packages/0000755000175200017520000000000011517104606012275 5ustar tyndurtyndurpackages/diffutils/0000755000175200017520000000000011517104606014266 5ustar tyndurtyndurpackages/diffutils/2.8.1/0000755000175200017520000000000011517104606014734 5ustar tyndurtyndurpackages/diffutils/2.8.1/bin/0000755000175200017520000000000011517104606015504 5ustar tyndurtyndurpackages/diffutils/2.8.1/bin/cmp0000755000175200017520000072442511517104606016227 0ustar tyndurtyndurELF@@4Xr4 (@@@@<QtdS~U=@@t8v@ҡ@ut h0@!@@ÐUthD@h0@@tt h@ЃÐQSP UWVS] )*:5=t&[FvSZvgEE$D$ѝy$`@oj{")ċEt$|$ t$D$$@=@s& @sBwҁ@rt$<$Ná@$l$[{cÉ$蹕Ǎ")čt$|$t$$$oUtRPjj5@ht@jj{zvU@u@1Ҹ@UWVS(É֋8h|@EPjSW! tt@ov8u]u؅xݙ11 u҉؍e[^_ÍvUSÀh@u'ƀh@Qj4@4t@]O`@`@]ÍvUWVSƉ׈P$u9xYw^FC@Fe[^_Ívt#؈Fe[^_ÍvFe[^_^F?Fe[^_MF-À또U5@gth@h@jjà 5@jkth@h@5@jÍvL$qUWVSQ41Y(@@h@9 }؃ jh @h@SV bv 11$@5@h@*XZh@h@<@1ۍvPh@Ļ@Cu hh@h@hĵ@hx@h@Ύ 1eY[^_ɍaà h@h@@h@h@h@藎 w1eY[^_ɍaø h|@Wjj5@ { E؋U;$@r ; @ @$@:@@@@@:ȣ@a@U,@9L l@B,@9(;@ p@1,@9~2EB,@1ҍE#@Guѡ,@9 DžDp@ƿ;@(ۋDt5l@.,=3Dl@ֿ;@ t@1ҍ[@PRPt+t@4l@h@5@j DD@;@=@nEPjO=@HPh5@5@ ã@$@؉@ @$@ $=@E1@NGuDž,DžDž0@ #$@t+1҃$w9 s 1) $VS5t@ @QS5x@` @ Ћ Ћ@H< 1ƃ Au苅XB1؉1ȋ ILDž8111Ʉ8щv18Cu情L<L Zt\EPuuW3uI;M.}MuUB;F9E>u1Uą:2E1}ыEL @,@4@?e[^_Åqu5@E@,@ @-@AMu}̉} @$@9J9EtE ,@EM9M~2u A ,@;M:-uzt=,@} $@O@E)B;FB ;F U},@B,@;Mq]t>u Dx- U2PM 1h@5@J 5@u1}ыEL @UB 4@?)EE $@iuM̉MȸMy1}ыEL @EtMȋU uVF 1ҋE2&}:Y8WH:|x:?=@,@@uK,@<9Uu @B,@#C@9UU @,@u 46h=@5@\I=@}]EEt7,@M x- uPu 6h8@5@H @@,@4@?T1XVM 1hu@5@H$}w $M1}ыEL @UB 4@M9:t:}76h@5@HH@E\H;%{ u5@,@5@u5@E~<=vu=tEԋUԊUuu}+}}EEEEfEWuuSuI;MM؅Eu1h@5@=G;,@;U]u @B,@/} t7h@5@F@EJ?=@,@@?1U܅Et ,@M 41h@5@F@1эT @,@?u؋EE,@U x-UE0$v;UM @B,@@E؅@WGUtVE 0hX@5@E54@U1::L:Mu؋UUMME54@E8:t:}E؋xuLutU2M 1h@5@E@1эT @?fE@@1}ыEL @MtMU u؋Ve}؋w E؃xu,@9U~3M @B,@V} 7hX@5@\D]tu t6h@5@4D@׊EэT @Ujjjuu uUjuuuu ufUjuuuu uÐUVSME X @ x3vKgfff))A0хuډZ[^ÍvK ȉ֙0(Јgfff)uK-Z[^ÐU(@tС(@hҾ@h@jP$ZUu utUu utUuBtpUWVSNjpUEMˋUыEEʉUuuuuE11 te[^_ÍvEUW1e[^_ÍvUWVS lj։ːKtet [^_1 [^_fUWVS,u] }1$Pjh@h@o]؉fCU׃ Pu}-@PWuVP=@u7EUM؋9tqMtE߄u0EUMQ1e[^_øe[^_ÍEEfPu u^EUMQe[^_Ëutu e[^_ÃPuV tEESj0u/ tCt[@D$ED$$u˃1[^_]Í& tED$@D$$pmE @[^_]Ív'U)$`=@d@D*@&@ =@uÐUWVS }1=vl@t$$it&9{ul@t$$i$pƍ [^_]UWVS }1 v9{t+l@t$$/iu [^_]t&l@t$$'i$ [^_]UVSl@$ƋEh@Fh@11&@;Fwl@\$$hul@\$t$$iE D$F$Y^[^]jl@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$k\$D$D$ E D$E$l[]ÍUED$E D$ D$D$E$1 UED$E D$ D$D$E$ UED$D$ED$ E D$E$UEi`@A@p@Ít&UWVS,EUMI=t@Gt@p@ Eu&)ċE\$#D$D$$iED$ED$C$kE\$t$ |$D$$t&1 &p@\$$ftF;~up@\$$fE;u|;~t)&+_V떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$f\$ƋG 4$D$QhG $<$]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1$+$#]u]Í&U(E uu}}]EEEzp@t`$$É0E{C<$|$ƋE4$D$is \$p@$e]u}]%t&뙐U 0]Ít&U j0]ÐUED$x@$6c1tÍv'UED$x@$c1tBÉ'UWVS }1]v<$D$jt&x@t$$buԃ [^_]0$C${$sx@t$$bUWVS 1t&<$D$t.x@t$$2bu [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$e9E r݉4$et$$D$f&$e4$E e$맍vUE]utoU1u ]u]ÍvE $5e$JƋE $e4$D$E D$GfE tC$1s롸$tE$d$E $d$҉CthtdE$dD$ED$$eE $ldD$E D$C$ex@\$$"bx@1$C$$U]]u$\$D$$@o4$؋u]]É'U(]u}D$=E$¸tR+ueF)ĉt$E\$$~D$d3D$}$|$te1]u}]Ít&@eUx@$=^Ít&'UWVS,EEE EFEEE}&$bEF$b]]x;D$E$EED$D$EE$c|$FD$]$cEEEED$x@$^lED$ ED$E܉D$E$EE,[^_]'UWVS`D$F@$@x@$}u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$ha<$D$tt$<$Ha4$>aUDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt&@獴&UU S]G) ʃ) 1[]Ðt&@獴&UU SG,Ћ] ʃ)[]Í@䍴&UVSUMu t@@D@BH@Bt\1ۅt.@[^]É\$$@@Ht\$4$4u؃Hu1[^]Í&@@FD@FH@1[^]Í&1 t&Ht\$4$t\$$@@p֍&'US@]uu%@1[]Í&$ti@B$M@D$@1[]ÐUED$ D$$a1Ít&'UED$ D$$_a1Ít&'UD$D$$@.aD$ D$$@@a@t&M@=@@u@ U=@]]uu}} G~&@&]u}]Ív tՅt4@@C@C@C @C1t@G@G@G @G@1rfKUS]=@t=G( t#M @ @[]Í&[]Ív[뼉'US]=@t=GH\$$@@u@t$Ѓ1[]Ð1[]v빍@ U$nÍUEwE].t&]Í&'UU ~ÍD$D$ D$D$E$;1ÐU@]ÍU@]ÍUWVS1ۃ }9~t3L@\$$Wu@ [^_]fL@\$$W$ uȉ4$ 1[^_]Í&UWVS1ۃ}9~t3L@\$$Vu@[^_]f} tr} t} ft"@[^_]ËF [^_]Ë]F 9t!tD$@\$ D$D@$^ 1[^_]Ít&]F9tD$@\$ D$@$^1[^_]ËE cF[^_]ÍUWVS }L@1 f9>tlL@\$$pUu$Ƹt>L@t$$BWL@>P@FP@FF t&F [^_]u@fU L@tÍ#WL@@$@$@$Ðt&UVSL@t519pt#L@\$$oTu[^]Ít&[^]bf&'U(Eu]}t;$D$4$NjED$2t.]Ћu}]f@ލ&Et$ D$D$E $D$|$4$څt떍t&U(Eu]}t;$ D$4$NjED$t.]Ћu}]f@ލ&Et$ D$D$E $b!D$|$4$څt떍t&UE]uu}} #tEt$|$$t]u}]Í&]u]}]t&@ÍUEt&D$ ED$D$E $Í@Í&UE]u\tVD$ ED$D$E $8 t]u]Í$Xu@Ӎv@ UE]t&UVS u ]00 D$~@$(#0$8ft^ErtDaDED$$"t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$~@$h"@@됍&15D$~@$("uLvEwfvEwE+D$%@$!v$@UE D$RD$E$0ÐU$^ÍU]7U1]É'U1]É'U]ÍU]ÍU]ÍUE$_?<É'U}׉$]ÉuD$4D$UG!$VD$D$$$4D$t$$GG1G,w, O0tAG0G]GT@uT@G}1] US] D$~@E$t[]v@[]Ít&'Uuu]}} D$~@4$t%$]u}]Ðt&4$=tI$1=D$4D$<$RTGAGGT@T@G@농v'U(]]}} u$|$t]u}]Í&$D$}@tԋG G\$ D$D$$G0G$두UWVS1ۃ }u@t&9ljEtGX@\$$;Lu@ [^_]$@:ٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1fX@\$$KnU;uݡX@\$$K [^_]fUED$$D$Í'UVSu1 t&;0tkX@\$$Ku$ @D$_D$@$@1D$ 93CCX@\$$L[^]>&'UWVSE}}Et[^_]1&;8t X@\$$RJuމ<$1ۍt&;>tVX@\$$Ju1D$ D$D$@$@8UFF[^_]jf뿐ULD$[@$@X@ÐUED$@D$@$`@D$ 9`@U1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$@ v@UWVSrD1ɉ‰EE#E$BËE$KAStdfuC.C E\$$C11vD$xE$AtXC$EƋCt+rǍ&CC뗐t&$@EƉ떍F$EE$@uE#&tcu :F/<$mED$E$@t8_4$\$D$EƋGu/볍&|E$AE[^_]Í&$E$?D$E${@8$@@E$?\$D$E$AaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EEf@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$BҍUUE $T$E ÐU@$@D$ED$,ÍU@$Ít&'U]&US$@]t$D$ $É[]Í&]ED$$*6؃$[]fUWV1S }'@$st4$ t7@$t7 [^_]f@$u@$t1fʍ&'US$@]tE $D$ $É[]Ít&]ED$$J5؃$[]fUS@]U u$T$5؃[]Í\$D$ D$$ []Ít&US]$@\$$t@t$ 2[]Ðt&D$@$|4ؐt&UVSD$~@$@ wD$ D$D$4$5 Ƅw@D$D$@4$$@D$ D$D$$D$~@$@[ )wD$ D$D$4$ Ƅw@ZD$D$@4$6$@D$ D$D$@$D$~@$@ wD$ D$D$4$ Ƅw@D$D$@4$@D$ D$D$$$cĠ[^]Ð@@@@Ġ[^]Ít&D$@4$ @vD$@4$ @*D$@4$ @U1]É'U]Ít&'UE@1] U]B&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$<t$u\$ D$ @F$Ɖ]u}]Íu \$KS<$!/C $6/U|$T$$s<\$ D$D$ @F$tƋC $/뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$@C$ Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$@F$4$`딍US$]u$[]Í&Ct$ELED$ D$D$&@C$zD$Ë@ D$E$N:C $ӹ$˹E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$+1҄u뱍vC!C$N뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$8$wt&tyvC!C$:vK9Crt$ED$ $_8sY&{Cft$ED$CC$"8sv'U]]u$6U $D$T$ D$^$6]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$CtӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$)@$!)@@EED$ D$D$/@G$RË@ <9}sE<D$@D$E$6C $薵$莵,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$裻_utRu4ttG!9u܍f]v֍ovɍt͉$v賴G!9uIvvE<$ED$ D$D$/@G$Ë@<9}sE<D$C $'t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$1 )čt$<$19s@a<w%$T@vЃ|+uf<$19rE1ۉ$1UT$D$F$2E$p1t$ D$8@$D$U$w t Nun1ۉ<$e[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$0$貴FU$T$0$&蔴ËFCFCF C FCFCFCFCF C F$C%C$$GD$ D$$D$C%4$ϰv'UD$A@$E@Ít&UWVS] D$~@E$~C$ D$%@$N84$t$ D$D$<$uN@D$D$0@$4$ $@ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$G21[^_]á@D$@$%@e@D$@$@<@D$@$4$ @ &UWVS,E uD$E$FN^V!EFEFEF EFEFE܋E؋GFGFG F GFGFGFGFG F G$F$_W!OEGEGEGEG EGE܉GE؉<$ ,[^_]Í1,[^_]ÐUVS0]uD$@4$r,]$t$D$ D$D$$O$wf&'U$~ÍU@tED$@$=*1Ð*@u@É'UVS1ۃ@uu!&Ѓ@\$$'uu[^]U(}}EU u1]]EUt\$t$ $T$4EU\$t$ $T$)]u}]ÍUWVS,E ]Ex@E܋EuET@E"w}U܉1&MD$ $T$L$2 u܋E1EUfE}|$ $T$D$}E}؈D3uɋE,[^_]ÍUUE tE BE]ᐸ]É'UWVSEU }EUHt!EU}E BE[^_]፶tOE~>11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$"~8$t 1҃[]f[]Ít&'UWVS$蛭1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y|l@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&U(E E@E@@ED$ED$E$LÍv'UE D$E$ÍUuu ]]4$f9~tu ]]u]9u EUE $ÐU}MU EtÐD$T$ L$D$p@@$AU $]t$u |$KA9rS׃r9w)uD{t&$t$|$]Ít& {܍UVSE0uEE] EuD$E]E@ED$E$x9v0[^]Ðt&UED$ ED$E D$E$zÐUED$@$Ðt&UED$@$w1҅t $U]w&UED$@$71҅t $IU]W&Uuu]u1ۉ؋u]]Í&4$u$ t$ D$D$É$"UFu u0]ÐUSD$ D$D$@$t@ MZ$G؃[] UED$@$D$ E D$8ÍUWVS E}D$@$U v2t&D$@$U 9߉w݋E  [^_]ÍvUWV1S1ۃ }E5&$脐t<U$lƉ<$j9wƉ<UE [^_]ÍvU(uu]}4$vǍ")ĉ4$\$|$\$E$\$4$ ËE$轑؋u]}]Í&'US]$\$ D$@$D$[]É'UWVS,]D$@$EU)čD$ET$\$$lUE$EtD$$Ue$ݐ$@$)č\$t$$TD$@$2EE(&D$@$de܅e܉<$|UƍD)č\$|$$3/ED$D$D$$u$($=E\$1ۉ$e܋EetjU$ƍx@#)ċE\$$D$QU TE$菏\$ |$D$@$t$5e[^_]Ív1ۋe؍e[^_]ÐE$ft&@v1ۉ؍e[^_]ÍUS$@-$B$@$D$@D$@$@ UT$D$$$@ D$ \$D$D$$D$ -[]Í&U($@]uu}r 4$h D$|$@N $D$@D$z4$2 $@$ WT$t$$N$ \$D$D$$D$ o]u}]fUED$ D$D$@$ÐUS$]U MtCu $1[]Ðt&UMEEEED$ D$D$@C$襣$[]ÐUE]P?0Í'UE]P@0Í'UEPA0]ÐUU ERP0]ÐUMU]] uuQRS0 MEUN]u] UMU EQRP0 fUMU E]QRP=0 Ðt&UE UPR0]Ít&UU ERP>0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$舍D$$FFF D$D$$ ta$ EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ@EE؃<[^_]ÍvEE@<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$ \$UT$M܉ $4 \$E$FU F$E] UMV~HU1fC D$CD$EE$MC K9}MƋVT$D$U$F D$$ 4$UE ]u$tD$E$^$]u]ÐUWVS ]f$袅u<+E<-<0E}1EmfB;EJ~-$躅to$ˆV;E\$踆H)ʉ}9}EE{ƍ4Ct"$:u$Ku߉M tU :Uth}-@ [^_]Í<0C.If a FILE is `-' or missing, read standard input.SKIP values may be followed by the following multiplicative suffixes: kB 1000, K 1024, MB 1,000,000, M 1,048,576, GB 1,000,000,000, G 1,073,741,824, and so on for T, P, E, Z, Y.SKIP1 and SKIP2 are the number of bytes to skip in each file.%s %s differ: char %s, line %s %s %s differ: byte %s, line %s is %3o %s %3o %s -i SKIP --ignore-initial=SKIP Skip the first SKIP bytes of input.-i SKIP1:SKIP2 --ignore-initial=SKIP1:SKIP2 Skip the first SKIP1 bytes of FILE1 and the first SKIP2 bytes of FILE2.-l --verbose Output byte numbers and values of all differing bytes.-n LIMIT --bytes=LIMIT Compare at most LIMIT bytes.-s --quiet --silent Output nothing; yield exit status only.-v --version Output version info.write failedstandard outputinvalid --bytes value `%s'cmp %s %s %s %s %s %s %s %s %s %s bci:ln:svmissing operand after `%s'extra operand `%s'/dev/null%*s %3o %3o %*s %3o %-4s %3o %s cmp: EOF on %s print-bytesprint-charsignore-initialverbosesilentquietversionhelp--help Output this help.H@H@@@@@@@@@@@@@@@@@@@h@@@@@@@@@@@kKMGTPEZY0Copyright (C) 2002 Free Software Foundation, Inc.Written by Torbjorn Granlund and David MacKenzie.