@L X@@,0 ], f u(mySuA0$YSNw7'<lAP. oy&@@M@M@p@̓@ԓ@ܓ@@ @@     ̓@ԓ@(p@;ܓ@H@^@@ m@ t@D@ Г@ؓ@ȃ@ܓ@tM@P@!t@(@6@7 @@*@c7BT@$Gd@ LX$@fpz@@#@ +@4/@`G@J G@J@'1Q@<@TQ@RQ@ `S@yt|S@/S@eT@@TU@tU@V@X@X@8Y@Y@d$Z@e Z@q[@)[@~3 @t GPX]@c]@Ou`@Xj@xn@lu@uw@Mx@B܉@;#19k@EU@`t@ kx@ s|@ z@ m@@l@@ @P @H @  @P  @ @0 ,@@  9p@ B@ KU`@  @ _i@_xx@x@@ @ ș@ ԙ@ @ Й@ ؙ@ @@ %.8EOXajs|@ @ @ @ @0@I@ $@ 0@g:@y@L@ V@@ _@ p@ x@ @ @ @ @ @ @ @  @@ 0@ @a`@ %D@ 1? @ G@ O`@K`@Rkt(@ @ @ @@ @7  & 0 ; C @ N U 0@^ @ g @ n @ v } @  P@E  @` @$ ؁@ ԁ@ @         . 5 D S [ b ?@ys Ħ@ } Ȧ@ ̦@       Ц@        @0! @N) @6 <@ L *@zg P@-n `)@ v 1@Q ~@% )@B t@T @ @0 n@ @  @& 0@, @@4 @ @< @ V <@`d D@"m ?@!w @ @ @ .@ d@ .@O @ @ @ H0@ P,@ 5 @+L 9@^ @Ue @B@Oo %@( @% @0 ܤ@i @ @9 #@r 0@Y @ @@ @^T#@9;P0@(D@UD@`J@z@@@X@F@@h@9@I7@f@ %@W+A@l4@GԦ@ MP@U0@] @e@+p,@c@@H@+&@l@;@V@@@d@Z@)0 @/Xb@ME@ Jp;@ ]@d ;@m`;@ z@@oF@"ԅ@K@;H@T@$@"@&@k@@7 @:@"Q@;@C@J@F@#T ?@H_@ad@w @?~@ p?@d@ @ @/@??@//@[@@H@@@5@.P@!6@ C0@H=@_ @4g08@rt @ {܈@1D@X@4F@@u@/8@0@x4@$@@@t>@ (@>x@!Z0@id(@%(@HL!@p@L@_p@t@@P@IX@@@~@!`@ ;J@'Ek@oY@-c@i.@u,m@AP'@.@ j@2<+@>@/@@_(@ h@r@ @:@m+l@ E@9M:@b@ om@` @@ď@@j`@ @32@*@ A@A@)l@ @I0@d@ -0@=@!E@IJ6@`L@Gvp)@ |`@ @0@0@< @@V@P@&-@6|@ t%@32 J@W @G]@[s0:@l@Q@ p@@ @ܓ@ @@z;@l x@ >$@ E`E@9L@'Y`@ _@@#d`@Dq@@~@9)@@@ k@.`@@ P@W@@pm@?J@ @)@X8@ E\@nQ@@ Y@aC@Ki+@+@@@@QE@ @_;@@t@&@'8@?@2P@4 @\:`@VBo@T@d*@@1@3@7/@d @L0E@"@%@V@ 3@r$`@,P:@@@!@ [p@el@ |p@U$@W@F@D@J`@W@@ B@!0@0#@o,h@J@>Y @6_,@k@;r )@| @@@T$@n@ԓ@p,@7@+p@  @@&%@-@ 3@?=@-@B@G@ J`@R@ _@.gЮ@o:@A@N@vC@>@@.@@ @W@@!p:@<@I0@P@/@)@B72@mH@ R@q`|+@"z @R/@!`@!02@mĢ@D@p@ @GB@h@ @Yh@ dF@!p@ )5@<$@QH#@ ohw@#@M/@@9@u@I(@@\@  0@i @1< 0@ L @va @Eg @ @Q @z l@ P@d @ ,@ (@' @ @ (@A!̓@ !)@)!P<@j7!p@F!@ V!<#@ v!@@~!@f!p @v!E@]!8@! 1@`!,@!@ !X@N ! @8!p@!(4@v ")@u+"@@ 1"@<"ԓ@I"@;@["X@ u"@#|"0@"Ь@"`@1"@"`T@ "@ "@H"1@"@G#@#@I(#@./#@I#@S# :@^k#:@x# @#}#<@ #@#@J#@"# @!#@#`J@L#@#@$@$ @b$ @-$ @<$p@ M$@)@T$`D@[$@`$@h$3@Dt$ @.{$<=@$PG@d$`@R$@ $1@ $ G@$H@l$@$ %@%?@,(%`@@4%@ :%@@G%T]@?Z%@ x% %@ %@%@y%@ %<(@'%P@"%pF@%@@;&@ &@q&@0& 6@B&а@G&@@S&@Nk&@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startdumpe2fs.cusageprint_rangeprint_numberlist_bad_blocksprint_freeprint_bg_optext2_err.ctextlinkbadblocks.cmake_u32_listbitmaps.cclosefs.ctest_rootfreefs.cgen_bitmap.ccheck_magicinode.cget_next_blockgroupcreate_icacheio_manager.copenfs.cread_bb.cmark_bad_blockrw_bitmaps.cwrite_bitmapsread_bitmapsunix_io.cunix_get_statsfind_cached_blockraw_write_blkflush_cached_blocksunix_flushreuse_cacheunix_write_blk64unix_write_blkraw_read_blkunix_read_blk64unix_read_blkunix_set_optionunix_write_bytefree_cachealloc_cacheunix_set_blksizeunix_closeunix_openstruct_unix_managerbitops.cblock.cxlate_funcblock_iterate_indblock_iterate_dindcsum.cext2fs_group_desc_csumextent.cupdate_pathextent_gotoext2fs_extent_fix_parentsextent_node_splitind_block.cllseek.calloc.ccheck_block_uninitalloc_stats.ccrc16.ccrc16_tableerror_message.cinit_debugdebug_maskdebug_fbufferet_name.cbufchar_setcom_err.cdefault_com_err_procls.cbuf.2400tmp.2401mntopts.cmntopt_listbuf.2393pe.cps.cuuid.cbuf.2297ostype.cos_tabfeature.cjrnl_feature_listfeature_listbuf.4432buf.4372hashstr.chash_listunparse.cuuid_unparse_xfmt_lowerfmt_upperunpack.cctype.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrtol.cstrncpy.cstrcasecmp.cmemmove.cstrcat.cstrchr.cstrcpy.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarnet.cerrors.1392protocolsservicesh_addr_list.1450ip.1449aliases.1448hostent.1447buf.1416proto_aliases_tcpservice_aliases_httpservice_aliases_imapservice_aliases_ircsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetopt.cplace.1334user.cwait.cwait_listrpc_child_exitstrerror.cerror_message.1085rpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.casprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indextime.cmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cassert.csnprintf.cdirectory.cinit.cseek.cnetwork.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncmp.cstrcmp.cstrdup.cstrlen.cstrtok.clast.930memchr.cunlink.caccess.cposix_dir.clost_link.clibgcc2.cparse_pos_paramsputcharuuid_unparseext2fs_badblocks_copyext2fs_free_generic_bitmapstrcpyasctimeinit_dev_listext2fs_extent_insertext2fs_unmark_generic_bitmapext2fs_extent_deleteunsetenvrpc_send_responseext2fs_extent_replaceyieldext2fs_update_dynamic_revrpc_get_envvarswaitpidtmpfileext2fs_badblocks_list_delppb_from_argvstrtok_rlist_sizerpc_get_responseinitialize_ext2_error_tablegetgidprintfstdoutvsprintfext2fs_get_free_blockslibrpc_rpc_handlerrpc_get_stringext2fs_write_inode_fullext2fs_inode_scan_goto_blockgroupext2fs_write_ind_blockext2fs_get_blocksungetclist_pushext2fs_resize_generic_bitmapsigemptysetstrerrore2p_mntopt2stringgeteuidinet_ptonext2fs_unmark_block_bitmap_rangerpc_get_intext2fs_u32_list_addmemmoveext2fs_closeext2fs_fudge_generic_bitmap_endsnprintfio_split_dirname__strtok_rext2fs_write_inode_bitmapext2fs_descriptor_block_locext2fs_compare_inode_bitmapreset_com_err_hookext2fs_read_bb_inodeatolget_parent_pidip_to_stringlio_seekgetenvext2fs_get_generic_bitmap_rangelist_pope2p_string2featureerrnostrtoldgetegidisblanksetlinebufinitialize_ext2_error_table_rgetsio_create_linkext2fs_make_generic_bitmapio_split_filenameppb_get_argcext2fs_compare_block_bitmaptimer_cancelgetprotobynameio_get_absolute_pathfgetsext2fs_block_iterate2getcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirext2fs_extent_opene2p_uuid2strext2fs_u32_list_delperrorcreatinit_waitpidputsdup2ext2fs_u32_copyrpc_send_string_responseislowerext2fs_read_inode_bitmaptolowergetuidrewinddirinit_execvfeofext2fs_alloc_blockmallocremovelist_is_emptyoptargext2fs_badblocks_list_iterate_end_assertext2fs_rewrite_to_iovsnprintfrpcext2fs_badblocks_list_createe2p_feature2stringext2fs_read_inode_fullstrtoul__dso_handleitoaio_channel_write_blk64ispunctstring_to_ipopterrext2fs_set_alloc_block_callbackuuid_unparse_lowerext2fs_crc16readdirjvprintfisspaceregister_netcardfflushset_com_err_hooklist_get_element_atio_channel_set_optionsregister_intr_handlerext2fs_u32_list_iterate_enddirectory_openext2fs_allocate_generic_bitmapext2fs_warn_bitmap2ext2fs_freeputenv__umoddi3lseekext2fs_extent_set_bmapsigaddsetext2fs_u32_list_createstrncasecmpext2fs_set_inode_bitmap_rangeext2fs_clear_block_bitmap__udivdi3ext2fs_set_gdt_csumsetbufferabortprintf_putcext2fs_group_desc_csum_verifygmtime_rsprintf_putcext2fs_block_iterateext2fs_flush_icacheisxdigitalarmcom_err_vae2p_edit_mntoptsmessage_handlerstrtolext2fs_open_inode_scanext2fs_clear_inode_bitmapstrnlencreate_shared_memoryprogram_nameext2fs_extent_get_inforenameinit_memory_managerext2fs_block_alloc_statsstdio_inith_errnocallocinit_dev_registerstrtodlist_insertlist_destroy_et_listwriteatofext2fs_copy_bitmape2p_uuid_to_strfprintfkillinit_service_registerext2fs_read_ind_blockctimehex_formaterror_messagedirectory_createstrcatadd_intr_handlerext2fs_u32_list_iterate_begininit_sync_messagesntohlvprintfext2fs_free_inode_bitmapext2fs_clear_generic_bitmap__deregister_frame_infoext2fs_flushchdirext2fs_u32_list_equalopen_shared_memorye2p_os2stringext2fs_badblocks_list_iterate_beginadd_error_tableext2fs_badblocks_list_addext2fs_get_inode_bitmap_range__dtor_end__fseekppb_is_validext2fs_fudge_block_bitmap_endoptindmemchrjprintf_putcstdinwaitsend_messageinit_envvarserror_table_namemktime_startext2fs_group_desc_csum_setferrorsyscall_psignalreadext2fs_extent_header_verifyext2fs_write_block_bitmapext2fs_set_block_bitmap_rangeprint_fs_statecom_err_hookuuid_unpackstrcollisupperstrncmpext2fs_inode_scan_flagsadd_to_error_tablefpurgeext2fs_new_blockstrncpyunlinksetenvmem_allocate_physicalstrcasecmphtonlgetenv_indexext2fs_read_inodeext2fs_get_data_ioext2fs_read_block_bitmapputsnreallocext2fs_extent_getset_rpc_handlerext2fs_compare_generic_bitmaprpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putce2p_string2osstrtoksigfillsetext2fs_allocate_block_bitmapfdopeninit_executeisalphaclose_shared_memoryext2fs_badblocks_list_freesigactionext2fs_badblocks_equalfreadext2fs_set_generic_bitmap_rangeext2fs_allocate_inode_bitmape2p_jrnl_string2featurestrdupe2p_hash2stringinet_atone2p_edit_feature2list_createis_directorystrtoullext2fs_get_block_bitmap_rangeinit_messagingfopen__bss_startgetoptlocaltimememsetmainremove_error_tableext2fs_mark_block_bitmap_rangeftell__dtor_start__ext2fs_get_next_inode_fullinit_service_get_nameclearerrfclosegetenv_name_by_indexgetcharntohsinet_ntoatimeopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcherrorstrcmpulltoaprintf_putsnext2fs_u32_list_freedupcreate_processsyscall_putsnio_channel_write_bytegetcwdext2fs_read_bitmapsgethostbynameext2fs_mark_generic_bitmapcmdline_get_argcresponsesgetservbynameext2fs_set_inode_callbackfgetcsprintfasprintfcmdline_copy_argve2p_string2mntoptext2fs_resize_inode_bitmapstrtofatexitstrcspnoptresetrpc_get_dwordstderrext2fs_openext2fs_free_block_bitmapext2fs_write_inodeext2fs_u32_list_testext2fs_get_generic_bitmap_endext2fs_extent_gotoext2fs_set_generic_bitmap_paddingext2fs_get_next_inodemac_to_stringsigismemberext2fs_resize_block_bitmapet_list_lockdevice_nameasprintf_putcext2fs_set_block_alloc_stats_callbackdirectory_closelibrpc_c_rpc_handlerfputce2p_jrnl_feature2stringext2fs_bg_has_superext2fs_u32_list_findoptoptdivmodpreaduuid_unparse_upperlocaltime_rhstrerrore2p_edit_featureext2fs_test_generic_bitmap__ctor_start__strftimeppb_copy_argvwait_child_addunix_io_managerext2fs_get_generic_bitmap_startisdigitfwriteext2fs_free_dblistaccessext2fs_check_directorydirectory_read_edatadestroy_processlist_super2com_err_endext2fs_write_new_inodeext2fs_test_block_bitmap_rangehtonslist_super__ctor_end__mem_free_physicalext2fs_set_bitmap_paddingrewindfreopene2p_string2hashrpc_send_int_responseext2fs_new_inodeet_ext2_error_tablerpc_response_handlerexitsyscall_timerext2fs_llseekext2fs_super_and_bgd_locsigdelsetsetbufext2fs_inode_alloc_stats2inet_ntopext2fs_close_inode_scanmem_allocateatoiext2fs_badblocks_list_testiscntrlfprintf_putsnfprintf_putce2p_is_null_uuidgetenv_countext2fs_write_bitmapsfilenoet_list_unlocksyscall_v_exitregister_message_handlertimer_register_et_dynamic_listgmtimestrlenopentoupper__init_execstrchrio_channel_read_blk64io_remove_linkfputsext2fs_u32_list_countdirectory_seekclosedirprint_fs_errorsext2fs_extent_free_Jv_RegisterClassesvasprintfext2fs_set_data_iolist_removefcntlext2fs_open2ext2fs_warn_bitmapext2fs_fudge_inode_bitmap_end__register_frame_infoext2fs_badblocks_list_iteratepwritecloseget_pidext2fs_copy_generic_bitmap_signal_default_handlertelldirvfprintfget_cmdlineraiseext2fs_inode_alloc_statsinit_process_exitfreesigprocmaskext2fs_u32_list_iteratejprintf_putsnpackages/e2fsprogs/etc/0000755000175200017520000000000011517101521014753 5ustar tyndurtyndurpackages/e2fsprogs/etc/mke2fs.conf0000644000175200017520000000144311517101521017013 0ustar tyndurtyndur[defaults] base_features = sparse_super,filetype,resize_inode,dir_index,ext_attr blocksize = 4096 inode_size = 256 inode_ratio = 16384 [fs_types] ext3 = { features = has_journal } ext4 = { features = has_journal,extents,huge_file,flex_bg,uninit_bg,dir_nlink,extra_isize inode_size = 256 } ext4dev = { features = has_journal,extents,huge_file,flex_bg,uninit_bg,dir_nlink,extra_isize inode_size = 256 options = test_fs=1 } small = { blocksize = 1024 inode_size = 128 inode_ratio = 4096 } floppy = { blocksize = 1024 inode_size = 128 inode_ratio = 8192 } news = { inode_ratio = 4096 } largefile = { inode_ratio = 1048576 blocksize = -1 } largefile4 = { inode_ratio = 4194304 blocksize = -1 } hurd = { blocksize = 4096 inode_size = 128 } packages/e2fsprogs/share/0000755000175200017520000000000011517101523015304 5ustar tyndurtyndurpackages/e2fsprogs/share/man/0000755000175200017520000000000011517101521016055 5ustar tyndurtyndurpackages/e2fsprogs/share/man/man1/0000755000175200017520000000000011517101521016711 5ustar tyndurtyndurpackages/e2fsprogs/share/man/man1/lsattr.10000644000175200017520000000200011517101521020274 0ustar tyndurtyndur.\" -*- nroff -*- .TH LSATTR 1 "October 2008" "E2fsprogs version 1.41.3" .SH NAME lsattr \- list file attributes on a Linux second extended file system .SH SYNOPSIS .B lsattr [ .B \-RVadv ] [ .I files... ] .SH DESCRIPTION .B lsattr lists the file attributes on a second extended file system. See .BR chattr (1) for a description of the attributes and what they mean. .SH OPTIONS .TP .B \-R Recursively list attributes of directories and their contents. .TP .B \-V Display the program version. .TP .B \-a List all files in directories, including files that start with `.'. .TP .B \-d List directories like other files, rather than listing their contents. .TP .B \-v List the file's version/generation number. .SH AUTHOR .B lsattr was written by Remy Card . It is currently being maintained by Theodore Ts'o . .SH BUGS There are none :-). .SH AVAILABILITY .B lsattr is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR chattr (1) packages/e2fsprogs/share/man/man1/chattr.10000644000175200017520000001407611517101521020270 0ustar tyndurtyndur.