@b@c@i@l@n@s@sƹ@vι@<@ @P@@̷@@L@@ӹ@(GNU diffutils) 2.8.1Unknown system error: %s%s:%s:%d: %s: This program comes with NO WARRANTY, to the extent permitted by law. You may redistribute copies of this program under the terms of the GNU General Public License. For more information about these matters, see the file named COPYING.POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: illegal option -- %c %s: invalid option -- %c %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument memory exhaustedxstrtol.c0 <= strtol_base && strtol_base <= 36^&@v%@v%@&@v%@&@v%@v%@v%@&@v%@&@v%@v%@&@v%@v%@v%@&@v%@v%@v%@v%@&@|&@v%@v%@v%@v%@v%@v%@v%@&@3&@v%@v%@v%@&@v%@v%@v%@&@v%@&@v%@v%@v%@v%@v%@v%@&@v%@v%@m&@ A?CWDGET_ENVVWarnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt lrwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %d..:/%s: errno=%d console:/stdinconsole:/stdoutaconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/createx@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@w@x@x@x@x@x@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZ5@0@0@0@0@0@0@0@0@0@0@0@0@0@#@#@0@0@0@0@0@0@0@5@5@0@0@(@0@5@0@0@5@݊@O@O@O@O@O@O@O@O@O@O@@҉@O@߇@߇@O@҉@O@O@O@O@O@݊@݊@O@O@7@O@݊@O@O@݊@C@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@C@B@B@B@B@B@B@B@B@B@B@K@B@ۏ@B@B@@__Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK telldir: Nicht implementiert IO_ULINKlwIO_LINK zR| b'AB E<L_AB E @?GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@f@';@@Px@ +"@>"@ D#@C"#@2$'@B%('@)%T'@ &`'@')(@'-*@342@K53@.{6@3@>,73@e;9@+>;@=@=@gTF B@!FPB@MmLH@ytimer_cancel8timer_callbackytimer_register=@rpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*TFnsyscall_psyscall_vFagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvarsmL7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killdupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreat%yYgetppidgetpidi,ZchmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstatG_vwaitpid,waitXwait_child_addqinit_waitpidcxstrerror'RdZrpcsend_messageenyieldR0f,io_split_filenameio_get_absolute_pathZio_split_dirnamed\mget_pidget_parent_pidcreate_processmdestroy_processget_cmdline"onset_rpc_handler#oyadd_intr_handlerJEpa)vfprintffprintffprintf_putsn+fprintf_putcs}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#w Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen65_exit2abortGatexit{exiti 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintfF0vprintfcprintfprintf_putsnprintf_putc?a_assert;~]snprintf_putcvsnprintf!snprintfPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read ]ysyscall_timer dinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name%lio_seekV(create_shared_memoryopen_shared_memoryclose_shared_memory Fysyscall_putsnqmmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6_nwait_for_rpcv_and_wait_for_rpccppb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvdstrtollist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createstrcspnostrncpydstrcpyLostrdupostrlen(ٵQd__strtok_r strtok*omemchromemcpymemsetrunlinkȺoaccessY=seekdiryrewinddirtelldirreaddir3closedir_opendir4P io_remove_linkio_create_linkN__umoddi3fQ@@q@h"intXI5Lf7e~t]p(e 'eoy.Z%1H id2# 3# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFzpH` I3c-vl3d@@k@@q<7IY+, 3! vt@@h"intXI5Lf7e~8wt]}lp(e 'eR(e)e(e)eC*e+e,3m-e.e0~y64`Ja#(b#c# d# e#f#g#i#Xk # l #$\m #(In#,o#0B^%`%#f3##g7#valh3# + 0o 3.Z %1id2=#3#pid4#.5=# 7#8#>9#:A#4<#A=#! 0 AO>H   F);Q] 4u #Y/u &4R]x- ]Qrt@@2q%^q%|@@td@1@cc90#valAoaarg%eY 4@y@f3 h@ `@{z|@@0bufy\cyL@i@k \- [3n [% DpD J %cmpn3+\opqorurbstu+v+wx rety3 fz3?{3!'w"!P ig" r"!:11%%!^%ZA" c0L c1L s0H s1H" c0L c1L":1%" s0 H s1 H #0A$ )#0X$%5&p04&p14';4 l6 l07 l17 c08% c18% cnt9L: i;3  %aK&p0`&p1` l0b l1b c0c% c1c%(3l@@2 ` 3uc5c3f3)/3)Ð*+ntX,-@R@-@R@.:/@@ 0arg * . 0f13f*8X T55~1OP\ 23a3m3yg332 3 3 .....34 3 *D 3Q *P3 3+ 3I 2p43 24_4Z1t 5523 3) 34 .?* 4bD4n3z 3 /- @Z @ ..2.3& 4Z4_6X55u5j2839 3 3 3-.3@33.*Xo 3,L2x38j3D23 2.20s0F0s1G~#A $# $#0 $17* @ #0 $17e- @ #%, $7#< l@#3M $7a?= t@#n $7B^ @#+ $7HE @7H@7K @7N @7Vd@7YA@# $ 7ka  @ #0+ $ 7z< |@  #%Q $ 7(b @ A 8.8<38 Y38 7  )8& 8 8b  93#0 :8  8C0  ;9@SIv@@855oCQ@%t#@@9h"intXf~t]yv{o|3@@   3 d d @@ 3 d dp /@pe/@Y3b_3>q{y#@@h"intXf~t]p(O"]yod@w@L adx bd d@ lcmd md nd qd rdUdx@@ fdT3 bufT* TdJ bpVj W}Xd\d ]oY3P#@x@P!0F:oh"intXI5hf7~t]p( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O s :;@c@ 2OO7p%Jv,@Z@5@Z@j@d@ @25O5Ol5\66pB% hG@XH @| @x@42OOp%`7$ k&8$ AK@ 7 H@!(1O@kTx v#x@x@h"intXf~t]bv(@3SL#x@x@855oQ@@%}#x@"@oh"intXI5Sf7l~t]p(l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K B^`#f:##g#valh:#  % :    ?x@@t strئchr:R9@@8:: ;:tdtop<:)tem=?I len_:i`:rPlenp:iq: ?#` :?  ? :@c"@` :V? W   ::tpIc%?",?p-./:0:)61:2: ?ap: :z 6: :z! BaP:d"@"@! ` :  ?!?@!@!m?@!`: @!:$@"&8z V#p?@#:,@#I:0@#:4@#:@ #"@"@ B^j`j#f|##g#valh|# puoint|h"Xf~t]yu X|"@"@&"2 ` S| T2 pUj kV= W8C B% H|"@"@R" ` C| D2 pEj kF= G; #"@A#@ h"intXf~t],3y"@A#@~"id"buf"p!#o < #D#@#@ h"intXf~t]p(OyF CD#@x#@?#, jox#@#@k#nid#sid# pko# _o#@#@# p^o!$n^dc$4 Qo#@#@$BnPd$ pRo$ bO 3  Q ;h(@T~~o  ?Ҿ@nL  ##@'@O h"intXf~8at]}Voyzu#/u& c3#@M$@$ xb% b3B% dothok m3P$@$@U%S xl% l3% x l3%  z$@'@&1 sx13& ptrx<& x3& valy y1' ~ {dp|<x'tmp}o'$@$@q1'x 3'3(b 3(7z43 = #'@''@N h"intXf~t]p(Oy "'@''@(n!d)o  #('@Q'@ h"intXf~t]p(Oy &('@Q'@Y)p$)n%d)oq #T'@]'@S h"intXf~8at]}V WoT'@]'@)ptrV V V3 o 2 `'@(@ int~]ohf"Q %P , X t  z   u m ) low`# `#  s llv e  X M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww ! km1km0k _`'@(@*n^J*d^j*`A7-LWbm*x*'+i+,B,`,t`'@'@,(@(@,,P (@u*@h 4AAc3Aint 9Adc8A  AcA *Ac)A4 HAcGA MAcLAd(@(@-v %A(@(@?-c$A(@(@k-; -$ /A(@(@-ec.A%)@)@-7H )@?)@%.Z >A@)@n)@Q. c=A}.< CAp)@)@. cBA.)@)@.)@)@/3 RA)@*@?/ cQAk/ )@)@Sv 1 H)@*@S  WA *@7*@/ cVA/, \A@*@U*@/ c[A0 aA`*@u*@ 0 c`AL0;'i E x*@x*@7@intW E *@2@h"intXf7Z~t yZ]p(Z) I J# K# Lh#Mh#  Nh# OM#| OM YM# ZM#p [# \Z# ]h# ^h# s3 z3   s cO nz i3    ptr 3   3p ~ d s1 s2d nz k k x xjqoZ 8  s c3 nz i3 *@*@k0$ *@3,@0ptr0minM1maj91-hhm1S*@*@`*@+@m +@;+@~ +@;+@1+@+@ h h ,@,@! @,@-@1Z"h1#sth1 maj ,@,@$2%m~$/2& >-@1@X2' =z2q ?32 @a2pAT3hBh}3majC 4minDM4 EMn5Fz5`-@ .@ZS.@.@P` /@ /@`U/@`/@p0`hDh'6`/@/@L0@0@hhP6&  1@v2@n6p6'z6ptrV7minM7l  z7Ph.h8SN1@S1@0`p1@u1@m( hqs.$$7BM&8X:8`2@2@i`N2@X2@^&-  2@2@N8'  zz8' z8l 3p8 ~2@2@2@2@)R* bP@*v cT@+a eM,3* f38@*H g:X@* h:H@* k:@@*T l:0@* m:8@- q.A ' 2@ 3@|h"intXf~t]p(OJ %32@ 3@8s1#8s2#/9n$de9o+Y ' 3@>3@h"intXf~t]R +3@>3@9p*9ch*39c,Qob ' @3@~3@h"intXf~t]k *3@3@~3@9s1):s2)]:o5 3@9@Zh"intXf~t]p(O #d3@3@|:s": "d:len$d:  o  /3@B4@;Cn.O0;s.CP; .O|; st0IKi1O;y;O; t5O YY  ]P4@4@<str0<r 3]r<E3< c 4@4@<strz  34@4@<1s1s2 4@5@= ɸ==ends=˽] ̽_ ͽ^neg3={ 3=outb5@ u C  6@ 6@=  end    6@@6@>K end EV@6@8@=> Di> D> D3 ?FV]?negG3#@out6@ 38@8@C@s 18@9@o@1   3ym_9@;@h"intXI5Lf7e~t]p(e 'e0Zzo y , -# .#   /7k9@:@@ jZ@jZBAjbAil3AqZArZupe:@:@:BZdAfBdAF4:@;@B4SEBELGdiHZBHZB)9;@;@ C^i:Z 6d@4`@  1`@  '2@_;@_=@h"intXf7Z~t]p(Z'3!(#)o# *zo  &'#(O#  a;@4<@9C2 `OeC$b2ic3C O@<@<@Cy NOC$P2iQ3D,O<@_=@/D +[D+Oid-OD52D$<2i=3D#l@$Oh@1_=@B@ph"intXf7Z~t]p(Z 'Z0|Ooz 3 pid4O# 5O# @6o# 7z# 8 '$ 3!(*# )o# $ *Ao Ltpids|sOu3`vr=@=@Dpidp|pO`q;b=@!>@Dpida|aO`a3bS0>@a>@EgpidQ|QO`ROWCp>@>@DEpidA|AOlenAoB; A>@>@pE)>@ @@E{pid|EI;E@oF;%FOQF{`Kg\roF}A H!81@@*@@Fpid0|I0;@0o0; "`2!z;0@@@@F#pid|F$I;F$@oG$;:G%;ZG%`mG%iOG&3@@A@Gpid|GI;G@oG;H3?H`]H&2O A@yA@Hppid|HI;H@oH;IO2I`߉PI'LA@B@yI J|IJOI@KoIKz1J`MNzQJ(3Ot@):*'.p@0t B@AB@h"intXf~t]o B@,B@dJ 0B@AB@J|36PB@H@ h"intXf7Z~t]p(Z 'Z3pid4O#5O#@6o#7z# 8 o   '3!(#)o#   *y(V)#*#w+1 PB@vB@J3J͙ V B@B@K34KnCB@0C@TKBKiD3KE0C@C@KdLi3)LGL C@C@eLLLeC@MD@L dLdo&Mh^M p3PD@E@|M_MM,3N,ND@D@d &3E@E@JNvN3NM#3F@F@Nstr"Nsep$N.oO/@3F@F@$O T\F@G@PO!pidZ||OZOO"Zo"[z #`]zud#^ouh#_oul_oO$i`3upa 6G@H@OU=|OH@H@AUP@H@H@>C.P0KLLP #-lx@ %Y3KH@N@h"intXI5Lf7e~t] 'ey #A k   3 #x#J3#0o3H@H@_PssP3P 3H@9I@Ps#Q3YQ&3@I@I@Q%%3Q >3I@J@Q^=3)R=kR=sRi?3SosJ@J@:S/nsfSidpZ@3J@K@Ss>3 K@EK@Ss3PK@K@Ti433K@L@,Tcsig3XTcToldrT i 7L@L@T3&UsU)H3M@qM@UG3U[ VgM@M@(VS{M@M@TV<z3Vk3M@N@Vw pidjzj3VG!+w@!,@@!-@)"Y39, N@V@EP!0F:oh"intXI5hf7~t]p(" 'C*,Oy.v%1uid2# 3u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  *     ' 3! (#  )#    *z'8 (8#fd)O# 4+O# ,O# dupO N@4N@VkfdO/O@N@TN@#WfdOOO`N@N@OWfdO{WTiOW )ON@O@WfdOXcmdOXTXiOYdO@O@sap%argOYYO@O@ap%argOlYPOO@P@YO8YT\Yi]OY=:P@P@Z ~8Q@RQ@3Z7fd}O_Z!TiOZ`Q@ R@ZfdOZbufZ";["`=[##8u[#[ret[ $tR@R@[ZfdO\buf&\";F\"`f\##8\#\ret\nR@4S@]fd~O/]"`~O]"~O]##8]ff@S@S@^ fdeO>^Hee##g8^^oHS@T@|^fdGO^"HG^"G _##I8P_#Qn_g8 T@,T@_%fdO& ':O0T@U@_5$_MO=`(ls`fdO`##%8`)Haf 8`U@0U@|f8 a*`f85a+:,-:OU@V@ta5$99(0L@ (3OP@.N68.78.&88. YO!V@9V@h"intXf~t] 'Oyo 1dV@$V@a'd0V@9V@a!N@V@)Y@h"intXI5Lf7e~t]p(e 'eR(e)e(e)eC*e+e,3m-e.e0sy64`Ja#(b#c# d# e#f#g#i#Xk# l#$\m#(In#,o#0o.Z%1p id2#3p# pid4#.5# 7#8z#>9z#:A#4]4|  !43@V@GV@a 5$3 3   C3PV@WV@$b #B3 B 3`V@jV@PbN 5$ ޾ ;3pV@zV@|b 5$  A V@V@b { U3V@V@b  ̾1R3V@qW@cDfQD,cQJJcposSshc   H3W@W@{c#3cJcfD d 6y3W@X@'d 5$xSdxJd2z3d#{D e X@X@dir )e | 3X@)Y@Re5$~eJe3efD fX@)Y@buf}'(T@ Y3D#h0Y@[@vh"intXf7Z~t]p(Z 'Z'3!(#)o#  *o y o )  pid*|#[+ #2,3#) BCCpidA|iC3oDC nvpidm|io3opC|0Y@.Z@'f&pid|Sf2&fp3foCgHY@kY@#x.,g7IY@$Z@VaJgj 3c|0Z@SZ@hgX2&T`Z@Z@gpidS|goVCoutfZ@xZ@Z@V#.g7z[@[@ hqpid}|5h}O}oh~zhoCh K#.h7!#.h7"9[@[@i#0X@ $Y3?%\@0\@h"intXf~t]oyd*r\@0\@=i)3+`@d ? V%t0\@\@h"2>intXf7e~t]orpc"0\@K\@iipid!Zi #ZP 2>P\@\@iDpid0Zi 0Z j 0Z+jlen1ZKj 1zvj 33P :Th ZT D&t\@\@= h"intXf~t]o\@\@j(&=\@pe@t h"intXf~t]p(Ooyo'3!(#)d# *  &  b _ 2/ 1&2#3#5&# o6pSpcwd}Nvn3Sp3pcwd}Nvn(3i)3FvDlenEdEENGv ohi\@^@jhjShp kh3*kjugposkIknluhmulNnvk@Vwdk `!!!!x"#]@8^@(!!!!"#8^@^@[!!!!"$^@^@!!!!")%}^@_@dl&lNv'pl( _@_@'}l'Edl@Spi3+3Nv)Q:dS9p;di<3N=v_S]pH]}I^ib3Ncv%<}_@dc@lZ&+mNv*pudn3'dm'z}m+6`@U`@r!C,Nm"Y"d-|!,m,m",n,/n-X!x, cn,)n,4n+@b@`b@!!R"^,jn"t.nb@b@!!!,n,o/"}pc@pe@%o&Qo'C$}qo*Spul'do'Nvo-@ +!R( "^,jo"t.Vd@d@-!!!X ,p,+pM)tpe@e@C"h"intXf7Z~t] 'ZR(Zo'ope@|e@>p pid(ojp8oe@e@}p pid7o 9opVoe@e@pm {TO uidTz pT Uo pidWop ke@e@pze@e@'q {Sq*te@f@"h"intXf~t]oe@f@fq@*tf@#f@%#h"intXf7Z~t]o!f@#f@qZ O]*Nu0f@g@#P!0F:oh"intXI5hf7~t]p( 'y.v%1Tid2# 3T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O :  O  O  :0   v# D#arg#h##fp$## k'4O0f@kf@qfp3#3ap3%p5 tX6h(<Opf@f@qfp;#;ap=%=>OP/Of@f@r%arg.%BrC .brn.Or  (Of@g@rarg'%c':r,u g@k@w$h"intXI5Lf7e~t]p(e 'ey.Z%18id2#38#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 3  g@Dg@sYoPg@eg@/s3pg@yg@[s d3g@g@s,c3sg@g@cs>u{8g@Rh@s 8tpos3Ktc3ito 3`h@h@tc3th@h@cs>u{3h@ i@t neustrYWuj3i@{i@u7strYu/i@k@u~ 0'v1~~2z[v>V>V)@N$@%@&&@Y3 -uk@|@%h"intXI5Lf7e~t]op(e 'ey.Z%1?id2#3?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#5Z#@6#7# 8a 7id8#9#^:#;Z# *<?Iid@#A#^B#CZ# DI# AX KEOyidP#QcUidV#W K)  z& zres {K# |#%5 Vt2%13E%k@k@vc8l@l@v3l@!l@v!_30l@9l@w5$^3@l@!m@4w_`wH?w3w "_ ?out8cl@ *R30m@[m@2xQ M3`m@m@^xLHL?LoG3m@m@xFHF?cm@n@xsrcxy^y=yiyyygn@n@y  A  X|3n@8o@y7y-z3@o@o@Kzuwz yp!3o@4p@z"z#Z{hs@p@p@-{gY{ npos{w{ ]N3p@Jq@{dM|`Ms;|M3g|$ Pq@sq@|q@r@|| }^+}x}}i83r@Bs@~:%str77>%3Ps@s@0~c$3\~$&ch&zu{D3s@s@{~c3~~E!t@Uv@ " ?""^"#W \' ( )' *,  u@u@*i3+EF3`v@v@/ E[,cGz]?v@w@u  \?݁E\3\3,i^3S,c^3q!vKw@y@ "5$J"Jۂ-L?up.msgR +SE*iW3#~;#Y/ +"_ z 0y@y@|l3y@{@σ kk Hm _nKo,srcqQ,dstxz/ E A 1!l{@|@M """D&#T\+V-<-@-'.Z@-/@2&82 Y301u|@}@)h"intXI5Lf~t]p(Zoy'3!(#)o#  * e|@}@z d3 msggd IhzV2i,A, 3DE }@4}@Ņ*M3@}@}@sLus 1}@}@ 03I}@}@i43t5u 8(@Y3 1u}@Փ@O*h"intXf~t]P!qF{o3 d {3 d 3 { 0  # D# argd#]feJ {0 )3:(OV{z  u  # ]#}'|buf||O2V}@D~@1VS1O[13Vrem4OOLP~@ @<.KVhbufKuKOŇKOpMuXN.u`OVPO=[QOup 3@7@Pmpm|c{r3@@@܈pmC (n3H( i3Z3 3@%@Ɖ! "3#-0@`@.!,Z$ap,f܋%.ud"/3c%03ul"03"03"138"23w&i33ō#?3`@Փ@ !pm!G$apf+&t"Z3"M{o"F Op"!O"E"O"3#O3'$O"h%3C"&(H?`@)H &ret23ȗ)` &ret=3)x '"C ;) &len3&pad3=) e&ret3M*Œ@@&ret3) &ret3*@х@&ret3W*G@I@+ret3P) &ret3,x@@&ret3,@@&ret3K*L@@E&retX3)( -bufl %m])x &ret~3Ԝ. }/01]) +buf "U3)  &len3͞*b@x@+ret13P*B@p@!&retH3o*ۏ@@?&ret 3)@ Y&ret#3̟*`@@w&ret?3 *@@&retC3J*@@&retE3s)X &ret-3)p &ret3,@œ@&ret)3%*G@l@ &ret^3) : ":) T "Vۡ*H@d@r &retS3C &retY3w) &c{( &ret3Ԣ,͋@ڋ@+retc3P2{ 3 45{6 B,{4Ou@@-P!0F:oh"intXf~t]yO :O O : 0  # D# arg#@<O@@c;ap;%Y=l)CO @:@JBapD%=EOP,O@@@varg+C +n+Oأlen-O%O@@arg$c$::5u@ߔ@Z.oh"intXI5Sf7l~t]p(l 'ly.a%1?id2#3?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K ('@ߔ@Y 0% #% 6%:ۤ &:  % &8 VzP6xu@ؕ@/h"intXf~t]p(OP!|Fo3 o 3 o 3 0   # D# argo# D "W H#W# q$d# Z%d#c)3@D@&arg(Rc( :C3P@@ʥ!HBWBd!BLapBqlpD dREX=F3;U3@ؕ@HTWTdTapVq=W3Pu7u@@/oh"intXI5Sf7l~8~t]p(l 'l0y.a/H%1`id2#3`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l %&# '#(s#_)#*#[+# %  -$!!C$#' l -%*:P)!@@˦nC@0@C$B'#DC) w20@9@aDP@@p@?C$O'dirQ!٧F@Y@Q)e2_@l@S>:p@y@=!`==:0@@#/!O5 8t@@0h"intXf7Z~t]o !@@ O O09p@@1h"intXI5Lf7e~t]p(e 'eo 3 pid4Z# 5Z# @6z# 7# 8y HJE KE# L3#@ Mz#D INU#H U? Ad63@Q@Ϩ2res3`3`@@,devzQ@@XSpؒS` zĩpos33@m@p. Y` 3uppos3l)cp@@p` 3supret3 %C@'@QBl0@t@;cmdk#k3Xpidmpzuhwq;@rulDz7z˫J@ ޫ"Ydirp .z;h J Y h wX@)@dW3YmsgZ10@@02msg3 N@@pidM:ho @@2h"intXI5Lf7e~8wt]p(e 'ey.Z%1Cid2#3C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI#`Jl#K3# Ld V) _. @@ - `-lV -3 R/d;t@@O3h"intXf7Z~t]%zoO@@O idOíz@Ý@֭ idO o Н@@ idOa<t@ @3h"intXf~t]otd 3@ @AnOsni<3t@מ@4h"intXf7Z~t yZ]$h%o&'#!(z#{) !  O M O ptr" @Q@m.  h&1`@~@0OM0O ptr2 2 pB7@@Ů6O6OM6O ptr8rG3@@3jFFOHO)XU@מ@0jTTO=t@@4h"intXf~t]o@@\ @@,>@@(5h"intXI5Lf~t]p(Z )3 'Zo $    ) *# +z# len,o# e /& num0o# P 1&#5 / 4z ppb5z# 6o# 7o#  8o# v QoldPPo PonewRA; >b?5 Y@l@Yppbzo-`oMlenovoi3Q)X 3p@Ɵ@Ӱppbzo*i3R` 3J П@:@]+ppbzo+` 3 i3Qarg 3Ա b3b` `alenao  co d3newe!"""!#$3bshm3 opi3 L 3 `z 3@@@99bUshm3~p9% & #%1"a"V"K"B&0'lӲ#w#(y@ۡ@k"""&X#)p"&##'''/'O#? @@o*#Ţ9shm3retȇγ+Y3X@ E @Ф@6h"intXf~t] #]@Ф@str"  " "3=$]Fb %3zU& '3ѵ o Y3@b!!Ф@@#7h"intXf~t]p(O'3!(#)d#( ##$o#  *q !NФ@@ SM&)  !Vd@@E7 SUq ! @@ S߶ 3R!n3h !o@@ S 3ݷn!ݿ!o@b@HS<3r on!&E!(Ѹ O!op@ܦ@ S1/!ogs!B@ @ SA !@@ܹ' S 3> ov!x@@E! X!h@@ֺn Sg goDNm !6@@dS7!+@:!,3@i!-@NB"' @ڨ@.8h"intXf~t]p(O!&zy!%d @ڨ@s$"$ܻs1* bit+o tbl,Lidx-3  o oC"' @1@8h"intXf~t]p(O "*@1@-dst)Ysrc)n)dӼd,Qs-R o  C9"' @@m@9h"intXf~t]-"#@@m@to"@(""_4"$o DB"' p@@S9h"intXf~t]p(OK"&p@@str%len'dR"( o  DW"' @ީ@9h"intXf~t]p(O`"$d@ީ@str#3s%R oM Eg"' @@:h"intXf~t]|"2@@Rs1~v"1"1.p"3ftok3c43sc43˿ "@ o   "`@@޿ s_v"_"a@E"' @@b:h"intXf~t]p(O")@@ s&6c'3nn(dp+R    AF"' @@:inth"Xf~t]p(O A@@":":E:d;dstBsrcCtDd"}@   o   &G"' @n@P;h"intXf~t]p(O"#A"%OyA <@n@":c0:3E:d/ t=dZ c?z dstA oG"p@y@;h"intXf~t]yo"'3p@y@(5$'kH"@ݭ@<h"intXI5Lf7e~t]p(e 'eyo.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K "&3@ݭ@T %%3f)dir-  V dY3I;#@@<h"intXI5Lf7e~8wt]p(e 'e0~y.Z/A%1Yid2#3Y#pid4#.5# 7#8#>9#:A#4<#A=f#! _o AO> #!#"S#W### _  DIR&l%"&"# '#(l#_)#*#[+# _2 -O#t@@ sdirss`s~ %#i@3@5dirhs"]~@@V@adir\s"C'`@@'dirBs#D-/#J #P'+ w 2^#53@ @I_dir4sG#*s@@u) _+J$ @@=h"intXI5Lf7e~t]p(eo 'ey.Z%1?id2#3?#pid4#.5# 7#8z#>9z#:A#4]4K  Z#[##\##^z#_#  a$`dc#d##fz#g#  a#h #3 @@#3&>$?ul0$?p#@v##zzH  V  a  g#33@@#1 #1ZK$243$5v#60$G?>$H?=#O@#-@#"@@@#mz|nzHor)  a Y3>K2 @@K?int~]ohf"Q %P , X t  z   u m ) low`# `#  s llv e  X M nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww ! km1km0kT$S@@uRvRwT(VA7-@LWbtPmx't ,@0@I@@g% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I  : ;  $ >  : ; (  : ; .: ; ' @: ; I: ; I.: ; ' I@4: ; I.: ;' I@: ;I4: ;I .: ;' @.: ; ' @.: ; ' I : ; I.: ; ' 4: ; I.: ;' I 4: ;I 4: ;I! " #I$!I/ %.: ;' I &: ;I': ;I(.? : ; ' I@)4: ; I* U+4: ; I ,1X Y - .41/ 04: ;I11UX Y2 U341441 5161UX Y74: ; I 84: ; I? < 95I:!;4: ; I?  % I!I/ $ > $ > 4: ; I?  &I% $ > $ >  $ >  I&I.? : ; ' I@ : ; I '  I .? : ; ' @ : ; I4: ; I4: ; I 5I4: ; I? < % $ > $ > : ; I$ >  I&I.? : ; ' I@ : ; I : ; I 4: ; I 4: ; I 4: ; I4: ; I U4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I .: ; '  : ; I 4: ; I&I.: ; ' @: ; I1X Y 1 41.? : ;' @: ;I : ;I4: ;I U4: ;I .? : ; ' @: ; I 4: ; I? < ' 4: ; I?  !4: ;I?  % $ > $ > 4: ; I?  5I% I!I/ $ > $ > 4: ; I?  &I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I  : ;  ( .: ; I@: ; I: ; I .: ;' @: ;I4: ;I4: ;I 4: ;I U4: ;I U.: ;' I : ;I.? : ;' I@1UX Y1&I.? : ;I@ : ;I !4: ; I "4: ; I? < #4: ; I?  %  : ;  : ; I8  : ; I8  I&I$ > $ >  .? : ; ' I@ : ; I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I4: ; I I% $ > $ > : ; I .? : ; ' @.? : ; ' I@: ; I 4: ; I 4: ; I? < 5I ' 4: ; I?   II!I/ $ > &I% $ > $ > : ; I I : ; ( .: ; ' I@ : ; I : ; I 4: ; I .? : ; ' I@ : ; I 4: ; I  U4: ; I&I4: ; I? < % $ > $ > : ; I.? : ; ' I@: ; I I% $ > $ > : ; I.? : ; I@: ; I I% $ > $ > : ; I.? : ; ' I@: ; I : ; I  I &I $ > % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I$ > .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3?1 /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sys../libcmp.cstdint.hstddef.htypes.htypes.hstat.hgetopt.hio_struct.hstdio.hxstrtol.hlocale.herrno.hexitfail.hfreesoft.ht@gK>gY,o/!Ȕu'XPZ t/Kw{/Kj./Kyk/Kn=u|fg![,K$Xx<i<"-S`t0x#wyY,Llm')/m. gu t 4u$hKA&lD-qc 8g~u"4ug-~.i/YWQ  1ff9/|=*"x.=vuF? (m[t KKM/ /~&=>\~~f~6~B &  version.co /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includec-stack.cerrno.hexitfail.h@>Dt# sqX# w /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includecmpbuf.cstddef.htypes.herrno.h@K JuYtt Jsv .B0fJ=3  X /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includeerror.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.h@,g{vt ttftەgi޻ .QNgJBk .gJg.'! exitfail.c'! freesoft.c /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includegetopt.cstdint.hstddef.htypes.hio_struct.hstdio.hgetopt.hx@Yhu2y.5J  y5qJ/K*w(׃pot/K*g~f$X)g0v|gh)Y X]|  /A> <n0g}g~u~ȯɔv-~.u}t>if} ft~ȑ^.vP"g~<tQodJ' f=F>`<~t)gj.0up1tF,d /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includestrtoimax.cstdint.hT'@<y A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h`'@}Y/g?LNf~= uZ!LM  ctype.c(@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h*@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJZ: ../../includestrncmp.cstddef.h2@$>9LV2z ; index.c3@*z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h;@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h=@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c B@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.hPB@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.hH@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h N@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~p ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h@V@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k  ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h0Y@i+t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.hpe@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.ce@=gP ../../../include/arch/i386add_intr_handler.cstdint.hf@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.h0f@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h g@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.h|@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h}@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.h@?Dx ?Dx =3 puts.c@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ 8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDH ../../includelist.ccollections.hstddef.hФ@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h @$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncpy.cstddef.h@)Xg[ye_8 strcpy.c@@"JiS9 ../../includestrdup.cstddef.hp@%$T9 ../../includestrlen.cstddef.h@##+.?>\ strtok.c@1 ٦lJ =zvrJr#X].*iV9 ../../includememchr.cstddef.h@(JgKwp@8 ../../includebcopy.cstddef.h@==? kMY-=]X%k;=-1MK.7Y-=H:'V G ../../includememset.cstddef.hbsdtypes.h@;fr<T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h @@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F| 4t@1AB M.\.4@#AB $4@eAB FS. X.44@EAB Dc. 4|@AB FJ.4@aAB I.4l@n D  F AB Da.\. ].Z.\. H.o. H.u. E..;. ^.i.N.T.Y.k.O.J.v.. h.c.q. .z.0E.Z.o.| @AB (@AB Fu.B.X.l.| @sAB C x@aAB Fd.| P@AB BO.$Pd@AB El.Q.S. P @XAB I.Q.U.| x@&AB @AB FT@ AB Fa..E..... .._. D..|.d"@AB R. | "@AB T. "@AB T. | "@AB E| D#@4AB `.x#@AB I.N.#@AB I.N.#@AB F.N.|  #@yAB Fy.P$@:AB F$$@zAB F^.n.|  '@AB K.| P('@)AB W.J.