\" -*- nroff -*- .TH CHATTR 1 "October 2008" "E2fsprogs version 1.41.3" .SH NAME chattr \- change file attributes on a Linux second extended file system .SH SYNOPSIS .B chattr [ .B \-RVf ] [ .B \-v .I version ] [ .I mode ] .I files... .SH DESCRIPTION .B chattr changes the file attributes on a Linux second extended file system. .PP The format of a symbolic mode is +-=[ASacDdIijsTtu]. .PP The operator `+' causes the selected attributes to be added to the existing attributes of the files; `-' causes them to be removed; and `=' causes them to be the only attributes that the files have. .PP The letters `acdijsuADST' select the new attributes for the files: append only (a), compressed (c), no dump (d), immutable (i), data journalling (j), secure deletion (s), no tail-merging (t), undeletable (u), no atime updates (A), synchronous directory updates (D), synchronous updates (S), and top of directory hierarchy (T). .SH OPTIONS .TP .B \-R Recursively change attributes of directories and their contents. .TP .B \-V Be verbose with chattr's output and print the program version. .TP .B \-f Suppress most error messages. .TP .BI \-v " version" Set the file's version/generation number. .SH ATTRIBUTES When a file with the 'A' attribute set is accessed, its atime record is not modified. This avoids a certain amount of disk I/O for laptop systems. .PP A file with the `a' attribute set can only be open in append mode for writing. Only the superuser or a process possessing the CAP_LINUX_IMMUTABLE capability can set or clear this attribute. .PP A file with the `c' attribute set is automatically compressed on the disk by the kernel. A read from this file returns uncompressed data. A write to this file compresses data before storing them on the disk. Note: please make sure to read the bugs and limitations section at the end of this document. .PP When a directory with the `D' attribute set is modified, the changes are written synchronously on the disk; this is equivalent to the `dirsync' mount option applied to a subset of the files. .PP A file with the `d' attribute set is not candidate for backup when the .BR dump (8) program is run. .PP The 'E' attribute is used by the experimental compression patches to indicate that a compressed file has a compression error. It may not be set or reset using .BR chattr (1), although it can be displayed by .BR lsattr (1). .PP The 'e' attribute indicates that the file is using extents for mapping the blocks on disk. It may not be set or reset using .BR chattr (1), although it can be displayed by .BR lsattr (1). .PP The 'I' attribute is used by the htree code to indicate that a directory is being indexed using hashed trees. It may not be set or reset using .BR chattr (1), although it can be displayed by .BR lsattr (1). .PP The 'H' attribute indicates the file is storing its blocks in units of the filesystem blocksize instead of in units of sectors, and means that the file is (or at one time was) larger than 2TB. It may not be set or reset using .BR chattr (1), although it can be displayed by .BR lsattr (1). .PP A file with the `i' attribute cannot be modified: it cannot be deleted or renamed, no link can be created to this file and no data can be written to the file. Only the superuser or a process possessing the CAP_LINUX_IMMUTABLE capability can set or clear this attribute. .PP A file with the `j' attribute has all of its data written to the ext3 journal before being written to the file itself, if the filesystem is mounted with the "data=ordered" or "data=writeback" options. When the filesystem is mounted with the "data=journal" option all file data is already journalled and this attribute has no effect. Only the superuser or a process possessing the CAP_SYS_RESOURCE capability can set or clear this attribute. .PP When a file with the `s' attribute set is deleted, its blocks are zeroed and written back to the disk. Note: please make sure to read the bugs and limitations section at the end of this document. .PP When a file with the `S' attribute set is modified, the changes are written synchronously on the disk; this is equivalent to the `sync' mount option applied to a subset of the files. .PP A directory with the 'T' attribute will be deemed to be the top of directory hierarchies for the purposes of the Orlov block allocator (which is used in on systems with Linux 2.5.46 or later). .PP A file with the 't' attribute will not have a partial block fragment at the end of the file merged with other files (for those filesystems which support tail-merging). This is necessary for applications such as LILO which read the filesystem directly, and which don't understand tail-merged files. Note: As of this writing, the ext2 or ext3 filesystems do not (yet, except in very experimental patches) support tail-merging. .PP When a file with the `u' attribute set is deleted, its contents are saved. This allows the user to ask for its undeletion. Note: please make sure to read the bugs and limitations section at the end of this document. .PP The 'X' attribute is used by the experimental compression patches to indicate that a raw contents of a compressed file can be accessed directly. It currently may not be set or reset using .BR chattr (1), although it can be displayed by .BR lsattr (1). .PP The 'Z' attribute is used by the experimental compression patches to indicate a compressed file is dirty. It may not be set or reset using .BR chattr (1), although it can be displayed by .BR lsattr (1). .PP .SH AUTHOR .B chattr was written by Remy Card . It is currently being maintained by Theodore Ts'o . .SH BUGS AND LIMITATIONS The `c', 's', and `u' attributes are not honored by the ext2 and ext3 filesystems as implemented in the current mainline Linux kernels. These attributes may be implemented in future versions of the ext2 and ext3 filesystems. .PP The `j' option is only useful if the filesystem is mounted as ext3. .PP The `D' option is only useful on Linux kernel 2.5.19 and later. .SH AVAILABILITY .B chattr is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR lsattr (1) packages/e2fsprogs/share/man/man1/uuidgen.10000644000175200017520000000334111517101521020434 0ustar tyndurtyndur.\" Copyright 1999 Andreas Dilger (adilger@enel.ucalgary.ca) .\" .\" This man page was created for libuuid.so.1.1 from e2fsprogs-1.14. .\" .\" This file may be copied under the terms of the GNU Public License. .\" .\" Created Wed Mar 10 17:42:12 1999, Andreas Dilger .TH UUIDGEN 1 "October 2008" "E2fsprogs version 1.41.3" .SH NAME uuidgen \- command\-line utility to create a new UUID value .SH SYNOPSIS .B uuidgen [ .B \-r | .B \-t ] .SH DESCRIPTION The .B uuidgen program creates (and prints) a new universally unique identifier (UUID) using the .BR libuuid (3) library. The new UUID can reasonably be considered unique among all UUIDs created on the local system, and among UUIDs created on other systems in the past and in the future. .PP There are two types of UUID's which .B uuidgen can generate: time-based UUID's and random-based UUID's. By default .B uuidgen will generate a random-based UUID if a high-quality random number generator is present. Otherwise, it will chose a time-based UUID. It is possible to force the generation of one of these two UUID types by using the .B \-r or .B \-t options. .SH OPTIONS .TP .B \-r Generate a random-based UUID. This method creates a UUID consisting mostly of random bits. It requires that the operating system have a high quality random number generator, such as .IR /dev/random . .TP .B \-t Generate a time-based UUID. This method creates a UUID based on the system clock plus the system's ethernet hardware address, if present. .SH "CONFORMING TO" OSF DCE 1.1 .SH AUTHOR .B uuidgen was written by Andreas Dilger for libuuid. .SH AVAILABILITY .B uuidgen is part of libuuid from the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH "SEE ALSO" .BR libuuid (3) packages/e2fsprogs/share/man/man5/0000755000175200017520000000000011517101521016715 5ustar tyndurtyndurpackages/e2fsprogs/share/man/man5/e2fsck.conf.50000644000175200017520000001514211517101521021107 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 2006 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH e2fsck.conf 5 "October 2008" "E2fsprogs version 1.41.3" .SH NAME e2fsck.conf \- Configuration file for e2fsck .SH DESCRIPTION .I e2fsck.conf is the configuration file for .BR e2fsck (8). It controls the default behavior of .BR e2fsck (8) while it is checking ext2 or ext3 filesystems. .PP The .I e2fsck.conf file uses an INI-style format. Stanzas, or top-level sections, are delimited by square braces: [ ]. Within each section, each line defines a relation, which assigns tags to values, or to a subsection, which contains further relations or subsections. .\" Tags can be assigned multiple values An example of the INI-style format used by this configuration file follows below: .P [section1] .br tag1 = value_a .br tag1 = value_b .br tag2 = value_c .P [section 2] .br tag3 = { .br subtag1 = subtag_value_a .br subtag1 = subtag_value_b .br subtag2 = subtag_value_c .br } .br tag1 = value_d .br tag2 = value_e .br } .P Comments are delimited by a semicolon (';') or a hash ('#') character at the beginning of the comment, and are terminated by the end of line character. .P Tags and values must be quoted using double quotes if they contain spaces. Within a quoted string, the standard backslash interpretations apply: "\en" (for the newline character), "\et" (for the tab character), "\eb" (for the backspace character), and "\e\e" (for the backslash character). .P The following stanzas are used in the .I e2fsck.conf file. They will be described in more detail in future sections of this document. .TP .I [options] This stanza contains general configuration parameters for .BR e2fsck 's behavior. .TP .I [problems] This stanza allows the administrator to reconfigure how e2fsck handles various filesystem inconsistencies. .TP .I [scratch_files] This stanza controls when e2fsck will attempt to use scratch files to reduce the need for memory. .SH THE [options] STANZA The following relations are defined in the .I [options] stanza. .TP .I allow_cancellation If this relation is set to a boolean value of true, then if the user interrupts e2fsck using ^C, and the filesystem is not explicitly flagged as containing errors, e2fsck will exit with an exit status of 0 instead of 32. This setting defaults to false. .TP .I buggy_init_scripts Some buggy distributions (such as Ubuntu) have init scripts and/or installers which fail to correctly set the system clock before running e2fsck and/or formatting the filesystem initially. Normally this happens because the hardware clock is ticking localtime, instead of the more proper and less error-prone UTC time. So while the kernel is booting, the system time (which in Linux systems always ticks in UTC time) is set from the hardware clock, but since the hardware clock is ticking localtime, the system time is incorrect. Unfortunately, some buggy distributions do not correct this before running e2fsck. If this option is set to a boolean value of true, we attempt to work around this situation by allowing the superblock last write time, last mount time, and last check time to be in the future by up to 24 hours. .TP .I defer_check_on_battery This boolean relation controls whether or not the interval between filesystem checks (either based on time or number of mounts) should be doubled if the system is running on battery. It defaults to true. .TP .I clear_test_fs_flag This boolean relation controls whether or not e2fsck will offer to clear the test_fs flag if the ext4 filesystem is available on the system. It defaults to true. .SH THE [problems] STANZA Each tag in the .I [problems] stanza names a problem code specified with a leading "0x" followed by six hex digits. The value of the tag is a subsection where the relations in that subsection override the default treatment of that particular problem code. .P Note that inappropriate settings in this stanza may cause .B e2fsck to behave incorrectly, or even crash. Most system administrators should not be making changes to this section without referring to source code. .P Within each problem code's subsection, the following tags may be used: .TP .I description This relation allows the message which is printed when this filesystem inconsistency is detected to be overridden. .TP .I preen_ok This boolean relation overrides the default behavior controlling whether this filesystem problem should be automatically fixed when .B e2fsck is running in preen mode. .TP .I no_ok This boolean relation overrides the default behavior determining whether or not the filesystem will be marked as inconsistent if the user declines to fix the reported problem. .TP .I no_default This boolean relation overrides whether the default answer for this problem (or question) should be "no". .TP .I preen_nomessage This boolean relation overrides the default behavior controlling whether or not the description for this filesystem problem should be suppressed when .B e2fsck is running in preen mode. .TP .I no_nomsg This boolean relation overrides the default behavior controlling whether or not the description for this filesystem problem should be suppressed when .B e2fsck is run with the .B -n option. .SH THE [scratch_files] STANZA The following relations are defined in the .I [scratch_files] stanza. .TP .I directory If the directory named by this relation exists and is writeable, then e2fsck will attempt to use this directory to store scratch files instead of using in-memory data structures. .TP .I numdirs_threshold If this relation is set, then in-memory data structures be used if the number of directories in the filesystem are fewer than amount specified. .TP .I dirinfo This relation controls whether or not the scratch file directory is used instead of an in-memory data structure for directory information. It defaults to true. .TP .I icount This relation controls whether or not the scratch file directory is used instead of an in-memory data structure when tracking inode counts. It defaults to true. .SH EXAMPLES The following recipe will prevent e2fsck from aborting during the boot process when a filesystem contains orphaned files. (Of course, this is not always a good idea, since critical files that are needed for the security of the system could potentially end up in lost+found, and starting the system without first having a system administrator check things out may be dangerous.) .P .br [problems] .br 0x040002 = { .br preen_ok = true .br description = "@u @i %i. " .br } .SH FILES .TP .I /etc/e2fsck.conf The configuration file for .BR e2fsck (8). .SH SEE ALSO .BR e2fsck (8) packages/e2fsprogs/share/man/man5/mke2fs.conf.50000644000175200017520000002332011517101521021116 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 2006 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH mke2fs.conf 5 "October 2008" "E2fsprogs version 1.41.3" .SH NAME mke2fs.conf \- Configuration file for mke2fs .SH DESCRIPTION .I mke2fs.conf is the configuration file for .BR mke2fs (8). It controls the default parameters used by .BR mke2fs (8) when it is creating ext2 or ext3 filesystems. .PP The .I mke2fs.conf file uses an INI-style format. Stanzas, or top-level sections, are delimited by square braces: [ ]. Within each section, each line defines a relation, which assigns tags to values, or to a subsection, which contains further relations or subsections. .