| T'@ AB A. | `'@'AB E| (@AD (@AD (@/AB (@AB )@AB  )@AB @)@.AG p)@/AB )@AB )@AB )@4AB  *@AD @*@AB `*@AB | L*@AB L*@AB FIL@,@AE EL-@?AB FL 1@VAB FL2@3AB D| 2@KAB DD| H3@.AB | t@3@>AB A| 3@9AB 3@AG FP4@hAB B4@AB 4@ AB 4@AB F6@ AB  6@ AB @6@oAB F8@#AB 8@!AB |  9@vAB FIF :@AB  :@AB AFF ;@>AB | l ;@dAB Fl @<@oAB Fl <@AB E|  =@:AB D =@1AB  0>@1AB  p>@0AB  >@AB  >@IAB F @@AB A 0@@AB ON @@YAB X A@YAB X A@AB IFF| 0 B@ AB 0 0B@AB | t PB@&AB t B@'AB t B@AB Ft 0C@gAB AGt C@AB t C@AB MFt PD@_AB Lt E@GAB FFt F@AB Lt F@AB t F@AB Ft G@AB F|  H@IAB D H@IAB D @I@IAB D I@AB E J@_AB D J@%AB  K@%AB  PK@aAB  K@AB MFF L@WAB D M@qAB D M@AB  M@"AB  M@IAG | x N@AG x@N@AG x`N@yAB CxN@ AB CxO@AB FxP@KAB xQ@RAB AFx`Q@AB OxR@AB OxR@tAB LFx@S@IAB xS@AB Lx T@ AB x0T@AB ExU@"AB | <V@AB <0V@ AB | @V@AD PV@AD `V@ AG pV@ AG V@ AG V@AB  V@AB FHEW@EAB DW@AB FI X@AB IFF| 0Y@AB C0Z@#AB `Z@AB E[@AB F[@&AB | L\@0AB | x0\@AD xP\@DAB E| \@ AB | \@7AB C^@AB F_@AB Fpc@AB F| pe@ AB e@AB e@!AB De@ AB e@ AB | e@AB | @f@AB | l0f@;AB lpf@!AB lf@JAB IFlf@"AB |  g@$AB Pg@AB pg@ AB g@NAB Dg@AB BF`h@NAB Dh@\AB Di@kAB Di@jAB H| k@AD l@AB l@AB 0l@ AB @l@AB D0m@+AB `m@-AB m@.AB m@AB FKn@xAB D@o@aAB Do@AB FF@p@AB Dp@zAB DPq@#AB  q@fAB IFFr@RAB FFPs@EAB Ds@UAB FFt@UAB F`v@RAB Dv@AB IIw@6AB Cy@AB y@AB I{@AB F| |@bAB E }@AB @}@GAB }@HAB B|  l}@dAB FLGlP~@AB Fl@'AB l@@AB Fl@EAB Al0@0AB Fl`@uAB C| X@6AB X @AB X@@@AB FFX@AB | @?AB |  @dAB FGGP@[AB H@(AB | p@AB p@0AB p0@ AB p@@0AB pp@ AB p@`AB FF| @AB | H@QAB AH`@*AB H@mAB FH@mAB BCHp@rAB FIH@7AB DH0@DAB FH@AB DH0@AB PFH@+AB |  @fAB D| @AB @AB Н@AB |  @AB | 8@AAB LF8`@AB 8@AB 8@AB 8@AB | @ AB @ AB |  @lAB C p@VAB C П@jAB F @@`AB F @HAB L|  @AB F|  Ф@AG  @!AB  @yAB HF @AB  @AB FFF p@lAB FF @)AB D @AB MF @OAB D @!AB | (" @AD F| \"@QAB B| "@@-AB A| "p@JAB FI| "@AD |  #@AB BD #@"AB | l#@9AB A| #@AB F| #@AB F| $p@ AB | 0$@]AB D| `$@"AB `$@#AB `$@@AB `$`@AB IH`$@AB `$@ AB |  % @dAB F %@+AB JI| `%@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEexit_failureread0read1sprintcvalid_suffixesuint64_tbuf0buf1HELP_OPTIONauthorship_msgidLONGINT_OVERFLOWblock_compare_and_countbyte_numberLONGINT_INVALID_SUFFIX_CHARLC_NUMERICuintmax_tst_inoLONGINT_INVALIDoffset_widthnnnntry_helpuse_byte_messagelong_optionstype_all_diffsbyte_numbuffer0buffer1LC_COLLATEnlink_tLC_CTYPEsmalleroff_tgid_tst_blocksprogram_namest_uidblkcnt_twords_per_bufferfile_bytesoperandreason_msgidoption_help_msgidbyte_bufversion_stringuid_tst_atimefile_descsetlocalestrtol_errorerrnopositionedGNU C 4.2.2st_modeLC_TIMEoptargbuf_sizeline_numoptindargptrdev_ttime_tparse_ignore_initialopt_print_bytescheck_stdoutLONGINT_OKst_nlink_Boolexit_statusLC_ALLoptionst_blksizeoutstatst_ctimecopyright_string/home/tyndur/lbuilds/work/diffutils-2.8.1/src/diffutils-2.8.1/srcbytes_to_readLC_MESSAGESnullstatst_rdevline_bufblock_comparefile_positioncategoryst_gidhas_argusagestderrtype_statusdelimitermode_tst_devLC_MONETARYtype_first_diffblksize_tbyte_number_maxstat_bufmainspecify_comparison_typest_mtimeremainingfree_software_msgidino_tversion.cc_stack_diec-stack.cinfocontextsignoprogram_error_message/home/tyndur/lbuilds/work/diffutils-2.8.1/src/diffutils-2.8.1/libstack_overflow_messagec_stack_actionlcm_maxreadlimbuflimcmpbuf.cssize_tbuffer_lcmblock_readnreadnbyteserrnumprint_errno_messageerror_at_lineerror_print_prognameerror_message_counterror_one_per_lineerror_tail__builtin_va_listold_line_numberold_file_nameexitfail.cfreesoft.cprint_errorsPERMUTEorderingexchange_getopt_internalexactlongindbottomREQUIRE_ORDERpfoundtemp__getopt_initializedambiglast_nonoptnextchar_getopt_initializeindfoundoptstringopterrgetoptlongoptsfirst_nonoptposixly_correctgetopt.cnameendmy_indexRETURN_IN_ORDERoptoptmiddleoption_indexgetopt_longgetopt_long_onlyopt_indexgetopt1.cofftostrofftostr.cxreallocxalloc_msg_memory_exhaustedxcallocxmallocxmalloc.cxalloc_diexalloc_fail_funcoverflowbkm_scale_by_powert_ptrscale_factorbkm_scalexstrtoumaxstrtol_baseproductxstrtoumax.crpl_mallocrpl_reallocrealloc.cendptr/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex doubleisprintisgraphctype.c/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetliballoc_minorcdestlsrcnew_mininit_memory_manageruintptr_tliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockprevpagesl_pageCountnextmajSizefirststrncmp.c/home/tyndur/tyndur/src/lib/stringstrncmpstrchrstrchr.cstrcmp.cstrcmppositivedecimalitoamaxlenstrtoullstrtoulstrcollstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcfunctioninit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initstdinfdl_elementoffsetfdopenlseekpreadfd_list_elementF_GETFDnewfdfile_flagsoriginold_posio_resposix_files.cF_GETFLflags_sizefd_to_filecreatfd_listnext_fdgetpidgetpid.cgetppidumaskmkfifofchmodinode_numlost_statmknoddevicefstatstat.cmkdirrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpiderror_codestrerrorstrerror.csend_messagemetadatayieldsleep.cresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineparentset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsretvalputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathnew_filefseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfileold_bufferwrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorremainderulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valuedigitsldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closeio_direntry_type_tio_direntry_tdirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cprograminit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGptrdiff_tinit_execvPPB_ENV_VARstrtol.cstrtollast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionscurrentnew_nodelist_insertu_longstrcspnstrcspn.ccharsetstrncpy.cstrncpyfromstrcpysavestrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontlastmemchr.cmemchrdst0memcpy.csrc0donememset.cu_charu_intunlinkunlink.caccess.caccessreaddirtelldirdirentposix_direntryd_reclenrewinddirname_lengthposix_dir.copendirseekdird_nameclosedirio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu1tP,PR,R45u57u7Wt4RPXYuY[u[tXoPoSXyRyVththSRSPSPRgW~PPPuutPS u  u tPBVEZV]mVpVVR P)ASEYSbnWpSSSuutuQuuft5q5Vq%V%+q+YVY. q. > V> v qv V qV:q:HVHYqYfV5q5Sq$S$+q+YSY. q. > S> v qv S qS:q:HSHYqYfSQZPP:CPt~YWYt~ S> v t~ t~ S t~:t~HYt~YfW$. t} v t} t} q t}t}+t}Stl. tl> v tl tl:tlHftlY{SS S Sq S.. t~ v t~ t~ q t~t~+t~. t~ R v t~ t~ t~  Rt~+t~. t~> @ t~@ b Pt~ v t~U t~ q t~t~+t~.. t~ v t~ t~ q t~t~+t~.. t~ v t~ t~ q t~t~+t~.. t~ v t~ t~ q t~t~+t~.. t~ v t~ t~ q t~t~+t~W!. WZ v WU W . W5WWW:W. t~ v t~U t~ q t~t~+t~5:t~4VS^S< | S S B S.. t} v t} t} q t}t}+t}.. t} v t} t} q t}t}+t}!'S9 v SS.nV!. V  V v V V < V| ? VEVVV!KRT Z RZ \ S\ v R. t~ t~t~. t~ t~t~+BS+fQS}RQQSQS.. t~ v t~ t~ q t~t~+t~.. t~ v t~ t~ q t~t~+t~'S.. t~ v t~ t~ q t~t~+t~.nVWVWd. VW  VW VW < VW| . VW5VWVW(QS4SU SnVU Vh j P PQX t~ Q RU _ Qt~+:QPRSRS " P" $ S$ 9 P9 U PRU U SHYPRR 9 Ruutuu't##'th4rtl|tltp'tpuustVtNVNQtQYVY\t\pVpstSt MSQUSU\t \oSFFQtQ\\jtjs>QQ\jQ".P06P$<WtuuuwuwttWttt ttSVPPPuut P NVPVRMSPSQ&&t^rPw~PuuDtS t DS V t DV ttDEuEGuGtit|uu&tP&Q()u)+u+t(9P9tX<\t`\tlM_tp_thRR RkVVVkVVVuu t@@DtDPP6t6WQW^t^xQx tt vvt $t $PPt  t CCxt xt t +t +::ht h)t )GGt   t   t   t 55 t vtvy yt  t  MtM^ ^+t+: :hth  ttGGRtR< < ] t] tBBatatt"t"  t  t tStS+tS)GtS tS tS tS tS8APvxP+PP P 7 P P  P/ : PO Z P PvtTtT tT7 tT / tTl  tT tT tT tTV V7 V V * Vl  V V V G V] V V VvtXtX? tX7 tX / tXl  tX tX tX9 O P  Pz  Pvt\t\F t\7 t\ / t\l  t\ t\ t\vt`t`M t`7 t` / t`l  t` t` t`vtdtdT td7 td / tdl  td td tdSv|SS SS^S:hSS"SGS S  S SVV VV^V:FVVVVRV V  V Vt@t@ t@Mt@^t@+t@:ht@t@"t@) t@cyPP$PlP:IP[^PPReP  PtDtD tDMtD^tD+tD:htDtD"tD) tDtHtH tHMtH^tH+tH:htHtH"tH) tHtLtL tLMtL^tL+tL:htLtL"tL) tL u u  tuut !u!#u#>tuutBQBEREQ$P$It ITPTt FSI~Suu4t45u57u7St4LLSt4LLSt JLPNSPTUuUWuWstTlllPlntnsPsstTllst tuuuwuwtttPPuuytP_WawW$R|}u}ut|PWW|RVVR|QSSuu2tSVStVtV2tSt S2t 9W9tW2tSSttttt2ttX2tXCt`2t`HSt}SSR(MR_eRw~RRRRRRRR RR -R\qVt~VV-lV|~V2VtyPT]Puut  PtPtuu)t  Rt)R))t  P)t uu tuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttKu7V79u9KV6S69u 9KSKQtt.u,P,.utt>u  )S)+u+8S8>u  >Rtt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttuttu !t!#t#)uttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPtt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Ptt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P25:Y/ `y : q X > v n: q  _ > v z.n+ q <  -  v z  q   q + q  v  v  | |  !  !    _ r +:>  X HY (_laxv   )G+5:l  /  7    G":h^S 2BP'BP'*3*@&(&(*@&(*@*A$p\\X_r02 (:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I hj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K)030DL]GIT8"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@'D@D-`@` 50@0\?@F@M@R@$X@@<@ ]<\fuXZUL ?J%0 p^$~!bXyqv ]@@D@`@0@@@@@ @@     @@(0@;@H@^@@ m@ t@D@ @ @@@@P@!t@1@# @ @e1|@ @4@ENh@ ^@ mt@ w`@ |@@a @@(@2@2 @ @ l@ @h @ @ #@ 9@ PYa@l @ @ x@&@ @ $@ @ @ @  ,#@y6P$@:IR\hrz0@ 8@ H@ T@ @@ P@ X@ @,@8@  '3d@ :Bl@ Ih@ Wf=@{=@>@It@ x@ 0C@g@@  @ M@PK@a @ @ "0L@ 8P@ @P@KQQ@R\elV@vT@ X@ [@`@@ \@7  *2@ =Dm@M@ V@ ]@ el@ x@E:  @y"@ ,@ 7@ AKU^gpy@ h0@0D#@4g@N#@(@ @@- @QB@"p>@04\@ :F@J0Y@Ry@Z@i@@`w@"@!@@ @@ `=@0@@s@U@O K@%\@0@@Y('@) "@ @( @ / pc@@ @K pV@ Q P4@hV e@e @fn C@u PV@| p@l @ 4@ (@ 0m@+ g@ @+ ^@ p@V ;@d 0V@  _@ v@ @  d@+ pg@ 0 @ C @J @S @ ` @l@h @<@ow @" g@$ U@" [@& i@k @N@ =@: )@ @*@ @# @H @o@a -@? 0l@  Ф@ @ @? P@[ 0\@ T'@ ) @8 8@!@ @ M 3@R )@4Z 0@ a `@i `@ur @ (@/ n@x @ :@ @ F@ @_ R@t H@I `'@' `m@- }@ @ @V@ p)@/$ @ 9 J@_? @ O @V 3@9^ @s @ y@ *@ i@j 2@3 `@* 6@  @ @) @S@I 4@ W@E pf@! (@  M@I 0@ @01 f@B >@U @6] `V@ d | E@G @ @ p@z @l ,@ @9 @' x#@ @ 0Z@# P\@D G@ V@ @@  X@k@ B@ !L@W(S@-4@ 5)@=2@KEl@L@QTp@ [PD@_b@xB@'h@\ 1@Ve@0>@1A@@7@d@"J@% T@  #@p@r# )@+Н@?K@It@UOp@JV$@za@!m@@0z@6@o;@>w@6<@d"@@l@n @@@p@@@+l@o@PB@&Pg@#V@+@ 3 *@;`@ H@)@.P(@X@Ai`h@Nn"@@3@>P~@@@@ N@e@!@C@@mp@ `v@R@m6@ @}@G @ @x@a" A@Y0@ 7 @X=@I@IIҾ@e0@ u9@vPs@E"@4@ }@dR@@П@j`Z@W@)@q@f@]@`<@ e@ @'@*@7@IPq@#P{@X=@1n`@ }@H@H@Im@.`@@ 8@#(@f@Jf@"F@O@0B@ |@b:@,<@;@B0T@G`*@O0@D[3@.b @dqr@Rwp@ @ @s@N@ V@ `Q@`N@ype@ M@" @@0f@;e@ &M@q,@>*@CI@O@@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startcmp.ctry_helpspecify_comparison_typecomparison_typeparse_ignore_initialvalid_suffixesfile_positionpositioned.2856ignore_initialfile_descposition.2857sprintccheck_stdoutlong_optionsoption_help_msgidauthorship_msgidcopyright_stringbytesopt_print_bytesfilestat_bufbuf_sizebufferversion.cc-stack.cprogram_error_messagestack_overflow_messagecmpbuf.cerror.cerror_tailold_line_number.2045old_file_name.2044exitfail.cfreesoft.cgetopt.cmy_indexexchangefirst_nonoptlast_nonoptnextcharposixly_correctorderinggetopt1.cofftostr.cxmalloc.cxstrtoumax.cbkm_scalebkm_scale_by_powermalloc.crealloc.cstrtoumax.clibgcc2.cctype.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrncmp.cstrchr.cstrcmp.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetpid.cstat.clost_statinode_numwait.cwait_listrpc_child_exitstrerror.cerror_message.1085rpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indexprintf.cassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.cstrtol.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncpy.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930memchr.cmemcpy.cmemset.cunlink.caccess.cposix_dir.clost_link.cparse_pos_paramsxalloc_dieputcharxmallocxalloc_fail_funcstrcpyinit_dev_listunsetenvrpc_send_responseyieldrpc_get_envvarswaitpidtmpfileversion_stringppb_from_argvstrtok_rlist_sizerpc_get_responseprintfstdoutlibrpc_rpc_handlerrpc_get_stringungetclist_pushsigemptysetstrerrorrpc_get_intrpl_reallocgetopt_longsnprintf_getopt_internalio_split_dirname__strtok_rmknodatolget_parent_pidlio_seekgetenvfchmodlist_poperrnostrtoldisblanksetlinebufgetsio_create_linkio_split_filenameppb_get_argctimer_cancelgetpidio_get_absolute_pathfgets__getopt_initializederror_at_linegetcv_and_wait_for_rpcmemcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorcreatinit_waitpidputsdup2rpc_send_string_responseislowertolowerrewinddirinit_execvfeofmallocremovelist_is_emptyoptarg_assertvsnprintfrpcstrtoumaxc_stack_actionstrtoul__dso_handleitoaispunctopterrreaddirjvprintferror_message_countisspacefflushlist_get_element_atregister_intr_handlerdirectory_openputenv__umoddi3lseeksigaddset__udivdi3setbufferabortprintf_putcchmodisxdigiterror_print_prognamealarmmessage_handlerstrtolstrnlencreate_shared_memoryprogram_namerenameinit_memory_managerstdio_initcallocinit_dev_registerstrtodlist_insertlist_destroywriteatoffstatfprintfexit_failurekillinit_service_registerdirectory_createadd_intr_handlerinit_sync_messagesvprintfmkfifo__deregister_frame_infochdiropen_shared_memory__dtor_end__fseekppb_is_validoptindmemchrjprintf_putcxcallocstdinwaitsend_messageinit_envvarsumask_startlstatferrorsyscall_psignalreadstrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalgetenv_indexputsnreallocset_rpc_handlerrpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopenxreallocinit_executeisalphaclose_shared_memorysigactionfreadstrdupxstrtoumaxlist_createis_directorystrtoullinit_messagingfopen__bss_startgetoptmemsetmainfree_software_msgidftell__dtor_start__init_service_get_nameclearerrfclosegetenv_name_by_indexgetchargetppidopendirisgraphintr_handlerisalnumisprintmem_dma_allocateputcgetopt_long_onlystrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsesfgetccmdline_copy_argvstrtofatexitstrcspnc_stack_dieblock_readrpc_get_dwordstderrerrorsigismemberxalloc_msg_memory_exhausteddirectory_closelibrpc_c_rpc_handlerfputcofftostroptoptdivmodpread__ctor_start__ppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_process_endrpl_malloc__ctor_end__mem_free_physicalrewindfreopenrpc_send_int_responserpc_response_handlerexitsyscall_timersigdelsetsetbufmem_allocateerror_one_per_lineatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenosyscall_v_exitregister_message_handlertimer_registerstrlenopentoupper__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClassesbuffer_lcmlist_removefcntlmkdir__register_frame_infopwritecloseget_pid_signal_default_handlertelldirvfprintfget_cmdlineraiseinit_process_exitfreesigprocmaskjprintf_putsnpackages/diffutils/2.8.1/bin/diff0000755000175200017520000165064511517104606016363 0ustar tyndurtyndurELF@@44 (@@@@@@@@@8@QtdS趮U=@t8vX@ҡX@ut h@!@ÐUth@h@P@tt hP@ЃÐQSP UWVS] ?*/52t&[;vSOv;^EE$D$豝y$@?q")ċEt$|$ t$D$$Н@@=H@s& H@sBwҁH@rt$<$0ád@$b$qYÉ$處Ǎ")čt$|$t$$oUWVSÉ։jX pUPxU e[^_fUWVSd`\EXU W @h@l`9dTX9\Td\l;@h4Al2X9\9updA\Jd\`9u\9X~2 \ @\T @\X9\ue[^_Ë\9X`hDXl;Duj` \9X~= @tۋXSlCh Cp4X_DžXXStGÄh u]_uTMAl@@AtX$uL @D‰@@tu@@=}@Vhuh` @E hPh @Y[EPt @PM11q@])‰$ZEuEtxuE؋UEMLhM]\P]11E8UJ4;M}]< u]FBuA;M|EME̊BBuE<0t FBBuMUlU8];]EEH<{UD<MEUD4|)EfKBJuENBJutEEUDM89tE|;MU;C@U0vE@A<t0ABBuEvFBBu9Mt(UUU;u0@@@딉)؋U)U;Et3]M̋U1ۋM̋E|/})9 ]]EUBICUNBJuMK9|E}w=D @8URxUMM]KPDžLxruDU\:tXu1NBJuEKBJu)؃)LPډL߃IOyy= @u 0 @1LL   VRË8U$MQEPURVT ;uӋM1H$MIxM]]uvPuEEDžL11;}| ;U'M9utXu 7FAAuE CAAu)Ѓ)LPLڃGB넋L= @^ @ tmM @k @QP1PQRAQ=D @D @$@1덃 L3O[ Url)XTXMqh]CLCH$_$LtL P؃uD @1ۋEx|t0 @uUB hʯ@Ph @jj` CEuU L4EPE1Džlf9d H9Ixu@)ʉ|71.1_jLHjLh0 LGX L* L* L*UWVSE E= @u50 @]t:]}v3 EPEPEPWSP C3uѡ @أ@@}tRh@h#@uNe[^_Ph4!@h#@udNe[^_ËMtE@u뒍vUWVS E조@E@E\!vjPjPWh @0 yN9u$;CyѸf5@e[^_á@=tU@It ډCWj ?EEЋUUԋEE܃vE;E~ U;UE܅UЋE;P U܋RU؅]1&v @PjPF;uWj-:?= @tƃWj #?붍e[^_Í1EpʉU)uE9]v= @ WP>E @E[^PjOEԃuЋE܋@EtT]1 , @PjOF;ut'Wj+j>= @tʃWj S>uԋU܋UCE䡐 @U=L @Wjjh6@1GMU` @Wjjh;@G MU @Wjjh>@FUS ]S]SQRPJEU 9RPh2@5L @;]fPRh.@5L @;]fUWVS(EPEPEPEPuKE  @ً5H @U)9U)uE9E @M)9CE8 @M)91E䡐 @ @>TL @EPjjhB@Et ڋEujjhR@EMU` @ujjhX@E Et`u;uX<]t'S C9}S C9u.@ @PR3MF9u}ujjha@EMU @ujjhf@D EtYu;uQ<]t SC9}dSC9Xu.@, @PRLF9u}e[^_Í1E]8ʉU)uE9%9K~[_@9C~O_@CE䡐 @'qRL @EPjjhB@C<<@A9@fUWVS]H @E=?~sEC ESU6tPyuAUUy )+Uq+E+E9uA9U~&ˉ}uCSU܋ {tt UU뽐؃[^_ËUTUNUWVS<ƉӅtQPhm@5L @8e[^_f B,P(gtVjjP5 @j+}Wi ujs,ht@Wl WsVh}@5L @7 e[^_Í}fUS]} t, @ڸ@> @@[[% @ڸN@ @@[[U= @fUPp t,@tLt0tG0tF`t(@Ð@u@f@Ð@Ð@Ð@ø̰@ø@ÍvUVSƋtX h;C~ ue[^Rvv6bt P6h@jj{T e[^ÐUWVSÉ1эysWRt! PVh@jj.T e[^_Ív CEEEC UBSC9r!u9sCPQA}tE\D|EEGSPVRe[^_ÐUtRPjjS5 @h @jjtSKvUD @9t uD @1ҸH@UWVS ƉӉϋtRPu e[^_à SWhl@jjS 11UUWVSL]u WhjVnEE} lu Mu uvCXZSCp 1ۍtxtp@9@G@(Pj#>F%p=  D (PofC.]WTl31ҍu+x @ sHÄ9uՉ 5d@:t Xt =e[^_Ã(P."+ @BfM|tlt;x;1сp@p@=D @]t =@Sh (@VDÃ=@%p=@ @¡ @{QRPh,@+Isvl vuU ltwơ @Í[ @ VSPRh@@GDž fU pDžDž=@m=@hM )E RP} %Uth@GDže[^_Ív|v|;t9;E;E;E~ ;Eo;E`;EQ= @<=@=@u=@uh (@PÃW@ @t xlkDžli] ] Su Fj1Uth@WFDž|Qph@.F%p|=@%p=@8) }ϋ G^ZPSI=9@8*P91 LCd K= @t ;Et 1ۃlX7x P;l3;' P  pBDžWjjj68)aPjjl& B l(Džp,zpb R$Ãllt ` @¡ @QRPh@5CDžZ+ @F A5 h@,C1 h@BVjjpl p@Kp3 h@BU5d@/u 5d@N3uà h!@XB h@oBvL$qUWVSQdEIMEE`@ @hw@D@ @@ @$ ~#I @EEEE jh@h@@uuXE @T}v 11vU$`@E8EЙEUM1E1 tMЅy ]Ћ]냋 @8@E]h @]Y @]J|B @]1c] @]B @*@@U @@*@4C؃u] @] @]Pj UR5 @$sщƒE8 \1ɡ @É9w9 @]A5 @hȱ@[@1 j (4d@Gtf>ufX)RVPh@[ރj VuՊ< <<-@VPJ[4d@Gu1eY[^_ɍaË @E칼@]u]cVP5 @5 @F]@ @]. h@h@h@h;@h{@Z )1eY[^_ɍaø)=H @XH @]@ @]@]@] @]i@@E]w]e=+@  @hB@jD ]7 @](ZmE} 8@ @@X]] ] @]=H @H @= @ @ @]h j P5 @5 @h|@D  5 @ =fSj EP5 @oÉփw =C @@ @] @x@@,]@]@] @`= @B @ @]u @@]]A @]N @@v]6 @ @]I @1ى׉I)ȃa P nEġ @PPPjPPjPPjh@uEX@J@Uĸ@ ً}ĉыEč@J@1FuՋ]Y @ERj URPmÉփE8 w 1 @]CЃ } ]ȍ}DGЉEȅKE?m] [ `@ @@]@D @! @B@uȅx'zQ= D @B;=@ @ɃA=@ @=@ @҃]ЅD1P)9~ʅ @uأ @H @9 @} @@@|D @ @  @= @ @ @  @@  Љх @5d@]]؍FE4jdP\G9u SkEܾ XU4S/PF9uM܉ @E};d@;E31ۍvV}4uj79}ád@@d@9E)6 S6}}ȅC @B@M0Mȋ]11}U+H @9wr 9vH @E]w]Љ=@5@g@J @%@j@N @@8u,}1V @ @[@1fM!d@9E1RuU4j9}ád@@d@9ET @WE;H @S}IUȉH @; jhE܃1 @&@@Q@@Q@@Q@m@[@ @@H @ @B@d@U)ƒJM]T^@Ph@5@5@k, @D @ @8 hĶ@5 @@WX@F hM@41ҸL@4U@ @.@ h@4uh@jj:WU4M4jÃdt6UuPuht@jjT: }Ty@CUWVSE<U쐋t,Uu0B ;C uߋB;Cu׸[^_1[^_UVSƉӀ= @uB=@t% @SVy @u+u SVe[^ÃRPt SVh<@Rj_9jh @UWVS\EE8<1-EԉEUUE@U:_ rRE h[eƋEpEE @ uSƒBE1эyz.uBt<.fu5 @8uG}}}9s)f?SVdƋUB9rًURuuPE}@U E8t'1Uthd@jj7e[^_øԀz;c jdEUB1UE EUU9UCE]ԋt PCt P ;]uӋEe[^_Ë @tK uA @ Ep.EeE u } UPcEËUEB1f41B;UuEEԉEEE@ h @t@EhF@juPEhF@juP @tEEtYE8tfE0tjEM…xUEEtH1SQRuU ‹E9~UEuEE8uEE1ɋEE뭋E@cy8EEEu$vE@8)EEEuUE EU hF@hj@u$ÍvU hG@hj@u`$ÍvU hH@hj@u@$ÍvUVS,EPEPEPEPu@&à ue[^k/ EPEPuuh` @8$ tȃ5L @ja"E؉$EPuuh @#U܋E؃ 9~YPuh@5L @{u;ui, @Ph@n(F9u}ލe[^@)맃5L @jd"EU9~RPh@5L @*B)UVSEPEPEPEPu%à ue[^3.5L @7@P!uuh` @j #5L @j g!Ktu;u+f, @Ph@z'F9u}5L @jjh@Je[^UVSEPEPEPEPuD$à ue[^o-uuh` @j," 7@Ph@5L @Ktu;u7, @8.ux t8Rh@&F9u}5L @jjh@e[^5L @j jh@gUB< vB< vuÍv$@ A+Aà q1W!Hà q1A!à q1,!Hà q1!$@vUWVSEUCfEC<-t<'t<0t0 wvEC0 v}.t{EX< w*$@EC0 vԅnt/1e[^_À'u't\twt߀'uٍOuQE EUte+EP)čt$PRuV$lECC uVuenGO<'th0S10@ЊA<'u)&υMuP&1fҋE EUWVSEUEXHQUIMutW=@ @M9M}BE|]vt!s<%t3uPuEE9Euōe[^_ÍvE Pu"U‰UE@E uuFu  P躳uۋE E1EUBU< i< t3< t[<tBC PȺvEȉEJu븉ڃ)Љù 1)ú1ۺ EUBU<  Vu܋] VpÉ]Eщ|9M1y }EEUĉBPMMu)E])<u+uEE9EtSUE9UhM; H @|= @PvUBU< uEE܃EFE9Eu=*UUWEEPiFM)ȉEdT<1F9u}5`@Etu;u$ @1ɺ<F9u}5\@e[^_ËE@+EPE@+EPh@5L @}Z}EEE9KU;UsfU9U|U , @ @|GEE9}19‹E9E}*1‰U܉}=\@UU`@19ָѐUEh@E l@Ep@L @ÐUEUEUWVS Et& WU Ë0<$U3uލe[^_fUE@`@E ÐUS]E HPSZY@UE@PSZYHU]fUS]5d@t(ssss h@5h@5 uءh@E]kvUS]EPEPuuu TEU9~# PPRh@5L @ ]fSPh2@5L @]fUVS] So;ƃ SjP荻e[^UWVSu]1ʋM M})ӹэD P;É4$u uh@PV%؍e[^_UWS] S ƒ8u@Wu PSme[_f1р| /tҸ@UWVS,M @EHE䡨 @E, @UQ E QEMEEMЋy QDEԋqALMUE;}f}t`E/jPjPRh @d x,EG9}|+C;Etދ50 @u1G9}}ՋUЋrE9u|]}tWE,jPjPRh @ x(EF9u|'t C;Et 0 @u1F9u}وEUЋUЅEMԉEU؉}u@}҃1} ‰Ѝe[^_ËMЋqEI=0 @Eq1҉Ѝe[^_UWVSUE EEEEE=@ @L @E9UEF< t:< th<tX S賣]uS9uvvF< uNjE)ljuj _Ku}ʋEtM믃uS<EtV9uv> t!Puuu)Ke[^_ð u<1VSWu>t tPhʯ@h@ue[^_Ív= @t@PVSua릸@jjWu4렍vUWVS @E @M}u EFEOM vUGEF8t)}}t?}}uo:]  uE)몐 t'G P踡uv} tMF EP蓡u}tf PE$E:]qe[^_À  C} 9U ЃPG uB Pua EPuq:]}  } ;u FP譠N| tG P舠uO |} tEF P`uNE f} L >;}X GP!@O1e[^_ËE} uMF} u@9UUuh@5 @jUWVS<d@twufEЍSU1э< }BDE1}ы}ω<u܃ uuuuu]S]Ѓue[^_fUWVSLEEU U}u]= @EEUU}u]1}щM̍Yf|1щLBu SC3Eƃ]̃ SuV跱޿\PStV蜱Gu\@U\@e[^_Ív=B @u!]u}EE UUe[^_& j о@@vUjjuu u ÍvUuh@jj/vUS @uh@SjUL @tS;d@tK P 5L @[uyQjEP5t@}t9UuL @fh+@h@jj!L @fh+@h@jj믃 h!@ h!@fUWVS =L @t e[^_Ð =h@1ʋ=l@)Ӌ=@эD P1^5l@5h@5@h@PC = @u`d@L @=p@up SD @t \jh` @BEjh` @+. 5d@t h!@ S낐UEt%B t/uB /tt B uÀ8/uBÍvUWS]1эQv|/u  fAIt\EPuuWcuI;M.}MuUB;F9E>u1Uą:2E1}ыEL @d@l@?e[^_Åqu5 @E@d@@-@AMu}̉}@@9J9EtE d@EM9M~2u A d@;M:-uzt=d@} @O@E)B;FB ;F U}d@Bd@;Mq]t>u Dx- U2PM 1h@5h@x 5@u1}ыEL @UB l@?)EE @iuM̉MȸMy1}ыEL @EtMȋU uVF 1ҋE2&}:Y8WH:|x:?= @d@@uKd@<9Uu  @Bd@#C @9UU@d@u 46hz@5h@=@}]EEt7d@M x- uPu 6ht@5h@ @@d@l@?T1XVM 1h@5h@I$}w $M1}ыEL @UB l@M9:t:}76h@5h@@E\H;%{ u5 @d@5 @u5@E~<=vu=tEԋUԊUuu}+}}EEEEfEWuuSuI;MM؅Eu1hT@5h@;d@;U]u  @Bd@/} t7h,@5h@@EJ?= @d@@?1U܅Et d@M 41h@5h@@1эT @d@?u؋EEd@U x-UE0$v;UM  @Bd@ @E؅@WGUtVE 0h@5h@<5l@U1::L:Mu؋UUMME5l@E8:t:}E؋xuLutU2M 1h@5h@@1эT @?fE@ @1}ыEL @MtMU u؋Ve}؋w E؃xud@9U~3M  @Bd@V} 7h@5h@]tu t6h,@5h@@׊EэT @Ujjjuu uUjuuuu ufUjuuuu uÐU$h@ ƒt8u1fPj EPR?ƒE8uÐUWVS]} 1>E~w*$ @t'pZ[^_Ê-ft F뿊O-tC1t3'u뷍vt@tA'ut'D\D';MsWGt-S-tHF뛍O1;Es;Esي@tF=uǐUWVSEMtZ׉E^EONE9Et9_ÉE Pt׃ u|È^EONE9EuNjEe[^_UWVSEMtZ׉E^EONE9Et9_ÉE PVt׃ uÈ^EONE9EuNjEe[^_UWVS}E@4  4M@Dž8Dž<DžD?