\" Tags can be assigned multiple values An example of the INI-style format used by this configuration file follows below: .P [section1] .br tag1 = value_a .br tag1 = value_b .br tag2 = value_c .P [section 2] .br tag3 = { .br subtag1 = subtag_value_a .br subtag1 = subtag_value_b .br subtag2 = subtag_value_c .br } .br tag1 = value_d .br tag2 = value_e .br } .P Comments are delimited by a semicolon (';') or a hash ('#') character at the beginning of the comment, and are terminated by the end of line character. .P Tags and values must be quoted using double quotes if they contain spaces. Within a quoted string, the standard backslash interpretations apply: "\en" (for the newline character), "\et" (for the tab character), "\eb" (for the backspace character), and "\e\e" (for the backslash character). .P The following stanzas are used in the .I mke2fs.conf file. They will be described in more detail in future sections of this document. .TP .I [defaults] Contains relations which define the default parameters used by .BR mke2fs (8). In general, these defaults may be overridden by a definition in the .B fs_types stanza, or by an command-line option provided by the user. .TP .I [fs_types] Contains relations which define defaults that should be used for specific filesystem types. The filesystem type can be specified explicitly using the .B -T option to .BR mke2fs (8). .SH THE [defaults] STANZA The following relations are defined in the .I [defaults] stanza. .TP .I base_features This relation specifies the filesystems features which are enabled in newly created filesystems. It may be overridden by the .I base_features relation found in the filesystem or usage type subsection of the .I [fs_types] stanza. .TP .I default_features This relation specifies a set of features that should be added or removed to the features listed in the .I base_features relation. It may be overridden by the filesystem-specific .I default_features in the filesystem or usage type subsection of .IR [fs_types] , and by the .B -O command-line option to .BR mke2fs (8). .TP .I force_undo This relation, if set to a boolean value of true, forces .B mke2fs to always try to create an undo file, even if the undo file might be huge and it might extend the time to create the filesystem image because the inode table isn't being initialized lazily. .TP .I fs_type This relation specifies the default filesystem type if the user does not specify it via the .B \-t option, or if .B mke2fs is not started using a program name of the form .BI mkfs. fs-type\fR. If both the user and the .B mke2fs.conf file does not specify a default filesystem type, mke2fs will use a default filesystem type of .IR ext3 if a journal was requested via a command-line option, or .I ext2 if not. .TP .I blocksize This relation specifies the default blocksize if the user does not specify a blocksize on the command line, and the filesystem-type specific section of the configuration file does not specify a blocksize. .TP .I hash_alg This relation specifies the default hash algorithm used for the new filesystems with hashed b-tree directories. Valid algorithms accepted are: .IR legacy , .IR half_md4 , and .IR tea . .TP .I inode_ratio This relation specifies the default inode ratio if the user does not specify one on the command line, and the filesystem-type specific section of the configuration file does not specify a default inode ratio. .TP .I inode_size This relation specifies the default inode size if the user does not specify one on the command line, and the filesystem-type specific section of the configuration file does not specify a default inode size. .TP .I undo_dir This relation specifies the directory where the undo file should be stored. It can be overridden via the .B E2FSPROGS_UNDO_DIR environment variable. If the directory location is set to the value .IR none , .B mke2fs will not create an undo file. .SH THE [fs_types] STANZA Each tag in the .I [fs_types] stanza names a filesystem type or usage type which can be specified via the .B \-t or .B \-T options to .BR mke2fs (8), respectively. .P The .B mke2fs program constructs a list of fs_types by concatenating the filesystem type (i.e., ext2, ext3, etc.) with the usage type list. For most configuration options, .B mke2fs will look for a subsection in the .I [fs_types] stanza corresponding with each entry in the constructed list, with later entries overriding earlier filesystem or usage types. For example, consider the following .B mke2fs.conf fragment: .P [defaults] .br base_features = sparse_super,filetype,resize_inode,dir_index .br blocksize = 4096 .br inode_size = 256 .br inode_ratio = 16384 .br .br [fs_types] .br ext3 = { .br features = has_journal .br } .br ext4 = { .br features = extents,flex_bg .br inode_size = 256 .br } .br small = { .br blocksize = 1024 .br inode_ratio = 4096 .br } .br floppy = { .br features = ^resize_inode .br blocksize = 1024 .br inode_size = 128 .br } .P If mke2fs started with a program name of .BR mke2fs.ext4 , then the filesystem type of ext4 will be used. If the filesystem is smaller than 3 megabytes, and no usage type is specified, then .B mke2fs will use a default usage type of .IR floppy . This results in an fs_types list of "ext4, floppy". Both the ext4 subsection and the floppy subsection define an .I inode_size relation, but since the later entries in the fs_types list supersede earlier ones, the configuration parameter for fs_types.floppy.inode_size will be used, so the filesystem will have an inode size of 128. .P The exception to this resolution is the .I features tag, which is specifies a set of changes to the features used by the filesystem, and which is cumulative. So in the above example, first the configuration relation defaults.base_features would enable an initial feature set with the sparse_super, filetype, resize_inode, and dir_index features enabled. Then configuration relation fs_types.ext4.features would enable the extents and flex_bg features, and finally the configuration relation fs_types.floppy.features would remove the resize_inode feature, resulting in a filesystem feature set consisting of the sparse_super, filetype, resize_inode, dir_index, extents_and flex_bg features. .P For each filesystem type, the following tags may be used in that fs_type's subsection: .TP .I base_features This relation specifies the features which are initially enabled for this filesystem type. Only one .I base_features will be used, so if there are multiple entries in the fs_types list whose subsections define the .I base_features relation, only the last will be used by .BR mke2fs (8). .TP .I features This relation specifies a comma-separated list of features edit requests which modify the feature set used by the newly constructed filesystem. The syntax is the same as the .B -O command-line option to .BR mke2fs (8); that is, a feature can be prefixed by a caret ('^') symbol to disable a named feature. Each .I feature relation specified in the fs_types list will be applied in the order found in the fs_types list. .TP .I default_features This relation specifies set of features which should be enabled or disabled after applying the features listed in the .I base_features and .I features relations. It may be overridden by the .B -O command-line option to .BR mke2fs (8). .TP .I blocksize This relation specifies the default blocksize if the user does not specify a blocksize on the command line. .TP .I lazy_itable_init This relation is a boolean which specifies whether the inode table should be lazily initialized. It only has meaning if the uninit_bg feature is enabled. If lazy_itable_init is true and the uninit_bg feature is enabled, the inode table will not fully initialized by .BR mke2fs (8). This speeds up filesystem initialization noticeably, but it requires the kernel to finish initializing the filesystem in the background when the filesystem is first mounted. .TP .I inode_ratio This relation specifies the default inode ratio if the user does not specify one on the command line. .TP .I inode_size This relation specifies the default inode size if the user does not specify one on the command line. .TP .I hash_alg This relation specifies the default hash algorithm used for the new filesystems with hashed b-tree directories. Valid algorithms accepted are: .IR legacy , .IR half_md4 , and .IR tea . .TP .I flex_bg_size This relation specifies the number of block goups that will be packed together to create one large virtual block group on an ext4 filesystem. This improves meta-data locality and performance on meta-data heavy workloads. The number of goups must be a power of 2 and may only be specified if the flex_bg filesystem feature is enabled. .I options This relation specifies additional extended options which should be treated by .BR mke2fs (8) as if they were prepended to the argument of the .B -E option. This can be used to configure the default extended options used by .BR mke2fs (8) on a per-filesystem type basis. .SH FILES .TP .I /etc/mke2fs.conf The configuration file for .BR mke2fs (8). .SH SEE ALSO .BR mke2fs (8) packages/e2fsprogs/share/man/man8/0000755000175200017520000000000011517101521016720 5ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/fsck.ext2.80000644000175200017520000002631211517101521020624 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH E2FSCK 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME e2fsck \- check a Linux ext2/ext3 file system .SH SYNOPSIS .B e2fsck [ .B \-pacnyrdfkvtDFV ] [ .B \-b .I superblock ] [ .B \-B .I blocksize ] [ .BR \-l | \-L .I bad_blocks_file ] [ .B \-C .I fd ] [ .B \-j .I external-journal ] [ .B \-E .I extended_options ] .I device .SH DESCRIPTION .B e2fsck is used to check a Linux second extended file system (ext2fs). .B E2fsck also supports ext2 filesystems containing a journal, which are also sometimes known as ext3 filesystems, by first applying the journal to the filesystem before continuing with normal .B e2fsck processing. After the journal has been applied, a filesystem will normally be marked as clean. Hence, for ext3 filesystems, .B e2fsck will normally run the journal and exit, unless its superblock indicates that further checking is required. .PP .I device is the device file where the filesystem is stored (e.g. .IR /dev/hdc1 ). .PP Note that in general it is not safe to run .B e2fsck on mounted filesystems. The only exception is if the .B \-n option is specified, and .BR \-c , .BR \-l , or .B -L options are .I not specified. However, even if it is safe to do so, the results printed by .B e2fsck are not valid if the filesystem is mounted. If .B e2fsck asks whether or not you should check a filesystem which is mounted, the only correct answer is ``no''. Only experts who really know what they are doing should consider answering this question in any other way. .SH OPTIONS .TP .B \-a This option does the same thing as the .B \-p option. It is provided for backwards compatibility only; it is suggested that people use .B \-p option whenever possible. .TP .BI \-b " superblock" Instead of using the normal superblock, use an alternative superblock specified by .IR superblock . This option is normally used when the primary superblock has been corrupted. The location of the backup superblock is dependent on the filesystem's blocksize. For filesystems with 1k blocksizes, a backup superblock can be found at block 8193; for filesystems with 2k blocksizes, at block 16384; and for 4k blocksizes, at block 32768. .IP Additional backup superblocks can be determined by using the .B mke2fs program using the .B \-n option to print out where the superblocks were created. The .B \-b option to .BR mke2fs , which specifies blocksize of the filesystem must be specified in order for the superblock locations that are printed out to be accurate. .IP If an alternative superblock is specified and the filesystem is not opened read-only, e2fsck will make sure that the primary superblock is updated appropriately upon completion of the filesystem check. .TP .BI \-B " blocksize" Normally, .B e2fsck will search for the superblock at various different block sizes in an attempt to find the appropriate block size. This search can be fooled in some cases. This option forces .B e2fsck to only try locating the superblock at a particular blocksize. If the superblock is not found, .B e2fsck will terminate with a fatal error. .TP .B \-c This option causes .B e2fsck to use .BR badblocks (8) program to do a read-only scan of the device in order to find any bad blocks. If any bad blocks are found, they are added to the bad block inode to prevent them from being allocated to a file or directory. If this option is specified twice, then the bad block scan will be done using a non-destructive read-write test. .TP .BI \-C " fd" This option causes .B e2fsck to write completion information to the specified file descriptor so that the progress of the filesystem check can be monitored. This option is typically used by programs which are running .BR e2fsck . If the file descriptor number is negative, then absolute value of the file descriptor will be used, and the progress information will be suppressed initially. It can later be enabled by sending the .B e2fsck process a SIGUSR1 signal. If the file descriptor specified is 0, .B e2fsck will print a completion bar as it goes about its business. This requires that e2fsck is running on a video console or terminal. .TP .B \-d Print debugging output (useless unless you are debugging .BR e2fsck ). .TP .B \-D Optimize directories in filesystem. This option causes e2fsck to try to optimize all directories, either by reindexing them if the filesystem supports directory indexing, or by sorting and compressing directories for smaller directories, or for filesystems using traditional linear directories. .IP Even without the .B \-D option, .B e2fsck may sometimes optimize a few directories --- for example, if directory indexing is enabled and a directory is not indexed and would benefit from being indexed, or if the index structures are corrupted and need to be rebuilt. The .B \-D option forces all directories in the filesystem to be optimized. This can sometimes make them a little smaller and slightly faster to search, but in practice, you should rarely need to use this option. .IP The .B \-D option will detect directory entries with duplicate names in a single directory, which e2fsck normally does not enforce for performance reasons. .TP .BI \-E " extended_options" Set e2fsck extended options. Extended options are comma separated, and may take an argument using the equals ('=') sign. The following options are supported: .RS 1.2i .TP .BI ea_ver= extended_attribute_version Set the version of the extended attribute blocks which .B e2fsck will require while checking the filesystem. The version number may be 1 or 2. The default extended attribute version format is 2. .TP .BI fragcheck During pass 1, print a detailed report of any discontiguous blocks for files in the filesystem. .RE .TP .B \-f Force checking even if the file system seems clean. .TP .B \-F Flush the filesystem device's buffer caches before beginning. Only really useful for doing .B e2fsck time trials. .TP .BI \-j " external-journal" Set the pathname where the external-journal for this filesystem can be found. .TP .BI \-k When combined with the .B \-c option, any existing bad blocks in the bad blocks list are preserved, and any new bad blocks found by running .BR badblocks (8) will be added to the existing bad blocks list. .TP .BI \-l " filename" Add the block numbers listed in the file specified by .I filename to the list of bad blocks. The format of this file is the same as the one generated by the .BR badblocks (8) program. Note that the block numbers are based on the blocksize of the filesystem. Hence, .BR badblocks (8) must be given the blocksize of the filesystem in order to obtain correct results. As a result, it is much simpler and safer to use the .B -c option to .BR e2fsck , since it will assure that the correct parameters are passed to the .B badblocks program. .TP .BI \-L " filename" Set the bad blocks list to be the list of blocks specified by .IR filename . (This option is the same as the .B \-l option, except the bad blocks list is cleared before the blocks listed in the file are added to the bad blocks list.) .TP .B \-n Open the filesystem read-only, and assume an answer of `no' to all questions. Allows .B e2fsck to be used non-interactively. (Note: if the .BR \-c , .BR \-l , or .B \-L options are specified in addition to the .B \-n option, then the filesystem will be opened read-write, to permit the bad-blocks list to be updated. However, no other changes will be made to the filesystem.) This option may not be specified at the same time as the .B \-p or .B \-y options. .TP .B \-p Automatically repair ("preen") the file system. This option will cause .B e2fsck to automatically fix any filesystem problems that can be safely fixed without human intervention. If .B e2fsck discovers a problem which may require the system administrator to take additional corrective action, .B e2fsck will print a description of the problem and then exit with the value 4 logically or'ed into the exit code. (See the \fBEXIT CODE\fR section.) This option is normally used by the system's boot scripts. It may not be specified at the same time as the .B \-n or .B \-y options. .TP .B \-r This option does nothing at all; it is provided only for backwards compatibility. .TP .B \-t Print timing statistics for .BR e2fsck . If this option is used twice, additional timing statistics are printed on a pass by pass basis. .TP .B \-v Verbose mode. .TP .B \-V Print version information and exit. .TP .B \-y Assume an answer of `yes' to all questions; allows .B e2fsck to be used non-interactively. This option may not be specified at the same time as the .B \-n or .B \-p options. .SH EXIT CODE The exit code returned by .B e2fsck is the sum of the following conditions: .br \ 0\ \-\ No errors .br \ 1\ \-\ File system errors corrected .br \ 2\ \-\ File system errors corrected, system should .br \ \ \ \ be rebooted .br \ 4\ \-\ File system errors left uncorrected .br \ 8\ \-\ Operational error .br \ 16\ \-\ Usage or syntax error .br \ 32\ \-\ E2fsck canceled by user request .br \ 128\ \-\ Shared library error .br .SH SIGNALS The following signals have the following effect when sent to .BR e2fsck . .TP .B SIGUSR1 This signal causes .B e2fsck to start displaying a completion bar or emitting progress information. (See discussion of the .B \-C option.) .TP .B SIGUSR2 This signal causes .B e2fsck to stop displaying a completion bar or emitting progress information. .SH REPORTING BUGS Almost any piece of software will have bugs. If you manage to find a filesystem which causes .B e2fsck to crash, or which .B e2fsck is unable to repair, please report it to the author. .PP Please include as much information as possible in your bug report. Ideally, include a complete transcript of the .B e2fsck run, so I can see exactly what error messages are displayed. (Make sure the messages printed by .B e2fsck are in English; if your system has been configured so that .BR e2fsck 's messages have been translated into another language, please set the the .B LC_ALL environment variable to .B C so that the transcript of e2fsck's output will be useful to me.) If you have a writable filesystem where the transcript can be stored, the .BR script (1) program is a handy way to save the output of .B e2fsck to a file. .PP It is also useful to send the output of .BR dumpe2fs (8). If a specific inode or inodes seems to be giving .B e2fsck trouble, try running the .BR debugfs (8) command and send the output of the .BR stat (1u) command run on the relevant inode(s). If the inode is a directory, the .B debugfs .I dump command will allow you to extract the contents of the directory inode, which can sent to me after being first run through .BR uuencode (1). The most useful data you can send to help reproduce the bug is a compressed raw image dump of the filesystem, generated using .BR e2image (8). See the .BR e2image (8) man page for more details. .PP Always include the full version string which .B e2fsck displays when it is run, so I know which version you are running. .SH AUTHOR This version of .B e2fsck was written by Theodore Ts'o . .SH SEE ALSO .BR e2fsck.conf (5), .BR badblocks (8), .BR dumpe2fs (8), .BR debugfs (8), .BR e2image (8), .BR mke2fs (8), .BR tune2fs (8) packages/e2fsprogs/share/man/man8/fsck.ext3.80000644000175200017520000000000011517101521030716 1packages/e2fsprogs/share/man/man8/fsck.ext2.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/fsck.ext4.80000644000175200017520000000000011517101521030717 1packages/e2fsprogs/share/man/man8/fsck.ext2.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/e2label.80000644000175200017520000000225511517101521020323 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH E2LABEL 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME e2label \- Change the label on an ext2/ext3 filesystem .SH SYNOPSIS .B e2label .I device [ .I new-label ] .SH DESCRIPTION .B e2label will display or change the filesystem label on the ext2 filesystem located on .I device. .PP If the optional argument .I new-label is not present, .B e2label will simply display the current filesystem label. .PP If the optional argument .I new-label is present, then .B e2label will set the filesystem label to be .IR new-label . Ext2 filesystem labels can be at most 16 characters long; if .I new-label is longer than 16 characters, .B e2label will truncate it and print a warning message. .PP It is also possible to set the filesystem label using the .B \-L option of .BR tune2fs (8). .PP .SH AUTHOR .B e2label was written by Theodore Ts'o (tytso@mit.edu). .SH AVAILABILITY .B e2label is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR mke2fs (8), .BR tune2fs (8) packages/e2fsprogs/share/man/man8/mkfs.ext4dev.80000644000175200017520000004170211517101521021337 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH MKE2FS 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME mke2fs \- create an ext2/ext3 filesystem .SH SYNOPSIS .B mke2fs [ .B \-c | .B \-l .I filename ] [ .B \-b .I block-size ] [ .B \-f .I fragment-size ] [ .B \-g .I blocks-per-group ] [ .B \-G .I number-of-groups ] [ .B \-i .I bytes-per-inode ] [ .B \-I .I inode-size ] [ .B \-j ] [ .B \-J .I journal-options ] [ .B \-N .I number-of-inodes ] [ .B \-n ] [ .B \-m .I reserved-blocks-percentage ] [ .B \-o .I creator-os ] [ .B \-O .IR feature [,...] ] [ .B \-q ] [ .B \-r .I fs-revision-level ] [ .B \-E .I extended-options ] [ .B \-v ] [ .B \-F ] [ .B \-L .I volume-label ] [ .B \-M .I last-mounted-directory ] [ .B \-S ] [ .B \-t .I fs-type ] [ .B \-T .I usage-type ] [ .B \-V ] .I device [ .I blocks-count ] .sp .B "mke2fs \-O journal_dev" [ .B \-b .I block-size ] .\" No external-journal specific journal options yet (size is ignored) .\" [ .\" .B \-J .\" .I journal-options .\" ] [ .B \-L .I volume-label ] [ .B \-n ] [ .B \-q ] [ .B \-v ] .I external-journal [ .I blocks-count ] .SH DESCRIPTION .B mke2fs is used to create an ext2/ext3 filesystem (usually in a disk partition). .I device is the special file corresponding to the device (e.g .IR /dev/hdXX ). .I blocks-count is the number of blocks on the device. If omitted, .B mke2fs automagically figures the file system size. If called as .B mkfs.ext3 a journal is created as if the .B \-j option was specified. .SH OPTIONS .TP .BI \-b " block-size" Specify the size of blocks in bytes. Valid block-size values are 1024, 2048 and 4096 bytes per block. If omitted, block-size is heuristically determined by the filesystem size and the expected usage of the filesystem (see the .B \-T option). If .I block-size is negative, then .B mke2fs will use heuristics to determine the appropriate block size, with the constraint that the block size will be at least .I block-size bytes. This is useful for certain hardware devices which require that the blocksize be a multiple of 2k. .TP .B \-c Check the device for bad blocks before creating the file system. If this option is specified twice, then a slower read-write test is used instead of a fast read-only test. .TP .BI \-E " extended-options" Set extended options for the filesystem. Extended options are comma separated, and may take an argument using the equals ('=') sign. The .B \-E option used to be .B \-R in earlier versions of .BR mke2fs . The .B \-R option is still accepted for backwards compatibility. The following extended options are supported: .RS 1.2i .TP .BI stride= stride-size Configure the filesystem for a RAID array with .I stride-size filesystem blocks. This is the number of blocks read or written to disk before moving to the next disk, which is sometimes referred to as the .I chunk size. This mostly affects placement of filesystem metadata like bitmaps at .B mke2fs time to avoid placing them on a single disk, which can hurt performance. It may also be used by the block allocator. .TP .BI stripe-width= stripe-width Configure the filesystem for a RAID array with .I stripe-width filesystem blocks per stripe. This is typically stride-size * N, where N is the number of data-bearing disks in the RAID (e.g. for RAID 5 there is one parity disk, so N will be the number of disks in the array minus 1). This allows the block allocator to prevent read-modify-write of the parity in a RAID stripe if possible when the data is written. .TP .BI resize= max-online-resize Reserve enough space so that the block group descriptor table can grow to support a filesystem that has .I max-online-resize blocks. .TP .B lazy_itable_init\fR[\fB= \fI<0 to disable, 1 to enable>\fR] If enabled and the uninit_bg feature is enabled, the inode table will not be fully initialized by .BR mke2fs . This speeds up filesystem initialization noticeably, but it requires the kernel to finish initializing the filesystem in the background when the filesystem is first mounted. If the option value is omitted, it defaults to 1 to enable lazy inode table initialization. .TP .B test_fs Set a flag in the filesystem superblock indicating that it may be mounted using experimental kernel code, such as the ext4dev filesystem. .RE .TP .BI \-f " fragment-size" Specify the size of fragments in bytes. .TP .B \-F Force .B mke2fs to create a filesystem, even if the specified device is not a partition on a block special device, or if other parameters do not make sense. In order to force .B mke2fs to create a filesystem even if the filesystem appears to be in use or is mounted (a truly dangerous thing to do), this option must be specified twice. .TP .BI \-g " blocks-per-group" Specify the number of blocks in a block group. There is generally no reason for the user to ever set this parameter, as the default is optimal for the filesystem. (For administrators who are creating filesystems on RAID arrays, it is preferable to use the .I stride RAID parameter as part of the .B \-E option rather than manipulating the number of blocks per group.) This option is generally used by developers who are developing test cases. .TP .BI \-G " number-of-groups" Specify the number of block groups that will be packed together to create one large virtual block group on an ext4 filesystem. This improves meta-data locality and performance on meta-data heavy workloads. The number of groups must be a power of 2 and may only be specified if the flex_bg filesystem feature is enabled. .TP .BI \-i " bytes-per-inode" Specify the bytes/inode ratio. .B mke2fs creates an inode for every .I bytes-per-inode bytes of space on the disk. The larger the .I bytes-per-inode ratio, the fewer inodes will be created. This value generally shouldn't be smaller than the blocksize of the filesystem, since in that case more inodes would be made than can ever be used. Be warned that it is not possible to expand the number of inodes on a filesystem after it is created, so be careful deciding the correct value for this parameter. .TP .BI \-I " inode-size" Specify the size of each inode in bytes. .B mke2fs creates 256-byte inodes by default. In kernels after 2.6.10 and some earlier vendor kernels it is possible to utilize inodes larger than 128 bytes to store extended attributes for improved performance. The .I inode-size value must be a power of 2 larger or equal to 128. The larger the .I inode-size the more space the inode table will consume, and this reduces the usable space in the filesystem and can also negatively impact performance. Extended attributes stored in large inodes are not visible with older kernels, and such filesystems will not be mountable with 2.4 kernels at all. It is not possible to change this value after the filesystem is created. .TP .B \-j Create the filesystem with an ext3 journal. If the .B \-J option is not specified, the default journal parameters will be used to create an appropriately sized journal (given the size of the filesystem) stored within the filesystem. Note that you must be using a kernel which has ext3 support in order to actually make use of the journal. .TP .BI \-J " journal-options" Create the ext3 journal using options specified on the command-line. Journal options are comma separated, and may take an argument using the equals ('=') sign. The following journal options are supported: .RS 1.2i .TP .BI size= journal-size Create an internal journal (i.e., stored inside the filesystem) of size .I journal-size megabytes. The size of the journal must be at least 1024 filesystem blocks (i.e., 1MB if using 1k blocks, 4MB if using 4k blocks, etc.) and may be no more than 102,400 filesystem blocks. .TP .BI device= external-journal Attach the filesystem to the journal block device located on .IR external-journal . The external journal must already have been created using the command .IP .B mke2fs -O journal_dev .I external-journal .IP Note that .I external-journal must have been created with the same block size as the new filesystem. In addition, while there is support for attaching multiple filesystems to a single external journal, the Linux kernel and .BR e2fsck (8) do not currently support shared external journals yet. .IP Instead of specifying a device name directly, .I external-journal can also be specified by either .BI LABEL= label or .BI UUID= UUID to locate the external journal by either the volume label or UUID stored in the ext2 superblock at the start of the journal. Use .BR dumpe2fs (8) to display a journal device's volume label and UUID. See also the .B -L option of .BR tune2fs (8). .RE .IP Only one of the .BR size " or " device options can be given for a filesystem. .TP .BI \-l " filename" Read the bad blocks list from .IR filename . Note that the block numbers in the bad block list must be generated using the same block size as used by .BR mke2fs . As a result, the .B \-c option to .B mke2fs is a much simpler and less error-prone method of checking a disk for bad blocks before