#v&3#] !B<fDD+@1ۋ@߃)PW芑tDPá@uƉ։<9E t8~WVj VS@(@\@@@ )ߋP)H_4 ~؉)f@0H9u)˅tK- )ߋT) <9E ~%H0 QVj Z\' ڋ0z@uuuWjjƋT)à ؅J <9E f, P H0& PSj 讐uuuWE +/uEt}\u;눋Ů=]FًUԅJUJJUS]JJZZ[fUVSƉӋE9tfBBJ9uډ[^UWVSljӉ΋ME 9t ŠBBJ9uMډ[^_fUWVSE] 29tuF҃ ]tpEME<;}rDu,‹U U ˆF9rMu͉Һ Z[^_1҉Z[^_>fUWVSlj΋EHMv 1[^_Ív$`@AxۍDEE[^_ÍY]CQuMAЍEEE <t}u1nu1^U ЈUWVSӉΉE}M9sB9tډu1[^_ÍvAEQ@ЍDEM9r[^_fUWVSEU܉ϋEU;Us<t!<t5U܍Eu1[^_fBU[^_ÍvBEJ@Uxv]|3uCTtMM9uOAEQ@4AE<1tMSC43Mu"ҐU @U @ÐUSUM ]tBBEAEA[fbAA[ÐUS]t P/bCCCt PbCcCt PaC]ÍvUWVS Euw`@@1Ӆt9v#FWPRurED0؍e[^_VSRur؍e[^_vUWVS(EpPډUj,EPhjV tMAAEEEF Eؐ;]t<t C<v<苿vEUB NJB BMME$@CS@ЅuECЃE9EwEH}aEUU9U!MEU @E1Ґ€@t2Bu]11 Bt€@u2CЍ\<t<SCЍ\EME9\IMfUJ uj_1e[^_Ãe ABu A{+:uCHK…yύPB{':xctCHK…yӍPΊV D0@=uMA @u?E؈]1oC0]1]IAIAu5B91Ҋ<(x<| fxEP\)@9uF=vF}w79t)\48t80t0,g,\9$2#BE#' T9<5 T< \C\\ @\r\@\]\C\H T;$9]؃ %  ?\0y^ TF;G\\\+0P0 )Dž,[ T: \\ +0\H0WH0N0)كVڸg\+0PV0\Dž, +0\H0BWH0&\ Dž,X[:@9$tQU9$U1#9$ˆjG;$t Z](t ɋ( :uz]uƄjE8]t.tE`N N1DžD:j@(‰@( S?ƃE;$@E9$L1*و҃` C S̵ZYVP賵tو҃` (tt u S7t S*7t_ T7v;]DM9$CE҃` Y Tg7 cMQ\)@9va}G=vGEp0U9t)\,t,늋\C\ T6u6)\\}G1ۃ@0+\\ QƅC `\@\\@\\C\ T5N\C"S\Dž,2\ @\\B\1[=9$AE9$Z1ҊK](t ( 8=Q;$tw ˆLBCECD=t/t C)ЉE`K K 1DžD=$8]u T4[.9$AE9$)Z1ҊK](t ( 0.;$txˆkBCƅkCƄk.t/t C)ЉE`N N@1DžD.$?]uƊkt9$CE҃` kD1i;]6Ƅk뗉Ƅj:$UWVSuE%OEFFhFE hF1v;Gt+^ W1t߃ Wf2;GuEumVVmE ˆV 1} эQVME tEU<;|9|E9lsƋhU] ltDD U0z4;L} @9LLH;E;LC@u9LL9tL€@8{X9T]T`@GTTTSCЃHCGTX9TT`@BT;X9TT`@CT TFT`vP9L L`8FLT:_ATJuEu2l9hwhUB9lsEX9TIT`@CTBL9H uLHPP9LtˋLALT:CTJu8H9L{}LPP9Ltы8Q @u'`L`<0 )y'`L`<Eu2l9hwhUB9lsELX9TT`@CTTu0 t@ |TLtM$l9hTt(‹}t!v‹]uDžhDžlu TH;\ T9XY`@ىTETCTp40u@Xt<8}@;0t394 E9E‹M9418u Duh] ]9]P9Lu0L9HH9EULPM+MP+L]9~Mċ`e]ątQL}`:PM1&LD3}T;`C8#Iu׋ELEMl9hw hB9lsEp@P9UEPu蚯EeU+U+hD@9rl9hwfhp4tË} 8hU}DDU9lsƋhMul|DʃX9TT`@ATBUH9LELPP9LtыM9L[L9L@NEu2l9hwhuڀB9lsELX9TT`@BT5TWUOCȃTUBX9! T`@BTT}E<bp=@x2TLp ] $7lhS T;Xl TA`@T\E0%4;LU LH9Ew ;LC@L@9Lt7}9LaL9L@X9T T`@BT-H9L]LPP9Ltы}9L L9 L@sEu0l9hwhMB9lsELX9T T`@FT\@9LU9L L9 L@0V4;Lt:] t3LH9E";?LC@iX9T6 T`@GT04;LeE Z@9LHLH;Ey ; LA@]9LC L9| L€@8X9T T`@GTEЍ<};Xtn<X8z<  WE B<w;G9sDtЅuF^T~F #X9TI T`@FT8F xX9T T`@BT<pG<T < <UAȉMЄ@GȄG 1B;U9Dt9v<T@ETW@ЍDEt8oMM18WMMrL9H ELHP}}E)ljLHP}}E)ljHU؉DAx@E]LP`` L`8ËT ME9LTFEu0l9hwhMB9lsEETX9T`@FTLq<BRЉlhhfpE TX9TBT`@FTEEfEtED9POETF‹TDU9d@sU P輤MA$詤]C{e ] 8FF}; uvqLLAx@ЋuF, 94w9;Ew4+4A94w;Uw +4$~$ЋMANjT9X4MTG]<<< ]l9hwvhp4tEhUMDETEl9vhMulDUEЍDʃL ;X`@GTBUl9hwfhp4tË} 8hU}DDU9lsƋhMul|ETDʃX9TT`@ATBU:҉l}9H<E9UU0E؉E1hDžhDžlEu94}9DPd]p0}tA;duԋuLT]9] u HPq8B@X9TsT`@CTx@XTx@x@x@Mix@x@ux@k}zx@Vx@LUx@&U<TFS‰EEЉE8x@T:M  BUTC9shxƉupNj|ƋtËU9wAEE T 9w‹EPUHMRUɃEl@+h\@E+E9p@P9UEPuyvEeE+E9p@P;UsMMXE ˆ]MA]x@Zx@Px@FMA$uFMAuUx@ }? tU x@]C x@X]C`L}Gx@x@Ed@9UPr MA[^Pq]CS|SCE:_x@ L? vx@L;fu}Ux@x@\x@mMAMAUBEx@g}9L}ML+4WA9AЉŪ1D9҅uA;MtG9;Mf u5p pvML VWUldX9Tt3T`@CT%HLPx@ ul9hwbhpƉu}U4tÍL}8hEFEGE  ;lvӋhU] ltUEE}DLD }1 UWVSEU M}u]$]] ]]]u }[^_fUVSEu M]UMU]M u11[^UWVS]u E@EURUy؍e[^_ËMMM9؉E5U9U}u)ދMA}Et\E@v}tE;]}@UBu7;] M9M#1E v])Ӊ֐x;]tG u(u$SuuMU E ,r~"NCgv}tE@uvFKEE+E1U]9`M]<IщA]A]</J9%Muv+EUUUM<4E)؉){< t< kyaOf;]}M 9M<~щAA]<jJ9` P蓢2UEPuuuPu jjuIÍvUWVSt u1 [^_]Ít&$$)ƉfUWVS u} &}$ÍGE$9u>uӃ 1[^_]Ð$$ )É[^_]ÐUWVSu>Љ%=t0й%=tuO9] rtF%t f[^_]Ít&%u9[^_]Ít&<|ʹu0fUuu ]1ۉ}}tE4$D$u؋u]}]Ðt)P!ƒ~ι? 9ˉ뭍'U1S]M tUȃ9toʁ9tC9tl ?ȀC?ȀCȃ?ȀC[]ÉЃ?ȀC[]Ív[]Í ?ȀCЃ?ȀC[]Í'UWVS }u twEuh1ۍD$ED$$YtrtEЉt 9]wÀ}u؅tҍt&t [^_]ÍMu11؍v;]s [^_]Í [^_]ÍvuE:vU ED$E D$E$ UWVS,u} ]E1t&ET$$Et%E)9E\$D$E$mދt 9uw}uMtu;us E0,[^_]Ðt&M_11&,[^_]Ðf}Et&'UED$E D$E$ÐUEM 8ut&8t ҍt&u1]ÐUS]U t& 8uu1ɉ[]Ðt&B[])ÐUSM] tU&9tu1[]Ít&B[]vÐUWVS}u] 9 ftD1B9E ))1ҋ] ]9u] uΉEt1fuEÉt1ҍ&9ufE[^_]Ðt&]u  t91)1DD uÉEt%1Ґt&DDuEƉi1ҍ&DD uE[^_]f1&1eUWVS Mu uw)tU 1&9u [^_]Ít&} ؅t ؉ Ét&E)E1f9EuE+MEEUt&uUEʃt1t& 9u [^_]ÐUU Mt$9t1 f<t&t9u]t&1]t&Í&UWVS0]uf0TE1QEtыE1 vڃ7Tؐ1D t ] T}ҍv29uȋU 0[^_]Í&'UVSutQ-t<+t7A11< v :fA< w3 TPЄu[^]Íu1҉[^]Ð&U]É'U]&UWVS ]} &$u+1-1@.tn|B< v5؍v؍ftt [^_]fƒ0P$%@ٞw…u, t&z롍& @ٍt&91,ft&UE D$E$]EUE D$E$]EUWVSL]f$ru<+<-EMyE ߀;011EEt6E6EԋEZEȉUAA< v6]uU tU :E؅t ]uۃރL؉[^_]Ít&EɉM܃/9MȋEEʋM܉EU0Ή]utZiA<nEɉMV9ZMȋEEʋMEUăWΉ]u랋UɉM9MȋEEʋMEU7Ή]uZt&}t"vEWv;0t&uԀ{xfuC{$GHAEEs{xC{$EE UED$ D$$oÍ'UED$E D$E$AÐU8uE u}}]EV=Uw& @t;=$@ts]u}]Ív:=tc==vuËU]u}U]&U]u}]Dt&]Eu}]t&FED$$W1 f?[D$E @D$U$muɍFD$ ED$E<$D$U @FD$ ED$E<$D$ @v'UUE  @U],UW V @S1ۃED$D$$D$ED$E$vt&߃ t;>t[ @D$ED$$mu˃1[^_]Í& tED$ @D$$pvE  @[^_]Ív'U+$`2@$@+ @&@ = @uÐUWVS }1=v,@t$$rt&9{u,@t$$r$ƍ [^_]UWVS }1 v9{t+,@t$$/ru [^_]t&,@t$$'r$ [^_]UVS,@$/ƋE(@F(@11&@;Fw,@\$$qu,@\$t$$rE D$F$d^[^]s,@f`D$ L$$T$(RPQ a80PD$t D$@D$ă ؋DÐUS]$t\$D$D$ E D$E$[]ÍUED$E D$ D$D$E$q UED$E D$ D$D$E$1 UED$D$ED$ E D$E$UEr @6@0@Ít&UWVS,EUMI=4@G4@0@ Eu&)ċE\$#D$D$$rED$ED$C$E\$t$ |$D$$2t&1 &0@\$$otF;~u0@\$$oE;u|;~t)& jV떍SvދE;u֍;e[^_]&US]EU M][]UEMU u1$E}]ktK@D$G $Í@$\$ƋG 4$D$QqG $<$ ]u}]Ít&'UEMU ]$Eutxv @ 0 t&C 1$$]u]Í&UEMU ]$Eutxv @ 0 t&C 1$K$C]u]Í&U(E uu}}]EEEz0@t`$DÉ0E{C<$/|$ƋE4$D$*s \$0@$n]u}]%t&뙐U 0]Ít&U j0]ÐUED$8@$6l1tÍv'UED$8@$l1tBÉ'UWVS }1]v<$D$t&8@t$$kuԃ [^_]0$C$$8@t$$kUWVS 1t&<$D$:t.8@t$$2ku [^_]Ðt& [^_]É'UE1҅tPÐt&U$@]]uu1ۉ؋u]]Ðt44$n9E r݉4$nt$$D$&$n4$E n$맍vUE]utoU1u ]u]ÍvE $5n$jƋE $n4$D$E D$WE tC$1s롸$tE$m$E $m$҉CthtdE$mD$ED$$E $lmD$E D$C$8@\$$"k8@1$C$$ U]]u$\$D$$@o4$؋u]]É'U(]u}D$=E$>¸tR+ueF)ĉt$E\$$~D$3D$}$|$te1]u}]Ít& @eU8@$=gÍt&'UWVS,EEE EFEEE}&$kEF$k]]x;D$E$EED$D$EE$|$FD$]$EEEED$8@$glED$ ED$E܉D$E$EE,[^_]'UWVSiD$;@$@8@$u [^_]ÐD$ D$D$@$EtЉ‹@ tljB9s&<$hj<$D$tt$<$Hj4$>jUDNjB B9r[^_]ÐUU S]G) ʃ)1[]Ðt& @獴&UU S]G) ʃ) 1[]Ðt& @獴&UU SG,Ћ] ʃ)[]Í @䍴&UVSUMu t@@B@Bt\1ۅt. @[^]É\$$@Ht\$4$4u؃Hu1[^]Í&@F@F@1[^]Í&1 t&Ht\$4$t\$$@p֍&'US@@]uu%@@1[]Í&$ti@B$B@D$@@1[]ÐUED$ D$$1Ít&'UED$ D$$o1Ít&'UD$D$$`@>D$ D$$@"`@t&B@=@uD@ U=D@]]uu}} G~& @&]u}]Ív tՅt4`@d@Ch@Cl@C p@C1t`@Gd@Gh@G l@Gp@1rfKUS]=D@t=G( t#M `@ `@[]Í&[]Ív[뼉'US]=D@t=GH\$$@u`@t$Ѓ1[]Ð1[]v빍 @ U$nÍUEwE]50t&]Í&'UU ~ÍD$D$ D$D$E${1ÐU @]ÍU @]ÍUWVS1ۃ }9~t3 @\$$`u @ [^_]f @\$$`$-"uȉ4$ 1[^_]Í&UWVS1ۃ}9~t3 @\$$_u @[^_]f} tr} t} ft" @[^_]ËF [^_]Ë]F 9t!tD$h@\$ D$8@$!^ 1[^_]Ít&]F9tD$h@\$ D$@$^1[^_]ËE cF[^_]ÍUWVS } @1 f9>tl @\$$p^u$Ƹt> @t$$B` @>@F@FF t&F [^_]u @fU @tÍ#` @`@$d@$h@$Ðt&UVS @t519pt# @\$$o]u[^]Ít&[^]bf&'U(Eu]}t;$D$4$NjED$r t.]Ћu}]f @ލ&Et$ D$D$E $ D$|$4$ څt떍t&U(Eu]}t;$KD$4$NjED$t.]Ћu}]f @ލ&Et$ D$D$E $"D$|$4$\څt떍t&UE]uu}} #tEt$|$$t]u}]Í&]u]}]\t& @ÍUEt&D$ ED$D$E $PÍ @Í&UE]u\tVD$ ED$D$E $x!t]u]Í$u @Ӎv @ UE]t&UVS u ]00 D$L@$h$0$xft^ErtDaDED$$!$t}$5t$D$É$ [^]ÍBBDDtDErE+ufD$L@$#@ @됍&15D$L@$h#uLvEwfvEwE+D$@$ #v$+ @UE D$RD$E$0ÐU$ÍU]wU1]É'U1]É'U]ÍU]ÍU]ÍUE$?J<É'U}׉$]ÉuD$4D$G!$D$D$$ $tD$t$$GG1G,w, O0tAG0G]G@u@G}1] US] D$L@E$t[]v @[]Ít&'Uuu]}} D$L@4$ t%$]u}]Ðt&4$HtI$1HD$4D$<$bGAGG@@G @농v'U(]]}} u$|$t]u}]Í&$D$q@tԋG G\$ D$D$$+G0G$두UWVS1ۃ }u@t&9ljEtG@\$$;Uu @ [^_]$t@`BٍEt1~t01t&ȍ<$t& t~t&uދE tFU 1f@\$$TnU;uݡ@\$$T [^_]fUED$$D$Í'UVSu1 t&;0tk@\$$Tu$ `D$_D$@$@1D$ D3CC@\$$U[^]>&'UWVSE}}Et[^_]1&;8t @\$$RSuމ<$1ۍt&;>tV@\$$Su1D$ D$D$@$@CUFF[^_]jf뿐UUD$P@$@@ÐUED$@D$@$ @D$ gD @UE D$D$E$EÍ&'UED$D$$DÍ'U$@N?1Ív'UEu1}]$DtL$U$fw7D$F|$$Ɔ<$]u}]Ív‰'UE$CɃÍU]WCU1UjR30u]Ðt&UVSE uU]MEEE1QSRjV70t[^]ÐU0]ÐUWVSÃ,E}UM܉EEu=v+EE<:[C)E4$ v@UWVS2L1ɉ‰EE#E$JËE$ IStdfuC.C E\$$K11vD$xE$vItXC$MƋCt+rǍ&CC뗐t&$@DMƉ떍F$mEE$OHuE#&tcu :F/<$mED$E$Ht8_4$\$IL$LƋGu/볍&|E$IE[^_]Í&$hE$GD$E$;H8$膼@@E$XG\$D$E$eIaU0]Ít&UE]P0Í'UMSU ]ESQRP0[] U0]Ít&U0]ÐUEP20]ÐUEP40]ÐU(EE0]@EEEEED$E D$E$Ðt&UED$E D$E$ UEuu ]Et$\$ 4$D$D$ ]u]f4$JҍUUE $T$E ÐU @$@D$ED$n3ÍU`@$Ít&'U]&US$d@]t$D$ $É[]Í&]ED$$?؃$[]fUWV1S }'`@$st4$ t7`@$t7 [^_]f`@$u`@$t1fʍ&'US$d@]tE $D$ $É[]Ít&]ED$$>؃$[]fUSd@]U u$T$>؃[]Í\$D$ D$$ []Ít&US]$^H\$$td@t$ 2[]Ðt&D$@$>ؐt&UVSD$L@$@ wD$ D$D$4$5 Ƅw`@D$D$@4$$`@D$ D$D$$D$L@$@[ )wD$ D$D$4$ Ƅwd@ZD$D$O@4$6$d@D$ D$D$@$D$L@$@ wD$ D$D$4$ Ƅwh@D$D$O@4$h@D$ D$D$$$cĠ[^]Ð`@d@@h@Ġ[^]Ít&D$O@4$ h@vD$@4$ `@*D$O@4$ d@U1]É'U]Ít&'UE@1] U]F&US]U taҋCu@CC{%t't#9t$t&1C%[]Í&1[]Ã}tj}t>}ft[]t&Í&CCCC뀐t&SCMCKb&SCMCKB UED$ D$D$$Ðt&UM UD$ET$ L$$ÍvUU D$ D$ET$$fU(}]uEwqG.)ċE\$wSUKC CT$|$$t$u\$ D$@F$Ɖ]u}]Íu \$KS<$8C $8U|$T$$C\$ D$D$@F$4ƋC $8뀐t&US]u[]Í&Kt{t3Ct,St%Kt$;CuC1봐1C뛐&US$]u$[]Í&KtS1u$ECED$ D$D$'@C$A Uuu]u]u]Í^t4$D$ D$D$4$9t$ D$D$0@F$4$@딍US$]u$[]Í&Ct$ELED$ D$D$9@C$:D$Ë@ D$E$C $賭$諭E뉍US]u[]Ðt&Ct$Cu*E$D$ E T$D$51҄u뱍vC!C$.뼍UED$D$$_Í'U(E]]}}uEE ۉEt[CtTCSuC<s"UE]u]}]<tt&1]u}]Í&C9Crt$D$ E$W$wt&tyvC!C$:vK9Crt$ED$ $/sY&{Cft$ED$CC$sv'U]]u$y>U $D$T$ D$^$T>]9ƋuD]Í&'US$E ]D$D$D$ E]$$ É[]Ít&'Uuu ]]u؋u]]ÐFD$F!$#tӉF!FF\ƍt&'UWVS,}GWE1E E܋UEE UEE)=EU;@v/@Eܣ@$2@$2@@EED$ D$D$B@G$Ë@ <9}sE<D$@D$E$C $v$n,[^_]Ít&1,[^_]Ít&EE 9ЉƉEt/t&WG!)ڃ9UDsW)GD$G!$胯_utRu4ttG!9u܍f]v֍ovɍt͉$v蓨G!9uIvvE<$ED$ D$D$B@G$Ë@<9}sE<D$C $ 1t&'US$]$t$[]Í&E\$ D$D$$YuEɍ&'UEuu]}$ct1]u}]ÍE E~s1& t6;}}.E$3ËE$u"u̓fЍt&뉍vsfnv1v^t&'UWVS1ۃE} $EU1ۉ$9 )čt$<$99s@a<w%$d@vЃ|+uf<$e99rE1ۉ$T9UT$D$F$苷E$09t$ D$K@$D$aU$w t Nun1ۉ<$ܥe[^_]fЃ*|+[+Q@@t&0t&& t&WtFFFFE$]8$蒨FU$T$7$&tËFCFCF C FCFCFCFCF C F$C%C$$'D$ D$$D$C%4$诤v'UD$T@$X@Ít&UWVS] D$L@E$~C$% D$@$N84$t$ D$D$<$uNh@D$D$@@$4$ $ @ [^_]ÐD$\$<$D$ 9u4$Ft&Zf4$$E$W71[^_]áh@D$@$% @eh@D$@$ @11fD$E$cUt 9ڀ}uԃ[^_]f}u1ꍶUSÃD$ D$$衦~8$t 1҃[]f[]Ít&'UWVS${1҉E䍶u@E EU t&B%Euz%BEU uېU]Avt&&u &9}|Mu Cv0f &uE u [9}}t&E[^_]Ðt&EUEHw (uQ A< vY1*a:.tj1D$ U$}ft6_v.D$ M $UeE9hwЃ]t%D$+E$e-UD$T$M $i؉Et&9hw(fTvE9h3D$0E$}9h&w,vE9hD$ M $}6|||11|4|Q||1y||@||EKlj|l9hw#(E9h D$ E$}Fv|) |||E:D$|$M $ht 9ÐE9hw-&vE9hD$ E$}||D$U\$|$U$*9D$-M $e-Ev1`t&UEWVS4 U )k<) ] )k<)Ƹ*ȉsӺ$I)Í[)E HK))ЋU )Jmsm)iҵXE)сFU HBBE H)6; @|}z;; @|fE xQM 6AA +@ȉQ [^_]Í&Ⱥ1)] imC)щKX] S똍BU B덐t&UEEE D$E$;É'UED$@$Ðt&UED$@$Ðt&U@]ÍU@]ÍU1]É'UW1VSLD$EfE%?EMt)E<%t6;} UMUu׋Ee[^_]Ðt&MB0]ÐU0]Ít&U0]ÐUWVSU:D;E w!tGu Z )9rB9E r 19E s#1[^_]Ð)ދZ9wB9E r 9E r݃9w޸[^_]Ít&UWVS}E <$D$pt(71ۅt O11ېt&19à 9r[^_]Ív'UWVSuE 4$D$tCt0111 v 9v|u}D;]uۋEU[^_]ÍUWVS<]$wD$$FFF D$D$$'ta$(EԋEЋV^B 9]ԋP@BM‰JX F ^ uF F$rEEأ @EE؃<[^_]ÍvEE @<[^_]Ít&  UUD$M $Ep)]ED$D$E؉$\$UT$M܉ $d\$E$FU F$E] UMV~HU1fC D$CD$EE$MC K9}MƋVT$D$U$趃F D$$ 4$5rUE ]u$tD$E$^$]u]ÐUUt]Ð&UEtt@]Ív1]t& U$Ét$u 1$t$]Ëtx@t9t)ȉ vt̅u@@@뵋5@9|͡@tĉ)Ѝ&UU Er1҅tP]Ðt&U]]}} utOu;tEr$pk9@u,@9|Qu!