formatting it, as .B mke2fs will automatically pass the correct parameters to the .B badblocks program. .TP .BI \-L " new-volume-label" Set the volume label for the filesystem to .IR new-volume-label . The maximum length of the volume label is 16 bytes. .TP .BI \-m " reserved-blocks-percentage" Specify the percentage of the filesystem blocks reserved for the super-user. This avoids fragmentation, and allows root-owned daemons, such as .BR syslogd (8), to continue to function correctly after non-privileged processes are prevented from writing to the filesystem. The default percentage is 5%. .TP .BI \-M " last-mounted-directory" Set the last mounted directory for the filesystem. This might be useful for the sake of utilities that key off of the last mounted directory to determine where the filesystem should be mounted. .TP .B \-n Causes .B mke2fs to not actually create a filesystem, but display what it would do if it were to create a filesystem. This can be used to determine the location of the backup superblocks for a particular filesystem, so long as the .B mke2fs parameters that were passed when the filesystem was originally created are used again. (With the .B \-n option added, of course!) .TP .BI \-N " number-of-inodes" Overrides the default calculation of the number of inodes that should be reserved for the filesystem (which is based on the number of blocks and the .I bytes-per-inode ratio). This allows the user to specify the number of desired inodes directly. .TP .BI \-o " creator-os" Overrides the default value of the "creator operating system" field of the filesystem. The creator field is set by default to the name of the OS the .B mke2fs executable was compiled for. .TP .B "\-O \fIfeature\fR[,...]" Create a filesystem with the given features (filesystem options), overriding the default filesystem options. The features that are enabled by default are specified by the .I base_features relation, either in the .I [defaults] section in the .B /etc/mke2fs.conf configuration file, or in the .I [fs_types] subsections for the usage types as specified by the .B \-T option, further modified by the .I features relation found in the .I [fs_types] subsections for the filesystem and usage types. See the .BR mke2fs.conf (5) manual page for more details. The filesystem type-specific configuration setting found in the .I [fs_types] section will override the global default found in .IR [defaults] . .sp The filesystem feature set will be further edited using either the feature set specified by this option, or if this option is not given, by the .I default_features relation for the filesystem type being created, or in the .I [defaults] section of the configuration file. .sp The filesystem feature set is comprised of a list of features, separated by commas, that are to be enabled. To disable a feature, simply prefix the feature name with a caret ('^') character. The pseudo-filesystem feature "none" will clear all filesystem features. .RS 1.2i .TP .B large_file Filesystem can contain files that are greater than 2GB. (Modern kernels set this feature automatically when a file > 2GB is created.) .TP .B dir_index Use hashed b-trees to speed up lookups in large directories. .TP .B filetype Store file type information in directory entries. .TP .B flex_bg Allow bitmaps and inode tables for a block group to be placed anywhere on the storage media (use with \-G option to group meta-data in order to create a large virtual block group). .TP .B has_journal Create an ext3 journal (as if using the .B \-j option). .TP .B journal_dev Create an external ext3 journal on the given device instead of a regular ext2 filesystem. Note that .I external-journal must be created with the same block size as the filesystems that will be using it. .TP .B extent Instead of using the indirect block scheme for storing the location of data blocks in an inode, use extents instead. This is a much more efficient encoding which speeds up filesystem access, especially for large files. .TP .B uninit_bg Create a filesystem without initializing all of the block groups. This feature also enables checksums and highest-inode-used statistics in each blockgroup. This feature can speed up filesystem creation time noticeably (if lazy_itable_init is enabled), and can also reduce .BR e2fsck time dramatically. It is only supported by the ext4 filesystem in recent Linux kernels. .TP .B resize_inode Reserve space so the block group descriptor table may grow in the future. Useful for online resizing using .BR resize2fs . By default .B mke2fs will attempt to reserve enough space so that the filesystem may grow to 1024 times its initial size. This can be changed using the .B resize extended option. .TP .B sparse_super Create a filesystem with fewer superblock backup copies (saves space on large filesystems). .RE .TP .B \-q Quiet execution. Useful if .B mke2fs is run in a script. .TP .BI \-r " revision" Set the filesystem revision for the new filesystem. Note that 1.2 kernels only support revision 0 filesystems. The default is to create revision 1 filesystems. .TP .B \-S Write superblock and group descriptors only. This is useful if all of the superblock and backup superblocks are corrupted, and a last-ditch recovery method is desired. It causes .B mke2fs to reinitialize the superblock and group descriptors, while not touching the inode table and the block and inode bitmaps. The .B e2fsck program should be run immediately after this option is used, and there is no guarantee that any data will be salvageable. It is critical to specify the correct filesystem blocksize when using this option, or there is no chance of recovery. .\" .TP .\" .BI \-t " test" .\" Check the device for bad blocks before creating the file system .\" using the specified test. .TP .BI \-t " fs-type" Specify the filesystem type (i.e., ext2, ext3, ext4, etc.) that is to be created. If this option is not specified, .B mke2fs will pick a default either via how the command was run (for example, using a name of the form mkfs.ext2, mkfs.ext3, etc.) or via a default as defined by the .BR /etc/mke2fs.conf (5) file. This option controls which filesystem options are used by default, based on the .B fstypes configuration stanza in .BR /etc/mke2fs.conf (5). .sp If the .B \-O option is used to explicitly add or remove filesystem options that should be set in the newly created filesystem, the resulting filesystem may not be supported by the requested .IR fs-type . (e.g., "\fBmke2fs -t ext3 -O extents /dev/sdXX\fR" will create a filesystem that is not supported by the ext3 implementation as found in the Linux kernel; and "\fBmke2fs -t ext3 -O ^has_journal /dev/hdXX\fR" will create a filesystem that does not have a journal and hence will not be supported by the ext3 filesystem code in the Linux kernel.) .TP .BI \-T " usage-type[,...]" Specify how the filesystem is going to be used, so that .B mke2fs can choose optimal filesystem parameters for that use. The usage types that are supported are defined in the configuration file .BR /etc/mke2fs.conf (5). The user may specify one or more usage types using a comma separated list. .sp If this option is is not specified, .B mke2fs will pick a single default usage type based on the size of the filesystem to be created. If the filesystem size is less than or equal to 3 megabytes, .B mke2fs will use the filesystem type .IR floppy . If the filesystem size is greater than 3 but less than or equal to 512 megabytes, .BR mke2fs (8) will use the filesystem .IR small . Otherwise, .BR mke2fs (8) will use the default filesystem type .IR default . .TP .B \-v Verbose execution. .TP .B \-V Print the version number of .B mke2fs and exit. .SH AUTHOR This version of .B mke2fs has been written by Theodore Ts'o . .SH BUGS .B mke2fs accepts the .B \-f option but currently ignores it because the second extended file system does not support fragments yet. .br There may be other ones. Please, report them to the author. .SH AVAILABILITY .B mke2fs is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR mke2fs.conf (5), .BR badblocks (8), .BR dumpe2fs (8), .BR e2fsck (8), .BR tune2fs (8) packages/e2fsprogs/share/man/man8/findfs.80000644000175200017520000000144511517101521020266 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH FINDFS 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME findfs \- Find a filesystem by label or UUID .SH SYNOPSIS .B findfs .BI LABEL= label .sp .B findfs .BI UUID= uuid .SH DESCRIPTION .B findfs will search the disks in the system looking for a filesystem which has a label matching .I label or a UUID equal to .IR uuid . If the filesystem is found, the device name for the filesystem will be printed on stdout. .PP .SH AUTHOR .B findfs was written by Theodore Ts'o (tytso@mit.edu). .SH AVAILABILITY .B findfs is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR fsck (8) packages/e2fsprogs/share/man/man8/filefrag.80000644000175200017520000000101411517101521020564 0ustar tyndurtyndur.\" -*- nroff -*- .TH FILEFRAG 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME filefrag \- report on file fragmentation .SH SYNOPSIS .B filefrag [ .B \-v ] [ .I files... ] .SH DESCRIPTION .B filefrag reports on how badly fragmented a particular file might be. It makes allowances for indirect blocks for ext2 and ext3 filesystems, but can be used on files for any filesystem. .SH OPTIONS .TP .B \-v Be verbose when checking for file fragmentation. .SH AUTHOR .B filefrag was written by Theodore Ts'o . packages/e2fsprogs/share/man/man8/logsave.80000644000175200017520000000307511517101521020456 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 2003 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH LOGSAVE 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME logsave \- save the output of a command in a logfile .SH SYNOPSIS .B logsave [ .B \-asv ] .I logfile cmd_prog [ ... ] .SH DESCRIPTION The .B logsave program will execute .I cmd_prog with the specified argument(s), and save a copy of its output to .IR logfile . If the containing directory for .I logfile does not exist, .B logsave will accumulate the output in memory until it can be written out. A copy of the output will also be written to standard output. .PP If .I cmd_prog is a single hyphen ('-'), then instead of executing a program, .B logsave will take its input from standard input and save it in .I logfile .PP .B logsave is useful for saving the output of initial boot scripts until the /var partition is mounted, so the output can be written to /var/log. .SH OPTIONS .TP .B \-a This option will cause the output to be appended to .IR logfile , instead of replacing its current contents. .TP .B \-s This option will cause .B logsave to skip writing to the log file text which is bracketed with a control-A (ASCII 001 or Start of Header) and control-B (ASCII 002 or Start of Text). This allows progress bar information to be visible to the user on the console, while not being written to the log file. .TP .B \-v This option will make .B logsave to be more verbose in its output to the user. .SH AUTHOR Theodore Ts'o (tytso@mit.edu) .SH SEE ALSO .BR fsck (8) packages/e2fsprogs/share/man/man8/fsck.80000644000175200017520000002635011517101521017745 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH FSCK 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME fsck \- check and repair a Linux file system .SH SYNOPSIS .B fsck [ .B \-sAVRTMNP ] [ .B \-C [ .I fd ] ] [ .B \-t .I fstype ] .I [filesys ... ] [\-\-] [ .B fs-specific-options ] .SH DESCRIPTION .B fsck is used to check and optionally repair one or more Linux file systems. .I filesys can be a device name (e.g. .IR /dev/hdc1 ", " /dev/sdb2 ), a mount point (e.g. .IR / ", " /usr ", " /home ), or an ext2 label or UUID specifier (e.g. UUID=8868abf6-88c5-4a83-98b8-bfc24057f7bd or LABEL=root). Normally, the .B fsck program will try to handle filesystems on different physical disk drives in parallel to reduce the total amount of time needed to check all of the filesystems. .PP If no filesystems are specified on the command line, and the .B \-A option is not specified, .B fsck will default to checking filesystems in .B /etc/fstab serially. This is equivalent to the .B \-As options. .PP The exit code returned by .B fsck is the sum of the following conditions: .br \ 0\ \-\ No errors .br \ 1\ \-\ File system errors corrected .br \ 2\ \-\ System should be rebooted .br \ 4\ \-\ File system errors left uncorrected .br \ 8\ \-\ Operational error .br \ 16\ \-\ Usage or syntax error .br \ 32\ \-\ Fsck canceled by user request .br \ 128\ \-\ Shared library error .br The exit code returned when multiple file systems are checked is the bit-wise OR of the exit codes for each file system that is checked. .PP In actuality, .B fsck is simply a front-end for the various file system checkers (\fBfsck\fR.\fIfstype\fR) available under Linux. The file system-specific checker is searched for in .I /sbin first, then in .I /etc/fs and .IR /etc , and finally in the directories listed in the PATH environment variable. Please see the file system-specific checker manual pages for further details. .SH OPTIONS .TP .B \-s Serialize .B fsck operations. This is a good idea if you are checking multiple filesystems and the checkers are in an interactive mode. (Note: .BR e2fsck (8) runs in an interactive mode by default. To make .BR e2fsck (8) run in a non-interactive mode, you must either specify the .B \-p or .B \-a option, if you wish for errors to be corrected automatically, or the .B \-n option if you do not.) .TP .BI \-t " fslist" Specifies the type(s) of file system to be checked. When the .B \-A flag is specified, only filesystems that match .I fslist are checked. The .I fslist parameter is a comma-separated list of filesystems and options specifiers. All of the filesystems in this comma-separated list may be prefixed by a negation operator .RB ' no ' or .RB ' ! ', which requests that only those filesystems not listed in .I fslist will be checked. If all of the filesystems in .I fslist are not prefixed by a negation operator, then only those filesystems listed in .I fslist will be checked. .sp Options specifiers may be included in the comma-separated .IR fslist . They must have the format .BI opts= fs-option\fR. If an options specifier is present, then only filesystems which contain .I fs-option in their mount options field of .B /etc/fstab will be checked. If the options specifier is prefixed by a negation operator, then only those filesystems that do not have .I fs-option in their mount options field of .B /etc/fstab will be checked. .sp For example, if .B opts=ro appears in .IR fslist , then only filesystems listed in .B /etc/fstab with the .B ro option will be checked. .sp For compatibility with Mandrake distributions whose boot scripts depend upon an unauthorized UI change to the .B fsck program, if a filesystem type of .B loop is found in .IR fslist , it is treated as if .B opts=loop were specified as an argument to the .B \-t option. .sp Normally, the filesystem type is deduced by searching for .I filesys in the .I /etc/fstab file and using the corresponding entry. If the type can not be deduced, and there is only a single filesystem given as an argument to the .B \-t option, .B fsck will use the specified filesystem type. If this type is not available, then the default file system type (currently ext2) is used. .TP .B \-A Walk through the .I /etc/fstab file and try to check all file systems in one run. This option is typically used from the .I /etc/rc system initialization file, instead of multiple commands for checking a single file system. .sp The root filesystem will be checked first unless the .B \-P option is specified (see below). After that, filesystems will be checked in the order specified by the .I fs_passno (the sixth) field in the .I /etc/fstab file. Filesystems with a .I fs_passno value of 0 are skipped and are not checked at all. Filesystems with a .I fs_passno value of greater than zero will be checked in order, with filesystems with the lowest .I fs_passno number being checked first. If there are multiple filesystems with the same pass number, fsck will attempt to check them in parallel, although it will avoid running multiple filesystem checks on the same physical disk. .sp Hence, a very common configuration in .I /etc/fstab files is to set the root filesystem to have a .I fs_passno value of 1 and to set all other filesystems to have a .I fs_passno value of 2. This will allow .B fsck to automatically run filesystem checkers in parallel if it is advantageous to do so. System administrators might choose not to use this configuration if they need to avoid multiple filesystem checks running in parallel for some reason --- for example, if the machine in question is short on memory so that excessive paging is a concern. .TP .B \-C\fR [ \fI "fd" \fR ] Display completion/progress bars for those filesystem checkers (currently only for ext2 and ext3) which support them. Fsck will manage the filesystem checkers so that only one of them will display a progress bar at a time. GUI front-ends may specify a file descriptor .IR fd , in which case the progress bar information will be sent to that file descriptor. .TP .B \-M Do not check mounted filesystems and return an exit code of 0 for mounted filesystems. .TP .B \-N Don't execute, just show what would be done. .TP .B \-P When the .B \-A flag is set, check the root filesystem in parallel with the other filesystems. This is not the safest thing in the world to do, since if the root filesystem is in doubt things like the .BR e2fsck (8) executable might be corrupted! This option is mainly provided for those sysadmins who don't want to repartition the root filesystem to be small and compact (which is really the right solution). .TP .B \-R When checking all file systems with the .B \-A flag, skip the root file system (in case it's already mounted read-write). .TP .B \-T Don't show the title on startup. .TP .B \-V Produce verbose output, including all file system-specific commands that are executed. .TP .B fs-specific-options Options which are not understood by .B fsck are passed to the filesystem-specific checker. These arguments .B must not take arguments, as there is no way for .B fsck to be able to properly guess which arguments take options and which don't. .IP Options and arguments which follow the .B \-\- are treated as file system-specific options to be passed to the file system-specific checker. .IP Please note that fsck is not designed to pass arbitrarily complicated options to filesystem-specific checkers. If you're doing something complicated, please just execute the filesystem-specific checker directly. If you pass .B fsck some horribly complicated option and arguments, and it doesn't do what you expect, .B don't bother reporting it as a bug. You're almost certainly doing something that you shouldn't be doing with .BR fsck. .PP Options to different filesystem-specific fsck's are not standardized. If in doubt, please consult the man pages of the filesystem-specific checker. Although not guaranteed, the following options are supported by most file system checkers: .TP .B \-a Automatically repair the file system without any questions (use this option with caution). Note that .BR e2fsck (8) supports .B \-a for backwards compatibility only. This option is mapped to .BR e2fsck 's .B \-p option which is safe to use, unlike the .B \-a option that some file system checkers support. .TP .B \-n For some filesystem-specific checkers, the .B \-n option will cause the fs-specific fsck to avoid attempting to repair any problems, but simply report such problems to stdout. This is however not true for all filesystem-specific checkers. In particular, .BR fsck.reiserfs (8) will not report any corruption if given this option. .BR fsck.minix (8) does not support the .B \-n option at all. .TP .B \-r Interactively repair the filesystem (ask for confirmations). Note: It is generally a bad idea to use this option if multiple fsck's are being run in parallel. Also note that this is .BR e2fsck 's default behavior; it supports this option for backwards compatibility reasons only. .TP .B \-y For some filesystem-specific checkers, the .B \-y option will cause the fs-specific fsck to always attempt to fix any detected filesystem corruption automatically. Sometimes an expert may be able to do better driving the fsck manually. Note that .B not all filesystem-specific checkers implement this option. In particular .BR fsck.minix (8) and .BR fsck.cramfs (8) does not support the .B -y option as of this writing. .SH AUTHOR Theodore Ts'o (tytso@mit.edu) .SH FILES .IR /etc/fstab . .SH ENVIRONMENT VARIABLES The .B fsck program's behavior is affected by the following environment variables: .TP .B FSCK_FORCE_ALL_PARALLEL If this environment variable is set, .B fsck will attempt to run all of the specified filesystems in parallel, regardless of whether the filesystems appear to be on the same device. (This is useful for RAID systems or high-end storage systems such as those sold by companies such as IBM or EMC.) .TP .B FSCK_MAX_INST This environment variable will limit the maximum number of file system checkers that can be running at one time. This allows configurations which have a large number of disks to avoid .B fsck starting too many file system checkers at once, which might overload CPU and memory resources available on the system. If this value is zero, then an unlimited number of processes can be spawned. This is currently the default, but future versions of .B fsck may attempt to automatically determine how many file system checks can be run based on gathering accounting data from the operating system. .TP .B PATH The .B PATH environment variable is used to find file system checkers. A set of system directories are searched first: .BR /sbin , .BR /sbin/fs.d , .BR /sbin/fs , .BR /etc/fs , and .BR /etc . Then the set of directories found in the .B PATH environment are searched. .TP .B FSTAB_FILE This environment variable allows the system administrator to override the standard location of the .B /etc/fstab file. It is also useful for developers who are testing .BR fsck . .SH SEE ALSO .BR fstab (5), .BR mkfs (8), .BR fsck.ext2 (8) or .BR fsck.ext3 (8) or .BR e2fsck (8), .BR cramfsck (8), .BR fsck.minix (8), .BR fsck.msdos (8), .BR fsck.jfs (8), .BR fsck.nfs (8), .BR fsck.vfat (8), .BR fsck.xfs (8), .BR fsck.xiafs (8), .BR reiserfsck (8). packages/e2fsprogs/share/man/man8/tune2fs.80000644000175200017520000004037611517101521020411 0ustar tyndurtyndur.\" Revision 1.0 93/06/3 23:00 chk .\" Initial revision .\" .\" .TH TUNE2FS 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME tune2fs \- adjust tunable filesystem parameters on ext2/ext3 filesystems .SH SYNOPSIS .B tune2fs [ .B \-l ] [ .B \-c .I max-mount-counts ] [ .B \-e .I errors-behavior ] [ .B \-f ] [ .B \-i .I interval-between-checks ] [ .B \-j ] [ .B \-J .I journal-options ] [ .B \-m .I reserved-blocks-percentage ] [ .B \-o .RI [^]mount-options [,...] ] [ .B \-r .I reserved-blocks-count ] [ .B \-s .I sparse-super-flag ] [ .B \-u .I user ] [ .B \-g .I group ] [ .B \-C .I mount-count ] [ .B \-E .I extended-options ] [ .B \-L .I volume-name ] [ .B \-M .I last-mounted-directory ] [ .B \-O .RI [^] feature [,...] ] [ .B \-T .I time-last-checked ] [ .B \-U .I UUID ] device .SH DESCRIPTION .BI tune2fs allows the system administrator to adjust various tunable filesystem parameters on Linux ext2/ext3 filesystems. .SH OPTIONS .TP .BI \-c " max-mount-counts" Adjust the number of mounts after which the filesystem will be checked by .BR e2fsck (8). If .I max-mount-counts is 0 or \-1, the number of times the filesystem is mounted will be disregarded by .BR e2fsck (8) and the kernel. .sp Staggering the mount-counts at which filesystems are forcibly checked will avoid all filesystems being checked at one time when using journaled filesystems. .sp You should strongly consider the consequences of disabling mount-count-dependent checking entirely. Bad disk drives, cables, memory, and kernel bugs could all corrupt a filesystem without marking the filesystem dirty or in error. If you are using journaling on your filesystem, your filesystem will .B never be marked dirty, so it will not normally be checked. A filesystem error detected by the kernel will still force an fsck on the next reboot, but it may already be too late to prevent data loss at that point. .sp See also the .B \-i option for time-dependent checking. .TP .BI \-C " mount-count" Set the number of times the filesystem has been mounted. If set to a greater value than the max-mount-counts parameter set by the .B \-c option, .BR e2fsck (8) will check the filesystem at the next reboot. .TP .BI \-e " error-behavior" Change the behavior of the kernel code when errors are detected. In all cases, a filesystem error will cause .BR e2fsck (8) to check the filesystem on the next boot. .I error-behavior can be one of the following: .RS 1.2i .TP 1.2i .B continue Continue normal execution. .TP .B remount-ro Remount filesystem read-only. .TP .B panic Cause a kernel panic. .RE .TP .BI \-E " extended-options" Set extended options for the filesystem. Extended options are comma separated, and may take an argument using the equals ('=') sign. The following extended options are supported: .RS 1.2i .TP .BI stride= stride-size Configure the filesystem for a RAID array with .I stride-size filesystem blocks. This is the number of blocks read or written to disk before moving to next disk. This mostly affects placement of filesystem metadata like bitmaps at .BR mke2fs (2) time to avoid placing them on a single disk, which can hurt the performance. It may also be used by block allocator. .TP .BI stripe_width= stripe-width Configure the filesystem for a RAID array with .I stripe-width filesystem blocks per stripe. This is typically be stride-size * N, where N is the number of data disks in the RAID (e.g. RAID 5 N+1, RAID 6 N+2). This allows the block allocator to prevent read-modify-write of the parity in a RAID stripe if possible when the data is written. .TP .BI hash_alg= hash-alg Set the default hash algorithm used for filesystems with hashed b-tree directories. Valid algorithms accepted are: .IR legacy , .IR half_md4 , and .IR tea . .TP .B test_fs Set a flag in the filesystem superblock indicating that it may be mounted using experimental kernel code, such as the ext4dev filesystem. .TP .B ^test_fs Clear the test_fs flag, indicating the filesystem should only be mounted using production-level filesystem code. .RE .TP .B \-f Force the tune2fs operation to complete even in the face of errors. This option is useful when removing the .B has_journal filesystem feature from a filesystem which has an external journal (or is corrupted such that it appears to have an external journal), but that external journal is not available. .sp .B WARNING: Removing an external journal from a filesystem which was not cleanly unmounted without first replaying the external journal can result in severe data loss and filesystem corruption. .TP .BI \-g " group" Set the group which can use the reserved filesystem blocks. The .I group parameter can be a numerical gid or a group name. If a group name is given, it is converted to a numerical gid before it is stored in the superblock. .TP .B \-i " \fIinterval-between-checks\fR[\fBd\fR|\fBm\fR|\fBw\fR]" Adjust the maximal time between two filesystem checks. No postfix or .B d result in days, .B m in months, and .B w in weeks. A value of zero will disable the time-dependent checking. .sp It is strongly recommended that either .B \-c (mount-count-dependent) or .B \-i (time-dependent) checking be enabled to force periodic full .BR e2fsck (8) checking of the filesystem. Failure to do so may lead to filesystem corruption (due to bad disks, cables, memory, or kernel bugs) going unnoticed, ultimately resulting in data loss or corruption. .TP .B \-j Add an ext3 journal to the filesystem. If the .B \-J option is not specified, the default journal parameters will be used to create an appropriately sized journal (given the size of the filesystem) stored within the filesystem. Note that you must be using a kernel which has ext3 support in order to actually make use of the journal. .IP If this option is used to create a journal on a mounted filesystem, an immutable file, .BR .journal , will be created in the top-level directory of the filesystem, as it is the only safe way to create the journal inode while the filesystem is mounted. While the ext3 journal is visible, it is not safe to delete it, or modify it while the filesystem is mounted; for this reason the file is marked immutable. While checking unmounted filesystems, .BR e2fsck (8) will automatically move .B .journal files to the invisible, reserved journal inode. For all filesystems except for the root filesystem, this should happen automatically and naturally during the next reboot cycle. Since the root filesystem is mounted read-only, .BR e2fsck (8) must be run from a rescue floppy in order to effect this transition. .IP On some distributions, such as Debian, if an initial ramdisk is used, the initrd scripts will automatically convert an ext2 root filesystem to ext3 if the .BR /etc/fstab file specifies the ext3 filesystem for the root filesystem in order to avoid requiring the use of a rescue floppy to add an ext3 journal to the root filesystem. .TP .BR \-J " journal-options" Override the default ext3 journal parameters. Journal options are comma separated, and may take an argument using the equals ('=') sign. The following journal options are supported: .RS 1.2i .TP .BI size= journal-size