@vWu1]u}]Í&tq $[p뛐@ȍ&'U]]u1t#1tr$pk9@t]u]Ít&@t@ݐt&@̍t&US]$xu][]o&U$]]urۉƋEFtM u:3C9@t؋u]]Ít&@9E @܍t&U ؃t21빉'US]t$$FrU PC9@t؃[]Í؃@[]ÐU$q@ÐU1ɉWVS E] 8EEu9ut(t&Љ Tu]1ɅTu*t& ȃtt+M [^_]ÐUVS]utU t&tu[^]Í؃tu[^]ÐUS] Mt1ҍvDDu[]ÐU}}]u<$6p4$kptt$|$$e~؋u]}]ÐU1M9t :u)]ÐUWVuS^E t9uߍɍtJ {E t&9tuɍtE8[^_]Í&1E1E01iҍU E D$@D$E$0ÐU]駹US]D$L@$t$1[]f$Xt$,1[] @ːUWVS]$lE$ƋE D$x@E$Ye4$4P UP()ԍ\$CHCL$t$$V|\$ ED$@D$G$tm3tNe<$4$jU$je[^_]Ítu @t&븍 @롍& @ 뉍& @yt& @aU8}]] u}$l$t|txD$L@E$ED$x@<$EUBU;B @ E$賺U$診 @4$Ii<$Ai؋u]}]f @΍& @딍&$D$@ tE1ۉ$t$ D$D$U$ʻ4$lt&e4$PUP,)ԍ\$CHC L$t$$yUUC\$ ED$@D$UB$OtB&vt ev @ftu @t& @ 뷐UWV EEEUE׋EEu u 9vH1MEEU ^_Ð9ƒEuA9r U9U1Eu 1uƋEf +EEUMM ‰U܋}EMM ЊMu؉u܉щE9r)9tM1;v11/EM9sލvMI1UWV0EEu} EUEUuu}Eu9vhUEM9MvuЉ}fEЋUԃ0^_ÍvEEuTE9ErM9MwUE+EUEMMЉUfEu 1uEUEwv +E؉E܋UMEM ‰U}EMUM ЋuUMuU9Ur7;Ut.M)щM̉ME̊M ‰UЋE̊ME 9s)UǐUS@@t1ېЋ<@uX[QUngueltiger PPB! Files %s and %s differ No newline at end of fileBinary files %s and %s differ Z@D@,@@u@_@@l@c@%ld,0%ld,%ld@@ - + @@*************** *** **** !--- ---- %s %s %ld.%.9d%s %s %s ---+++regular empty fileregular filedirectoryblock special filecharacter special filefifosocketweird file%s: %sOnly in %s: %s standard outputwrite failedinvalid context length `%s'-Dtoo many file label options^[[:alpha:]$_]-Sdiff %s %s %s %s invalid width `%s'conflicting width options--from-fileUsage: %s [OPTION]... FILES Compare files line by line. %.*s %s invalid horizon length `%s'--line-format--to-file%a %b %e %T %Y%l %<%>%=missing operand after `%s'extra operand `%s'binarybriefcontextexcludeexclude-fromexpand-tabsforward-edhelphorizon-linesifdefignore-all-spaceignore-blank-linesignore-caseignore-matching-linesignore-space-changeignore-tab-expansioninhibit-hunk-mergeinitial-tablabelleft-columnminimalnew-group-formatnew-line-formatno-ignore-file-name-casenormalold-group-formatold-line-formatpaginatercsrecursivereport-identical-filessdiff-merge-assistshow-c-functionshow-function-lineside-by-sidespeed-large-filesstarting-filestrip-trailing-crsuppress-common-linesunchanged-group-formatunchanged-line-formatunidirectional-new-fileunifiedversionwidth--help Output this help.Try `%s --help' for more information.conflicting output style optionsconflicting %s option value `%s'cannot compare `-' to a directory-D option not supported with directoriesCommon subdirectories: %s and %s File %s is a %s while file %s is a %s Files %s and %s are identical pagination not supported on this host`-%ld' option is obsolete; use `-%c %ld'`-%ld' option is obsolete; omit it--from-file and --to-file both specified-i --ignore-case Ignore case differences in file contents.--ignore-file-name-case Ignore case when comparing file names.--no-ignore-file-name-case Consider case when comparing file names.-E --ignore-tab-expansion Ignore changes due to tab expansion.-b --ignore-space-change Ignore changes in the amount of white space.-w --ignore-all-space Ignore all white space.-B --ignore-blank-lines Ignore changes whose lines are all blank.-I RE --ignore-matching-lines=RE Ignore changes whose lines all match RE.--strip-trailing-cr Strip trailing carriage return on input.-a --text Treat all files as text.-c -C NUM --context[=NUM] Output NUM (default 3) lines of copied context. -u -U NUM --unified[=NUM] Output NUM (default 3) lines of unified context. --label LABEL Use LABEL instead of file name. -p --show-c-function Show which C function each change is in. -F RE --show-function-line=RE Show the most recent line matching RE.-q --brief Output only whether files differ.-e --ed Output an ed script.--normal Output a normal diff.-n --rcs Output an RCS format diff.-y --side-by-side Output in two columns. -W NUM --width=NUM Output at most NUM (default 130) print columns. --left-column Output only the left column of common lines. --suppress-common-lines Do not output common lines.-D NAME --ifdef=NAME Output merged file to show `#ifdef NAME' diffs.--GTYPE-group-format=GFMT Similar, but format GTYPE input groups with GFMT.--line-format=LFMT Similar, but format all input lines with LFMT.--LTYPE-line-format=LFMT Similar, but format LTYPE input lines with LFMT. LTYPE is `old', `new', or `unchanged'. GTYPE is LTYPE or `changed'. GFMT may contain: %< lines from FILE1 %> lines from FILE2 %= lines common to FILE1 and FILE2 %[-][WIDTH][.[PREC]]{doxX}LETTER printf-style spec for LETTER LETTERs are as follows for new group, lower case for old group: F first line number L last line number N number of lines = L-F+1 E F-1 M L+1 LFMT may contain: %L contents of line %l contents of line, excluding any trailing newline %[-][WIDTH][.[PREC]]{doxX}n printf-style spec for input line number Either GFMT or LFMT may contain: %% % %c'C' the single character C %c'\OOO' the character with octal code OOO-l --paginate Pass the output through `pr' to paginate it.-t --expand-tabs Expand tabs to spaces in output.-T --initial-tab Make tabs line up by prepending a tab.-r --recursive Recursively compare any subdirectories found.-N --new-file Treat absent files as empty.--unidirectional-new-file Treat absent first files as empty.-s --report-identical-files Report when two files are the same.-x PAT --exclude=PAT Exclude files that match PAT.-X FILE --exclude-from=FILE Exclude files that match any pattern in FILE.-S FILE --starting-file=FILE Start with FILE when comparing directories.--from-file=FILE1 Compare FILE1 to all operands. FILE1 can be a directory.--to-file=FILE2 Compare all operands to FILE2. FILE2 can be a directory.--horizon-lines=NUM Keep NUM lines of the common prefix and suffix.-d --minimal Try hard to find a smaller set of changes.--speed-large-files Assume large files and many scattered small changes.-v --version Output version info.FILES are `FILE1 FILE2' or `DIR1 DIR2' or `DIR FILE...' or `FILE... DIR'.If --from-file or --to-file is given, there are no restrictions on FILES.If a FILE is `-', read standard input.Report bugs to .3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@X:@X:@X:@X:@X:@X:@X:@X:@X:@X:@3@3@3@3@3@3@3@3@I:@9@A9@"9@ 9@3@8@8@3@3@8@3@8@3@8@3@3@{8@l8@9@3@,8@7@3@3@3@3@3@3@3@3@7@7@7@7@~7@l7@3@3@!7@3@3@6@3@6@3@6@6@6@6@6@a6@*6@6@5@5@3@3@3@3@3@3@3@5@5@4@4@3@4@H4@94@'4@4@3@3@3@:@:@:@07@07@07@07@Copyright (C) 2002 Free Software Foundation, Inc.Written by Paul Eggert, Mike Haertel, David Hayes, Richard Stallman, and Len Tower.--unchanged-line-format--old-line-format--new-line-format--unchanged-group-format--old-group-format--new-group-format--changed-group-format0123456789abBcC:dD:eEfF:hHiI:lL:nNpPqrsS:tTuU:vwW:x:X:y@@q@@Cʲ@e@x@X@t²@f@Ͳ@Ҳ@@D@w@B @i@@I,@b@@EU@h@Tt@Lz@,@@d@N@@@ȳ@ϳ@@@l@n@r@s@1@pA@FT@ya@Hs@S@@@a:@@@ִ@P@U@v@W%%=%c#ifndef %s %%<#endif /* ! %s */ %c#ifdef %s %%>#endif /* %s */ %c#ifndef %s %%<#else /* %s */ %%>#endif /* %s */ @@@0@p@@@D@t@@@D@@l@ĺ@@@4@\@D@@ܼ@ @l@@(@ؿ@@X@@@@@H@x@@@4@@@@@h@@@@8@@@\@@@@@cannot compare file names `%s' and `%s'%s: recursive directory loop%ld %ld . .. . s/.// a I@I@oI@oI@oI@oI@oI@I@I@I@I@I@vI@vI@vI@vI@vI@I@I@I@oJ@|J@|J@|J@|J@|J@|J@|J@|J@|J@|J@J@oJ@|J@|J@|J@|J@|J@|J@|J@|J@|J@|J@oJ@|J@|J@|J@|J@|J@|J@|J@|J@oJ@N@M@M@&N@M@M@M@M@M@M@M@M@M@M@M@M@M@M@M@M@M@M@M@N@M@M@=?  ''9# )-W 97s;Q/o!7 7]9qe@Ve@e@e@e@2e@d@d@d@d@d@d@d@d@d@d@d@d@d@d@d@d@d@d@d@i%ld,%ld c%ld,%ld %3ld %3ld delete %ld insert %ld subsidiary program `%s' not foundsubsidiary program `%s' failed%ld%c%ld%s%s%s%s %s \ %s diff%s %s %s/usr/bin/prdac(GNU diffutils) 2.8.1Unknown system error%s:%s:%d: %s: This program comes with NO WARRANTY, to the extent permitted by law. You may redistribute copies of this program under the terms of the GNU General Public License. For more information about these matters, see the file named COPYING.POSIXLY_CORRECT%s: option `%s' is ambiguous %s: illegal option -- %c %s: invalid option -- %c %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument _POSIX2_VERSION@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@%I:%M:%S %p%H:%M:%S%m/%d/%y%Y-%m-%d%H:%M@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@k@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@Ƙ@@@@@d@8@@"@@@@ޞ@@@@@Ý@@@@@@@@@@@&@ޚ@@@@@@~@@З@@@@@@@@@@3@@@W@memory exhausted@@@@@@V@@@@@@@@@@@@@@@*@@@@@@@@@@г@Q@!@ѵ@[@S@S@4@@@@@״@״@4@4@״@״@״@@@״@ϴ@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@˿@@@@@,@ֹ@ƹ@@@@@@@@@@@@@@@@@@@@ƹ@@@@@@@@@@@@@@@@@@@@@@@@@@@@s@@@2@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@=@(@@J@@J@J@J@J@J@@@@@@@@@@J@J@@J@K@@J@J@@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@@J@J@J@J@J@J@J@J@@J@c@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@@J@J@J@@p@,Hex D_SuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \)@8@@h@@@[@C@Q@@p@@8@A@q@m@&@@@@7@@@@@A@@*@@@lowerupper A?CWDGET_ENVVWarnung: S_SETFD ändert Flags (%#x => %#x) ohne Effekt Warnung: S_SETFL ändert Flags (%#x => %#x) ohne Effekt lrwaitpid(-1) wait.cwait_child != NULLCHL_EXITUnbekannter Fehler %dtelldir: Nicht implementiert ..:/%s: errno=%d console:/stdinrsconsole:/stdoutconsole:/stderrIO_WRITEIO_EOF IO_CLOSEIO_TELL IO_READ IO_OPEN w+btmp:/create(o@Pn@Pn@o@Pn@Pn@Pn@Pn@Pn@Pn@Pn@o@Pn@Pn@Pn@Pn@Pn@8n@Pn@Pn@Pn@Pn@n@rename: Konnte die Quelldatei nicht oeffnen rename: Ziel ist ein Verzeichnis rename: Konnte die Zieldatei nicht oeffnen rename: Fehler beim Kopieren: %d 0123456789abcdefghijklmopqrstuvwxyz0123456789ABCDEFGHIJKLMOPQRSTUVWXYZuy@px@px@px@px@px@px@px@px@px@px@px@px@px@cy@cy@px@px@px@px@px@px@px@uy@uy@px@px@hx@px@uy@px@px@uy@@}@}@}@}@}@}@}@}@}@}@@@}@~@~@}@@}@}@}@}@}@@@}@}@w{@}@@}@}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@)@__PM%%02i%03i%i%4icmos:/unix_timecmos-Modul geladen? JanFebMärAprMaiJunJulAugSepOktNovDezJanuarFebruarMärzAprilJuniJuliAugustSeptemberOktoberNovemberDezemberSoMoDiMiDoFrSaSonntagMontagDienstagMittwochDonnerstagFreitagSamstag%a %b %d %H:%M:%S %Y%a %b %e %T %Z %YWed Jun 42 13:37:42 1337 @Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@@Տ@Ռ@@Ռ@Ռ@Ռ@@@Ռ@Ռ@Ռ@t@Ռ@Ռ@Ռ@Ռ@@^@J@"@Ռ@׎@Ռ@@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@Ռ@@@Ռ@@x@Ռ@Ռ@@Ռ@^@Ռ@Ռ@.@$@Ռ@@Ռ@΍@Ռ@č@Ռ@Ռ@@Ռ@T@@@@@@@@@@@@@@@@@@@ @@@"@*@3@<@?