Create a journal stored in the filesystem of size .I journal-size megabytes. The size of the journal must be at least 1024 filesystem blocks (i.e., 1MB if using 1k blocks, 4MB if using 4k blocks, etc.) and may be no more than 102,400 filesystem blocks. There must be enough free space in the filesystem to create a journal of that size. .TP .BI device= external-journal Attach the filesystem to the journal block device located on .IR external-journal . The external journal must have been already created using the command .IP .B mke2fs -O journal_dev .I external-journal .IP Note that .I external-journal must be formatted with the same block size as filesystems which will be using it. In addition, while there is support for attaching multiple filesystems to a single external journal, the Linux kernel and .BR e2fsck (8) do not currently support shared external journals yet. .IP Instead of specifying a device name directly, .I external-journal can also be specified by either .BI LABEL= label or .BI UUID= UUID to locate the external journal by either the volume label or UUID stored in the ext2 superblock at the start of the journal. Use .BR dumpe2fs (8) to display a journal device's volume label and UUID. See also the .B -L option of .BR tune2fs (8). .RE .IP Only one of the .BR size " or " device options can be given for a filesystem. .TP .B \-l List the contents of the filesystem superblock. .TP .BI \-L " volume-label" Set the volume label of the filesystem. Ext2 filesystem labels can be at most 16 characters long; if .I volume-label is longer than 16 characters, .B tune2fs will truncate it and print a warning. The volume label can be used by .BR mount (8), .BR fsck (8), and .BR /etc/fstab (5) (and possibly others) by specifying .BI LABEL= volume_label instead of a block special device name like .BR /dev/hda5 . .TP .BI \-m " reserved-blocks-percentage" Set the percentage of the filesystem which may only be allocated by privileged processes. Reserving some number of filesystem blocks for use by privileged processes is done to avoid filesystem fragmentation, and to allow system daemons, such as .BR syslogd (8), to continue to function correctly after non-privileged processes are prevented from writing to the filesystem. Normally, the default percentage of reserved blocks is 5%. .TP .BI \-M " last-mounted-directory" Set the last-mounted directory for the filesystem. .TP .BR \-o " [^]\fImount-option\fR[,...]" Set or clear the indicated default mount options in the filesystem. Default mount options can be overridden by mount options specified either in .BR /etc/fstab (5) or on the command line arguments to .BR mount (8). Older kernels may not support this feature; in particular, kernels which predate 2.4.20 will almost certainly ignore the default mount options field in the superblock. .IP More than one mount option can be cleared or set by separating features with commas. Mount options prefixed with a caret character ('^') will be cleared in the filesystem's superblock; mount options without a prefix character or prefixed with a plus character ('+') will be added to the filesystem. .IP The following mount options can be set or cleared using .BR tune2fs : .RS 1.2i .TP .B debug Enable debugging code for this filesystem. .TP .B bsdgroups Emulate BSD behaviour when creating new files: they will take the group-id of the directory in which they were created. The standard System V behaviour is the default, where newly created files take on the fsgid of the current process, unless the directory has the setgid bit set, in which case it takes the gid from the parent directory, and also gets the setgid bit set if it is a directory itself. .TP .B user_xattr Enable user-specified extended attributes. .TP .B acl Enable Posix Access Control Lists. .TP .B uid16 Disables 32-bit UIDs and GIDs. This is for interoperability with older kernels which only store and expect 16-bit values. .TP .B journal_data When the filesystem is mounted with journalling enabled, all data (not just metadata) is committed into the journal prior to being written into the main filesystem. .TP .B journal_data_ordered When the filesystem is mounted with journalling enabled, all data is forced directly out to the main file system prior to its metadata being committed to the journal. .TP .B journal_data_writeback When the filesystem is mounted with journalling enabled, data may be written into the main filesystem after its metadata has been committed to the journal. This may increase throughput, however, it may allow old data to appear in files after a crash and journal recovery. .RE .TP .BR \-O " [^]\fIfeature\fR[,...]" Set or clear the indicated filesystem features (options) in the filesystem. More than one filesystem feature can be cleared or set by separating features with commas. Filesystem features prefixed with a caret character ('^') will be cleared in the filesystem's superblock; filesystem features without a prefix character or prefixed with a plus character ('+') will be added to the filesystem. .IP The following filesystem features can be set or cleared using .BR tune2fs : .RS 1.2i .TP .B large_file Filesystem can contain files that are greater than 2GB. (Modern kernels set this feature automatically when a file > 2GB is created.) .TP .B dir_index Use hashed b-trees to speed up lookups in large directories. .TP .B filetype Store file type information in directory entries. .TP .B has_journal Use a journal to ensure filesystem consistency even across unclean shutdowns. Setting the filesystem feature is equivalent to using the .B \-j option. .TP .B sparse_super Limit the number of backup superblocks to save space on large filesystems. .TP .B resize_inode Reserve space so the block group descriptor table may grow in the future. .B Tune2fs only supports clearing this filesystem feature. .TP .B uninit_bg Allow the kernel to initialize bitmaps and inode tables and keep a high watermark for the unused inodes in a filesystem, to reduce .BR e2fsck (8) time. This first e2fsck run after enabling this feature will take the full time, but subsequent e2fsck runs will take only a fraction of the original time, depending on how full the file system is. .RE .IP After setting or clearing .BR sparse_super , .BR uninit_bg , .BR filetype , or .B resize_inode filesystem features, .BR e2fsck (8) must be run on the filesystem to return the filesystem to a consistent state. .B Tune2fs will print a message requesting that the system administrator run .BR e2fsck (8) if necessary. After setting the .B dir_index feature, .B e2fsck -D can be run to convert existing directories to the hashed B-tree format. Enabling certain filesystem features may prevent the filesystem from being mounted by kernels which do not support those features. In particular the .BR uninit_bg and .BR flex_bg features are only supported by the ext4 filesystem. .TP .BI \-r " reserved-blocks-count" Set the number of reserved filesystem blocks. .TP .BI \-T " time-last-checked" Set the time the filesystem was last checked using .BR e2fsck . The time is interpreted using the current (local) timezone. This can be useful in scripts which use a Logical Volume Manager to make a consistent snapshot of a filesystem, and then check the filesystem during off hours to make sure it hasn't been corrupted due to hardware problems, etc. If the filesystem was clean, then this option can be used to set the last checked time on the original filesystem. The format of .I time-last-checked is the international date format, with an optional time specifier, i.e. YYYYMMDD[HH[MM[SS]]]. The keyword .B now is also accepted, in which case the last checked time will be set to the current time. .TP .BI \-u " user" Set the user who can use the reserved filesystem blocks. .I user can be a numerical uid or a user name. If a user name is given, it is converted to a numerical uid before it is stored in the superblock. .TP .BI \-U " UUID" Set the universally unique identifier (UUID) of the filesystem to .IR UUID . The format of the UUID is a series of hex digits separated by hyphens, like this: "c1b9d5a2-f162-11cf-9ece-0020afc76f16". The .I UUID parameter may also be one of the following: .RS 1.2i .TP .I clear clear the filesystem UUID .TP .I random generate a new randomly-generated UUID .TP .I time generate a new time-based UUID .RE .IP The UUID may be used by .BR mount (8), .BR fsck (8), and .BR /etc/fstab (5) (and possibly others) by specifying .BI UUID= uuid instead of a block special device name like .BR /dev/hda1 . .IP See .BR uuidgen (8) for more information. If the system does not have a good random number generator such as .I /dev/random or .IR /dev/urandom , .B tune2fs will automatically use a time-based UUID instead of a randomly-generated UUID. .SH BUGS We haven't found any bugs yet. That doesn't mean there aren't any... .SH AUTHOR .B tune2fs was written by Remy Card . It is currently being maintained by Theodore Ts'o . .B tune2fs uses the ext2fs library written by Theodore Ts'o . This manual page was written by Christian Kuhtz . Time-dependent checking was added by Uwe Ohse . .SH AVAILABILITY .B tune2fs is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR debugfs (8), .BR dumpe2fs (8), .BR e2fsck (8), .BR mke2fs (8) packages/e2fsprogs/share/man/man8/mke2fs.80000644000175200017520000000000011517101521031010 1packages/e2fsprogs/share/man/man8/mkfs.ext4dev.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/e2fsck.80000644000175200017520000000000011517101521030263 1packages/e2fsprogs/share/man/man8/fsck.ext2.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/mklost+found.80000644000175200017520000000243711517101521021437 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH MKLOST+FOUND 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME mklost+found \- create a lost+found directory on a mounted Linux second extended file system .SH SYNOPSIS .B mklost+found .SH DESCRIPTION .B mklost+found is used to create a .I lost+found directory in the current working directory on a Linux second extended file system. There is normally a .I lost+found directory in the root directory of each filesystem. .PP .B mklost+found pre-allocates disk blocks to the .I lost+found directory so that when .BR e2fsck (8) is being run to recover a filesystem, it does not need to allocate blocks in the filesystem to store a large number of unlinked files. This ensures that .B e2fsck will not have to allocate data blocks in the filesystem during recovery. .SH OPTIONS There are none. .SH AUTHOR .B mklost+found has been written by Remy Card . It is currently being maintained by Theodore Ts'o . .SH BUGS There are none :-) .SH AVAILABILITY .B mklost+found is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR e2fsck (8), .BR mke2fs (8) packages/e2fsprogs/share/man/man8/mkfs.ext2.80000644000175200017520000000000011517101521031442 1packages/e2fsprogs/share/man/man8/mkfs.ext4dev.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/mkfs.ext3.80000644000175200017520000000000011517101521031443 1packages/e2fsprogs/share/man/man8/mkfs.ext4dev.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/mkfs.ext4.80000644000175200017520000000000011517101521031444 1packages/e2fsprogs/share/man/man8/mkfs.ext4dev.8ustar tyndurtyndurpackages/e2fsprogs/share/man/man8/blkid.80000644000175200017520000001007311517101521020077 0ustar tyndurtyndur.\" Copyright 2000 Andreas Dilger (adilger@turbolinux.com) .\" .\" This man page was created for blkid from e2fsprogs-1.25. .\" .\" This file may be copied under the terms of the GNU Public License. .\" .\" Based on uuidgen, Mon Sep 17 10:42:12 2000, Andreas Dilger .TH BLKID 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME blkid \- command\-line utility to locate/print block device attributes .SH SYNOPSIS .B blkid [ .B \-ghlLv ] [ [ .B \-c .I cachefile ] .B \-w .I writecachefile ] [ .B \-o .I format ] [ .B \-s .I tag ] [ .B \-t .IR NAME = value ] [ .I device ... ] .SH DESCRIPTION The .B blkid program is the command-line interface to working with .BR libblkid (3) library. It can determine the type of content (e.g. filesystem, swap) a block device holds, and also attributes (tokens, NAME=value pairs) from the content metadata (e.g. LABEL or UUID fields). .PP .B blkid has two main forms of operation: either searching for a device with a specific NAME=value pair, or displaying NAME=value pairs for one or more devices. .SH OPTIONS .TP .BI \-c " cachefile" Read from .I cachefile instead of reading from the default cache file .IR /etc/blkid.tab . If you want to start with a clean cache (i.e. don't report devices previously scanned but not necessarily available at this time), specify .IR /dev/null . .TP .B \-g Perform a garbage collection pass on the blkid cache to remove devices which no longer exist. .TP .B \-h Display a usage message and exit. .TP .B \-l Look up one device that matches the search parameter specified using the .B \-t option. If there are multiple devices that match the specified search parameter, then the device with the highest priority is returned, and/or the first device found at a given priority. Device types in order of decreasing priority are Device Mapper, EVMS, LVM, MD, and finally regular block devices. If this option is not specified, .B blkid will print all of the devices that match the search parameter. .TP .BI \-o " format" Display .BR blkid 's output using the specified format. The .I format parameter may be .I full (the default), .I value (only print the value of the tags), .I list (print the devices in a user-friendly format), or .I device (only print the device name). .TP .B \-L Print the devices in a user-friendly list format. This is the equivalent of using the option \fB-o list\fR. .TP .BI \-s " tag" For each (specified) device, show only the tags that match .IR tag . It is possible to specify multiple .B \-s options. If no tag is specified, then all tokens are shown for all (specified) devices. In order to just refresh the cache without showing any tokens, use .B "-s none" with no other options. .TP .BI \-t " NAME" = "value" Search for block devices with tokens named .I NAME that have the value .IR value , and display any devices which are found. Common values for .I NAME include .BR TYPE , .BR LABEL , and .BR UUID . If there are no devices specified on the command line, all block devices will be searched; otherwise only the specified devices are searched. .TP .B \-v Display version number and exit. .TP .BI \-w " writecachefile" Write the device cache to .I writecachefile instead of writing it to the default cache file .IR /etc/blkid.tab . If you don't want to save the cache to the default file, specify .IR /dev/null. If not specified it will be the same file as that given by the .B \-c option. .TP .I device Display tokens from only the specified device. It is possible to give multiple .I device options on the command line. If none is given, all devices which appear in .I /proc/partitions are shown, if they are recognized. .SH "RETURN CODE" If the specified token was found, or if any tags were shown from (specified) devices, 0 is returned. If the specified token was not found, or no (specified) devices could be identified, an exit code of 2 is returned. For usage or other errors, an exit code of 4 is returned. .SH AUTHOR .B blkid was written by Andreas Dilger for libblkid. .SH AVAILABILITY .B blkid is part the e2fsprogs package since version 1.26 and is available from http://e2fsprogs.sourceforge.net. .SH "SEE ALSO" .BR libblkid (3) packages/e2fsprogs/share/man/man8/e2undo.80000644000175200017520000000206311517101521020206 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 2008 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH E2UNDO 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME e2undo \- Replay an undo log for an ext2/ext3/ext4 filesystem .SH SYNOPSIS .B e2undo [ .B \-f ] .I undo_log device .SH DESCRIPTION .B e2undo will replay the undo log .I undo_log for an ext2/ext3/ext4 filesystem found on .IR device . This can be used to undo a failed operation by an e2fsprogs program. .SH OPTIONS .TP .B \-f Normally, .B e2undo will check the filesystem UUID and last modified time to make sure the undo log matches with the filesystem on the device. If they do not match, .B e2undo will refuse to apply the undo log as a safety mechanism. The .B \-f option disables this safety mechanism. .SH AUTHOR .B e2undo was written by Aneesh Kumar K.V. (aneesh.kumar@linux.vnet.ibm.com) .SH AVAILABILITY .B e2undo is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR mke2fs (8), .BR tune2fs (8) packages/e2fsprogs/share/man/man8/badblocks.80000644000175200017520000001420511517101521020737 0ustar tyndurtyndur.\" -*- nroff -*- .TH BADBLOCKS 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME badblocks \- search a device for bad blocks .SH SYNOPSIS .B badblocks [ .B \-svwnf ] [ .B \-b .I block-size ] [ .B \-c .I blocks_at_once ] [ .B \-e .I max_bad_blocks ] [ .B \-d .I read_delay_factor ] [ .B \-i .I input_file ] [ .B \-o .I output_file ] [ .B \-p .I num_passes ] [ .B \-t .I test_pattern ] .I device [ .I last-block ] [ .I first-block ] .SH DESCRIPTION .B badblocks is used to search for bad blocks on a device (usually a disk partition). .I device is the special file corresponding to the device (e.g .IR /dev/hdc1 ). .I last-block is the last block to be checked; if it is not specified, the last block on the device is used as a default. .I first-block is an optional parameter specifying the starting block number for the test, which allows the testing to start in the middle of the disk. If it is not specified the first block on the disk is used as a default. .PP .B Important note: If the output of .B badblocks is going to be fed to the .B e2fsck or .B mke2fs programs, it is important that the block size is properly specified, since the block numbers which are generated are very dependent on the block size in use by the filesystem. For this reason, it is strongly recommended that users .B not run .B badblocks directly, but rather use the .B \-c option of the .B e2fsck and .B mke2fs programs. .SH OPTIONS .TP .BI \-b " block-size" Specify the size of blocks in bytes. The default is 1024. .TP .BI \-c " number of blocks" is the number of blocks which are tested at a time. The default is 64. .TP .BI \-e " max bad block count" Specify a maximum number of bad blocks before aborting the test. The default is 0, meaning the test will continue until the end of the test range is reached. .TP .BI \-d " read delay factor" This parameter, if passed and non-zero, will cause bad blocks to sleep between reads if there were no errors encountered in the read operation; the delay will be calculated as a percentage of the time it took for the read operation to be performed. In other words, a value of 100 will cause each read to be delayed by the amount the previous read took, and a value of 200 by twice the amount. .TP .B \-f Normally, badblocks will refuse to do a read/write or a non-destructive test on a device which is mounted, since either can cause the system to potentially crash and/or damage the filesystem even if it is mounted read-only. This can be overridden using the .B \-f flag, but should almost never be used --- if you think you're smarter than the .B badblocks program, you almost certainly aren't. The only time when this option might be safe to use is if the /etc/mtab file is incorrect, and the device really isn't mounted. .TP .BI \-i " input_file" Read a list of already existing known bad blocks. .B Badblocks will skip testing these blocks since they are known to be bad. If .I input_file is specified as "-", the list will be read from the standard input. Blocks listed in this list will be omitted from the list of .I new bad blocks produced on the standard output or in the output file. The .B \-b option of .BR dumpe2fs (8) can be used to retrieve the list of blocks currently marked bad on an existing filesystem, in a format suitable for use with this option. .TP .BI \-o " output_file" Write the list of bad blocks to the specified file. Without this option, .B badblocks displays the list on its standard output. The format of this file is suitable for use by the . .B \-l option in .BR e2fsck (8) or .BR mke2fs (8). .TP .BI \-p " num_passes" Repeat scanning the disk until there are no new blocks discovered in num_passes consecutive scans of the disk. Default is 0, meaning .B badblocks will exit after the first pass. .TP .BI \-t " test_pattern" Specify a test pattern to be read (and written) to disk blocks. The .I test_pattern may either be a numeric value between 0 and ULONG_MAX-1 inclusive, or the word "random", which specifies that the block should be filled with a random bit pattern. For read/write (\fB-w\fR) and non-destructive (\fB-n\fR) modes, one or more test patterns may be specified by specifying the .B -t option for each test pattern desired. For read-only mode only a single pattern may be specified and it may not be "random". Read-only testing with a pattern assumes that the specified pattern has previously been written to the disk - if not, large numbers of blocks will fail verification. If multiple patterns are specified then all blocks will be tested with one pattern before proceeding to the next pattern. .TP .B \-n Use non-destructive read-write mode. By default only a non-destructive read-only test is done. This option must not be combined with the .B \-w option, as they are mutually exclusive. .TP .B \-s Show the progress of the scan by writing out the block numbers as they are checked. .TP .B \-v Verbose mode. .TP .B \-w Use write-mode test. With this option, .B badblocks scans for bad blocks by writing some patterns (0xaa, 0x55, 0xff, 0x00) on every block of the device, reading every block and comparing the contents. This option may not be combined with the .B \-n option, as they are mutually exclusive. .TP .B \-X Internal flag only to be used by .BR e2fsck (8) and .BR mke2fs (8). It bypasses the exclusive mode in-use device safety check. .SH WARNING Never use the .B \-w option on a device containing an existing file system. This option erases data! If you want to do write-mode testing on an existing file system, use the .B \-n option instead. It is slower, but it will preserve your data. .PP The .B \-e option will cause badblocks to output a possibly incomplete list of bad blocks. Therefore it is recommended to use it only when one wants to know if there are any bad blocks at all on the device, and not when the list of bad blocks is wanted. .SH AUTHOR .B badblocks was written by Remy Card . Current maintainer is Theodore Ts'o . Non-destructive read/write test implemented by David Beattie . .SH AVAILABILITY .B badblocks is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR e2fsck (8), .BR mke2fs (8) packages/e2fsprogs/share/man/man8/dumpe2fs.80000644000175200017520000000416511517101521020544 0ustar tyndurtyndur.\" -*- nroff -*- .\" Copyright 1993, 1994, 1995 by Theodore Ts'o. All Rights Reserved. .\" This file may be copied under the terms of the GNU Public License. .\" .TH DUMPE2FS 8 "October 2008" "E2fsprogs version 1.41.3" .SH NAME dumpe2fs \- dump ext2/ext3 filesystem information .SH SYNOPSIS .B dumpe2fs [ .B \-bfhixV ] [ .B \-o superblock=\fIsuperblock ] [ .B \-o blocksize=\fIblocksize ] .I device .SH DESCRIPTION .B dumpe2fs prints the super block and blocks group information for the filesystem present on .I device. .PP .B dumpe2fs is similar to Berkeley's .B dumpfs program for the BSD Fast File System. .SH OPTIONS .TP .B \-b print the blocks which are reserved as bad in the filesystem. .TP .B \-o superblock=\fIsuperblock use the block .I superblock when examining the filesystem. This option is not usually needed except by a filesystem wizard who is examining the remains of a very badly corrupted filesystem. .TP .B \-o blocksize=\fIblocksize use blocks of .I blocksize bytes when examining the filesystem. This option is not usually needed except by a filesystem wizard who is examining the remains of a very badly corrupted filesystem. .TP .B \-f force dumpe2fs to display a filesystem even though it may have some filesystem feature flags which dumpe2fs may not understand (and which can cause some of dumpe2fs's display to be suspect). .TP .B \-h only display the superblock information and not any of the block group descriptor detail information. .TP .B \-i display the filesystem data from an image file created by .BR e2image , using .I device as the pathname to the image file. .TP .B \-x print the detailed group information block numbers in hexadecimal format .TP .B \-V print the version number of .B dumpe2fs and exit. .SH BUGS You need to know the physical filesystem structure to understand the output. .SH AUTHOR .B dumpe2fs was written by Remy Card . It is currently being maintained by Theodore Ts'o . .SH AVAILABILITY .B dumpe2fs is part of the e2fsprogs package and is available from http://e2fsprogs.sourceforge.net. .SH SEE ALSO .BR e2fsck (8), .BR mke2fs (8), .BR tune2fs (8) packages/e2fsprogs/share/man/man8/fsck.ext4dev.80000644000175200017520000000000011517101521031416 1packages/e2fsprogs/share/man/man8/fsck.ext2.8ustar tyndurtyndurpackages/e2fsprogs/share/info/0000755000175200017520000000000011517101523016237 5ustar tyndurtyndurpackages/e2fsprogs/share/info/libext2fs.info.gz0000644000175200017520000003170211517101523021440 0ustar tyndurtyndurSN`}.7O۷ovCNۣoݧW$Y󍔀~y,ZEJFI8I"KWEKr HqLƖgw(ng?)^fL1l7r$]aO&"Ӷ EQ^'=SU$Rq,A5w t =(WJhL)c"G+*j* (cpԙ b:<TٸHq>hwWP&C4wJN /]8]NMheM\Il=+0@t0wkm[߭>_kE{4 h vilcڷa؇ͭD\/#+7̷moJ1/VQx۵y [mɦY^,=v G)mCI9&E,+h\ $|ųj 9 #t~rR nY 4ψM  1Բ~`WFL'6Z~Dk'S(o>H~52A R2E{ dؐ!!O`9U@vgt9ƃЬ5 NRa:[YkP"LF~O:,gQ 4rwS@[$|yCU `Di."ޅQ*쏄9܎} [ф;zd9t@&L9;_"/eiZS 0%ȋN(/Ȉ? 7+ e{eȬ c"⏘4۟ǟ񶩖lz mq #틂$5jKreg8s\T`3xt_YbA2(oԔc|b.0F_oګȮrZ.g + G~ɥYnL hbl"AN$}w|C!f0`$$N+TN c|Nh{r Q =;-ұV.]c)҃&]!mp8M54 ZH Vq@ce.;^GCRq<(G*f뙑ttPqQN_#)N]OVE܀ |tXd^J 8&TNʰ,3I,IG"^ƚ 5~ئX]+ԞـA,ξP~}=l=}bO W3KoNŇRF|" M@h[;a7^ e#mBP(t ɞ4nt*qHpH3jI\ d+$NVY 0%*a y"f-YEʀˬi,f 9la2}8vCF}t+ne,Hr6fQ- Pv#-dљTy@(%ZADBKKQUd=|k-h^G§Y(Q#쮩S$s,ʁXҙƌۓrQWܟd?4/ͅv`, 9[:U3V۪rnȷE}H6TR K`"Jl♉1k~Dx#`rp3Am`lytjn i7ɜljY FaB#IW97"]-cS~`Ao;f5"y~2rܯ< aQ܂NWĠ0|ނ m0=K?cf@[)'cJs +"vaPó$6`0\N./_x4`b;c<^JNe &*ɮ./||q~R9Z$c EZ\aExX&߉T c%JD QKnDU;q\ņ0O;ǭ]WfO^HWjh }a쑱XGNb?SY\@ʹ5Ru >ÊS HF0ȕq.|H%뙧xvyXGHb:uw %8 ;FkEkZb$I<z!eKx b?/Wvr9F! ?c.JxHI 'fR?G2:7f rǦptyp(YK. R_d4q^9)Q#~)N"y~c[E\ެzq㉊4xkxS1Uо5[2y{5WBeM,SK3.\P*Of ,Urb~Dt K J|m*W**v9LrpNI,ğ%L| #?Mo/p*s6;lcyBKL{6(i-&ӷ9]>|zWd-|W9,). 5zrH3|/ cJ .s و)`gK 56/Qqud #QsM., ;*Mr7 :aHD 8LY"QR\U"o@XuLSچOM GָJnjz'iˁKPtfsjyii&P9B9Cd,T%=Oƚ3aauFX5NLsx4iɠlrT+g}Ht_LƼpe^#DMX74n!NT2h I5s٘(\/m3^wð-HWlv^!)sM_L_-Djˡ6dnZR[y!b{^0l'2Ό\"3WgIr&-9 18#Ia&#QY_аaeAVÞ̉iDKNyR0-IM["YY~b5V8ˀTP#Bu_9XSqݷyzyvvvʼn|Jkg>TH, 7~+3JS`qmsD0 y(谛U3,c;1 .:U gq)xeP?.21}R>\%Y`+3JΓ:IFYEɏ%jq. Rإ!ӭ= *`_ \NFG$27N'rPfZ E1W%[Ӳƈ2QNeFjFgbEj]v+g ޾:9N&oϏ(K$Cq`^"$KL|IHu$a>UX`*SG.4'Jf bDBQڟskf~H|4 u˰qdLBYIr59U73Q31dv3Ą95DB,hN0ޑh/RF?R/j13JhWh!;4Ҍ3JP>UpcԳFLiEyMvj%9!Ӗt=j6rF7ir&%_Mrn> .|ktE˚Q AS3.գ0@DR.LHx'ǜxϩ_w@!'&泘[p"6&ݏ &[d&<8xߒ^^Gxx\1Kᭈ1W0,[) cJAn+2* }85ccv^Ւ!b )Bb"ͅ*!C8dǏ][Ɇ[$ucS/m %QaL ":ϳi҅ӑgTV̀٤L* k}ud~6qstGTZ${x\ di%0&lnrN&V [Nw4=>Drqp)U~FсElN58M:Z–`҂MG \T-Ć dQAki ry l|KfiEƹ(=.|6g=9+.vMG;` 5ru;BE: s݊pL؅vʮc:^| Fz^@NX)c5H'_.`j3?8-}2O_h}38x<b4/31ԍ!םDc}^"p7GY셰#r* ߚ,:hq:_bc`aIƹֈ{RKe,1"$K`$5 b-m}yr0チ8/:rt<10.v5YkO<՟0}(FYmG 纶K)tnOgQPu;k,/伅Ehꦪ!.ԒH$Yz*+ow\qܽ&q+=oHI!KeP*1 ~q6~KDq(ˢ{љirF*!CʉvDp5t u8`Z2Zz\h?;QkycCٕ)W)0VqưV*"&2Ekr4ePf<ى?+cEO. 3=TɩϩfT)|_\OV6cs.AQT xac冡=+U&x'@CCBeMFvp .Xu:K!&4e@cO8is[y7e%  *bI=LJjV2ʏeu/I~L _ 5,Wǃ_gU͖%+.o!p:ꑃ'9,E -crGcZqM, ]Q}+=dAL UyD}A}`Dy|;Q݉ cSlqW: C>Bft3 &#[Gt:`ʙNYDݨ<2[Z B%U ~֦fns- "1LRe:$G8<.ƌiء:foiqC/|y/M0Z\s !lK;=ga| Bz"^܁9ù'GOC ?bOG&/29mya;mxٱ/dqn[iT}\*|Ei=&];g㷩6$w8<#B#X-=LkzE Gi)_dr7)]h2 T&=@GtT9N߱zVBZ NWYgM9^vS(Z ?h:y-d]"7J¥y?f[ܲ"q`eqn$OVYcū[etݪ#8)$-'S%{2kٲRj?..^x\dxx3Zk߅%?ʥjH@Hb#ؘxj^cbfʋT3X?T }_0vרfpy9|=ݩ˵uK;zlF[A: W||}z_!H mxf¬\rU<{DMϹ|Mizǫxש* 50e^/J^ <_泟(9sni~x"SNH<+Ezϒ!KEz;h3Q(.T*SkCX?.9OgX:TV^W -,a5K<#f Ւ2hWふǔ/L GݝNJWАnPQc*+1s7zw݂ FojgsuU)/V>7oЊJ㙯yy>tyjyl tj(HkRug'- 5^2\y6 2G6]}JA[~9>.:.@M X_a)|ςߢjwy-Ôz)x/f1Zc>ҳ; LOʋ0Ig\M'H .ƸTd2KW\i@.`Tg6Z2_bWP4:j^e`7]iu&1Nj.fm 0ˀ&^q<YٻF?\4@:䋦T,"jcKR eޭdcۀn2 Cw ,rI :4Q1Y;A9x1ydk͛nYsMR-zU#x'5&Hq՚MO]oSoο|ƈfGwٮguyG/t5־@.OZn#KX;: -ŨѭBʼn-j )<:s*V( tªm1;rضƇdTa NJ#6*xU- mX"as{M1L@xW%k0V^WYUXnF⚞ҵJ&$aMYk׃U̒^Y\>", g4A53\dBVU- ?Z]ֺb )_VMI"xUțQ3&4e 7^=1;άyNuYNc+yp>ZN^ =pVWöPe{ao騚>ݞNT#ln[5hkj_;V̶Wr[Q m}&5ٔZܰ]i`l]z\${ ,\$!![ [Y=thF9QA( B9Tr4W7|C=ySwJ"C?!*s8ZߺӦbRe)= qe1$mto]:GGrkt:ݩ J߬Q:(ikD'x㯓R%G?f"+*%U?cQmbu*h". PM>ˆD$F_vD9$a59Mm<ɵ*j{OՋUh2 @]WxZ~Ar_%Wʒ?D:!db8Cj@֭ l_ rQdV䩊U(QY)l9r' .%Yü;c8W ˸r /0˚m;EUϏ*لi2A#} z|!3Iyhx=CX]8sj8æ$qRFբnw4c-Lّ8ydWƨ<?!gQV * jٽŽPʦ'7z VvL5&cBd+D[5+E]K=AF)k#4)ûDc>_hC{ nY_Pti:;0l^RMLxrlo E5 nh\\,R t$ [-6b5u7eMM/u̸\Pل )Iy!A\ȾNpkD>_c.tgOܺzJm̀*m:7+s6vWg"‚ Ӎ&9ZjhZC߶E[UZ}RwnyҮD~<ưNv*O?o?Ƶ$bE(6 sa?,hn!9Fڶդ`5LGz|%|}deI/)0H9N֡Z2D(corߘƠ2YG{?pp~fx4ށ%}9p̄#$0uZFS?Xu{BrGJZ2%br&tvU0]wvd.h.^t;{;wZ7u{:va n˝q+Z}Tb$aS. _ΆfQ IǒFbTlāH$@aFRdzD\g&ljpCmJx6bݤYR܊dtȯRj6i'L$HM>o-|0땴1Bt[-VvrHwɦ%Ɂ\?n{B k'b- ܼTJIn mɴ@ĮY$hָèKLtT~e$,a  `mI2*x(!C r{0i ~P'g=u |ujbΎiGmo}L-F|螶Dou/*`4OlL9Ƨ2_ ď^^25$^ ^N;z ʼmF&^F~vʼFCҩܵk<"A 1} P)V;t*1*4dig'~ .-Ԫ KO%.NuG9tDT֩-%(qG C,'OR~,$nOV~9[Dso;FA;@]PkBKz=<"`ZLn3A=-c2È"Yf쵋 mV..t \}0_FC\hċxzP!YOBd6wu(„/{6TܸX;.Ee\}åK2 ̐nNÄgj'x+pN5%tS[/fOE 7khc92wf7NK9]wUin\FmϸY-3otT'Y452gWgګDڙ>@~{BO%Gk:LY$>Xz"Rɂ ӫv9Gb-EМtn3YԮ9H_$}wpXFr^xG<+#_"eD(U)b0'Ekkit.jKD_}G[%t𔅲_yrʏMZL'RG/Et(}Qxcv{Fƒh%G'z%d}:<+vʽU4[BA##@\س )s"ctQKguH5V5X=g!"~G/ǁCRYP:S;Z%?ʡ3+L9`@H77 lj^^6,_Q[gؤMG賎ϭzGn qX9sSx6 S~[X۝lFmFn\m}CRSZ7J<1`rx{l75*5XE_u.Ήls<(!8"0̯t<9~?lF fOp= S-OU]-2ʵ{3 LMK=2uG~SFR>?:T[>Ο/R8X=bQ .OOݽW}j, 1}Ԯ~ׯ3Z]LCO[Ay췇W]5sWoJ9kF4';|m_ɇ,CUYa';f Y7׽<᱃VCpor !,Wރˇ$pZl`[Q*ށ7Rty;=^m5w|ׯڥ