@B@E@H@K@N@Q@Y@`@i@r@}@@(@1@@@@@@@;Zx0N<[y1Otime():Konnte 'cmos:/unix_time' nicht oeffnen. Ist das alnumalphablankcntrlgraphprintpunctxdigit@@@@@ @@@@@@@@`@@@@@@@@@@@@@Zusicherung fehlgeschlagen: '%s' in '%d' auf Zeile %d rdwdDEV_LISTDEV_REG SERV_GETPATH;LOADELF SERV_EXISERV_REGSERV_NAMIO_SEEK IO_ULINKlwIO_LINK zR| 'AB E<_AB EL@d@?GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2The Netwide Assembler 2.03.01GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (Debian 4.3.2-1.1) 4.3.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2@@1jt@-@ !%@84@@Wv=$F@:D`I@(OdP@~[b@Ca(d@[ij@ { p@B@ܒ@ay@@ȟ@)@ g@p@c@Q@3@2@Q@K@x @a`%@.%@>Q%@9+&@='@E(@~.@D0@V2@gm 7@!P7@M=@yU C@K@)E@K@ 0N@ Q@0k0Q@9pR@d\R@ R@ [@|0\@WP\@p\@V!`]@J%0b@1r@(3 t@= @HD@xFp@H@f;M@?O@Q@YU@V@![@f$]p@SB^Н@^@[a@a@gТ@Ajk @l@Qnm@@-1np@Jo@o@q@ qШ@]s0@w̬@'z@_j=diff_2_files@ print_context_script print_context_header! mainoutput_styleno_diff_means_no_output)context;textMhorizon_lines_ignore_white_spaceqignore_blank_linesfiles_can_be_treated_as_binaryignore_caseignore_file_name_casefile_labelfunction_regexpignore_regexpbriefexpand_tabs#initial_tab5strip_trailing_crGstarting_fileYpaginate{group_formatline_formatsdiff_merge_assistleft_columnsuppress_common_linessdiff_half_widthsdiff_column2_offset switch_stringspeed_large_files-excludedEminimalWprogram_nameitime_format{filesoutfile4diff_dirsPv=Dprint_rcs_scriptpr_forward_ed_script$print_ed_script%Dn P print_ifdef_script1(O file_block_readQ read_files&[print_normal_script%ayprint_sdiff_scriptii|setup_outputfind_changefind_reverse_changeprint_scripttranslate_line_numbertranslate_rangewdebug_scriptprint_number_rangeV zalloc concat dir_file_pathnameA analyze_hunk output_1_lineX print_1_line lines_differ perror_with_name print_message_queuemessage5message"fatalJpfatal_with_name}finish_outputbegin_output)change_letterQpr_program!a{W?version_string){obase_namebase_len1|xc_stack_actionc_stack_die,5~buffer_lcmblock_readr error_at_lineerror9error_print_prognameQerror_message_countcerror_one_per_linejw9excluded_filenamenew_excludeadd_excludewadd_exclude_filefree_exclude|dexit_failure&,W?free_software_msgids_getopt_internalgetoptoptargoptindopterroptopt__getopt_initialized3^getopt_long_onlyLgetopt_long! }posix2_version#vquote_system_argܒ nstrftimewyxxalloc_diexcallocxrealloc xmallocVxalloc_fail_funcxalloc_msg_memory_exhaustedvrpl_mallocȟvrpl_realloczstrtoumaxg %fnmatchp'% re_set_syntaxc re_set_registers regfree regerror0 re_compile_fastmapregcompre_compile_pattern+"re_match_2"re_match;$re_search_2%re_search&regexecq're_syntax_options're_max_failures isprintiscntrlisspace;isblankeisdigitisalphaisalnumisxdigitisupperislower3ispunctisgraphtolowertoupper?%errnoQQinit_memory_managerfreeZmallocrealloccallocdstrtol2oqsortQostrncmp-^strncasecmp strcasecmpzxgzmblenmbtowcWwctomb__internal_mbsrtowcs(mbstowcst__internal_wcsrtombswcstombsdstrchrdstrcmpQomemchr+omemcpy=memsetE9ostrnlenitoa\atolatofstrcoll1strtoldstrtofstrtodKstrtoullatoistrtoul~librpc_c_rpc_handlerregister_intr_handlerregister_message_handler;init_messagingorpc_response_handlerintr_handlermessage_handlerEDtimer_cancel8timer_callbackytimer_registerVrpc_send_string_responserpc_send_int_responserpc_send_dword_responsegrpc_send_responseinit_sync_messagesrpc_get_responserpc_get_stringrpc_get_intrpc_get_dwordpsync_rpc_response_handlerresponses*mnsyscall_psyscall_vagetenv_name_by_indexgetenv_indexunsetenvdgetenvgetcwdsetenv_chdirputenvgetenv_count6rpc_get_envvarsinit_envvars7sigaddsetysigdelsetsigismembersigprocmask^alarmsigfillsetsigemptysetsigactionxsignalraise_signal_default_handler<killU=>dupkdup2closefcntlfileno7pwritepreadZlseekwrite readfdopenopencreat%getppidgetpidiEchmodfchmodmkfifoNmknodumaskmkdirPfstatstatlstatG vwaitpid,waitXwait_child_addqinit_waitpid xstrerrorYk=seekdiryrewinddirtelldirreaddir3closedir_opendir'Zrpcsend_message\nyieldR,io_split_filenameio_get_absolute_pathZio_split_dirnamed get_pidget_parent_pidcreate_processmdestroy_processget_cmdline"nset_rpc_handler#Wyadd_intr_handlerJa)vfprintffprintffprintf_putsn+fprintf_putcV!}perrorgetchargetcputchar,getsputcputsn puts7stdio_initstdinstdoutstderr#J% Eferrorcclearerrfpurgeremovesetvbufesetlinebufsetbuffersetbuffflush7feofufcloseftellfseekdrewindfwritefputs:fputcungetcfread fgetc fgetsu fopen tmpfile: rename freopen61_exit2abortGatexit{exiti3 'divmodulltoa3jprintf_putcsjprintf_putsn"parse_pos_paramsjvprintf{= gmtime_rlocaltime_rlocaltime gmtime6asctimepctimemktimestrftimetimeFHD0vprintfcprintfprintf_putsnprintf_putc8xFsprintf_putcQvsprintfsprintfHiswctypebtowciswupper8iswlowerViswalphatiswdigitiswalnumiswspaceiswblankiswpunctQiswprintoiswcntrliswgraphiswxdigittowuppertowlowerJwctype;Ma_assert;O~]snprintf_putcvsnprintf!snprintfQPdirectory_openndirectory_createdirectory_closeis_directory?directory_seekdirectory_read YUysyscall_timerVdinit_dev_listinit_dev_registercmdline_copy_argvYcmdline_get_argcinit_execute%init_service_getQ__init_execwinit_process_exitinit_service_registerinit_service_get_name![lio_seekV$]create_shared_memoryopen_shared_memoryclose_shared_memory B^ysyscall_putsnq^mmem_dma_allocate.mem_allocatemem_allocate_physicalmem_free:mem_free_physical6[anwait_for_rpcv_and_wait_for_rpccappb_is_valid`ppb_get_argcppb_copy_argvppb_from_argvDinit_execvglist_is_empty list_sizelist_get_element_atlist_removeHlist_poplist_destroylist_insert'list_pushnlist_createjkstrcspnlostrncpynmdstrcpy1nostrdupoostrlen(oQd__strtok_r strtokqrunlinkqoaccess4s io_remove_linkio_create_linkw__udivdi3z__umoddi3fQ@@q@h"intXI5Lf7e~t](e 'eoy.Z%1H id2# 73# pid4# .5# 7# 8z# >9z# :A# 4]4N ,/{ f0} {GP@q@-#FZ,ppbFLFz6HGAI3@c-vl3d@@k@@q< 7IY+,3t@@h"intXf~8at]"}V(O)3(O)O,(O)OD*O+O",3-O.O20hy24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o#0o  lin G 52 p #    n   9|ؓCٓ#s### #ޙ#2>3# >#2#H#<z#@z#D#H[#L#PF#T#Xe#\ C#` #d X #h #l #p #t t#x h#|eof #} $#op .2 /2# T0B#BHp0 P HKP# *N# AQ# TQ# p$Y# _# bz#!iO#rO#_vO#gzO#|~O#O#3O#A" 9,:#:#I;#<# xt@@2^|soldnew}a^__n___`^fdbdbdcdxvdiyveiftgthtitjjkkcloddmduvHx}y}}tlo}thi}xytlothiddxyvk3ddxyvk3WP  Exyx y!Vnt KO@ @ NNnN$N\N!xvPdt~!yvQdt~"#ccdV$ h%[%P%E%:%/%$"H&f&p'z'&#&E''''''&g&"p&&( '''&&17'<( 'M'V'_'j&uk(~ &(P &_'''" '"8&'''"X&"p&'&P') @8 @ 'F'P* @ @'0':"3 @z @5 !3!5  "+%" +{&@ ; ,} -} f3i b p endzXztemzbX endj.BtemDendEjF  ,b4 -a} fc3tgnh4 Xinijjklppp: . -5 ]bi0i1.=-5 i0i1  /73| @@^ 0cmp6 +8 #f93 #e: #p:% +;C +<3 (Uz+Vz "sz+ 1D %R " &^ = &h 2r T2~ L& P (`& & "& & P &$ "&1 &= O&I (' & & & A& p& "& "&Y &e (&q d1 % "8' "P& & & ' & -' "h' & '% 1 % "' & &S& &("'#'/(Z+&*@ @#end3h3d3g`3\$? %Q "'] &i &u X& & & & w" ' ' 4*@4R*@4+@4|/@43@5V5Y51w5{5 5\5515ę652 7@%@Gh"intXI5Lf7e~8wt]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20~ytm$"#3#$3#+%3#&3# '3#(3#)3#*3#+3# 24`uVa#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o #0 { o.Z %1& id2#73&# pid4#.5# 7#8#>9#:A#4<#A=,#!  AO> lin G] 42 |OLDNEW| C #s @# @# @#  @# # | 6> 3# > u#2 #H 6#< #@ #D <#H[ @#L @#PF @#T @#Xe u#\C @#` u#dX B#h B#l B#p @#tt H#xh #|eof #} $@#  u @ ^= 0! ]H K]#* N!#A Q!# T^# p$ Y&# _&# b#! ie# re#_ ve#g ze#| ~e# e#3 e# L&@@g@@Z]@y@G\/\c8_3qX ~!h!d!`!\p"eb#u|@ @$$3@%i@Q&@tp'puz %len3  u(E @H@#)out# u "i3) L* H@@R$  ~+a @+b @&\ ~tx&d ~tt ,*o @ @_ $)&!@tp'!@'g!@#'!@|%i"@%j"@%k"@'&#B' $ub%out%#(x @2!@  w)aw@ )bw@-\y~tx-dy~tt(4!@#@/ )[-@tp.@{.g@.@"i@.uS. u"out#.W/ .&.&R##@$@{ $;@@'$@'@V@(5$@*%@v @2u)inf3 !4u 0$@%@1buf: A2tm< 3D=30$@%@2sec@~  =*  4tm(lL,%@%@( )infK T K -*@@-A-@@5 ]@51 w&E =5 5 5 i5 i5 5 u6 5N6/ 9#(%@@@h"intXI5Lf7e~8wt]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20~y24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o #0V ^0 >`0#f3#MgB#valh3# 6 ;o 3.Z %1id2H#73#pid4#.5H# 7#8#>9#:A#4<#A=#! ; AO>S   F4k h    linG] 4 pOLDNEW 5p#n9  h     '> 3# > 0#2 (#H '#< #@ #D -#H[ 4#L 4#PF 4#T 4#Xe 0#\C 4#` 0#dX 3#h 3#l 3#p 4#tt 9#xh #|eof #} $4#  0 4 p  .m  /m#T 0}#} p? 0! H K#* N!#A Q!# T# p$ Y# _# b#! ie# re#_ ve#g ze#| ~e# e#3 e# L 4 5#len6#>7# 8# buf9#    ?  N  ? K   t / 5  T ! b  #  3%@%@  0%@)&@ st! 2(R,&@&@c!!\&@&@m$0!  &@_'@! "'06"  j"m0"&@W'@  "!lentl  " o " > # .`'@'@A#  -0m#} -0#1 '@'@#7 p# '@ (@# var-$90=$V 0q$"  #st ( 3 (@{2@$+ T}$'0!%d0A%!cmp?}f3% 3% L' L '  ($ )@)@vf % &)@*@ e3_(' >*0((dir+0' (dir0' L 3( 3(fnm0(dir0w))0*0posl)+ 8|2@2@), \h - [3-! [0"3  (p .(msg0(nl0.) 3  0,q o - n -;n3/ip30>q0r/ps 1s32@@@*32GA3C*2@ c*33*4c3t5i3*3;3+6C 4tH6 tO7D 3tP7 tW7 0tl720th , j -'P , k3.8h U *9v *: r.: .X5@q5@: .&K9@9@q b_.' te.w3/(off38  % ; R/*9 : /9 : /&<@<@ 3J0&k>@>@  3]07L ]C@;Cv 3<;^S6 (o@ N;16,@ t6G@6 J@6 M@6a X@6R ^@6v b@;76 !@@ ;<6xM@ &;h6J y`@ R56 @ ~067 ?`@ = .= <3= Y3= 7 @> VpD @> Y @> ]4H @> a @> d4 @> t @>1 w @> { @># ~ @>z  @>  @>  @>  @>  @> @ @>  @>]  @> 0@>  @0{>? k@0> @> B @>  @>  @>9 e @> e @> @>1 A @>k ? @ H>  @>  @> 0 @? 5m` @?/ 9L @;@A  ] A w =r B3=/  > 3@@#F@$h"intXI5Lf7e~8wtye]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20y24`Va#,b#c#d# e#f#]g#9i#_k!# l!#$m!#(n #,o#0 o.Z %1 id2#73# pid4#.5# 7#8#>9#:A#4<#A=#!AO> R!"S### DIR&lin G e> 3# > #2 3#H e#< #@ #D k#H[ #L #PF #T #Xe #\C #` #dX q#h q#l q#p #tt w#xh #|eof #} $#p  .  /#T 0# p} ! ~k #$#%k#Z.&#s@@(A@p0dcmp0i30pQ3(A@A@1d31Y\1Hr31|A@A@r317tdir6t k6!&8"i9!9#:A#4<#A=#!AO>  lin G]4 OLDNEW| SC S#s ڶ# ۶# ܶ#  ݶ# Y# > 3# > #2 (#H #< #@ #D #H[ #L #PF #T #Xe #\C #` #dX #h #l #p #tt #xh Y#|eof Y#} $#Y`$F@AF@5SXDF@aF@J5$WS!dF@F@v5L S3F@G@5)S5i5f0 6l0,6f1L6l1l6tf0~6tl0~6tf1~6tl1~7$7^G@H@X7~)]S7i_7f0_7l0_7f1_tll1_thb7)H@^I@ 8)(SL8f0*l8l0*8f1*tll1*th+8i?8 5/ 90  \> j pc`I@dP@h"intXI5Lf7e~8wt]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20~y24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o #0 o.Z %1 id2#73# pid4#.5# 7#8#>9#:A#4<#A=#!AO>  lin G]4 OLDNEW| SC S#s ڶ# ۶# ܶ#  ݶ# Y# > 3# > #2 (#H #< #@ #D #H[ #L #PF #T #Xe #\C #` #dX #h #l #p #tt #xh Y#|eof Y#} $#Y`r    ##V#``I@I@8SgS9i9Yrlit3p9c(e.I@K@9 out+9!+9! , ):"n,!-S]:#f/}:#c0 ;#c11b;$%9Q;&9d~%e;g#pk;&%9F;'b G((t&@)))*S<+K@?K@*<&,-!K@=M@<out<=rS0=.  th/C=.tl.Vtp&`#cl=#f=&xf1  ks@M@)O@>outqB>qa>q>rS>0ct>0fu?1&2f1y&2i3.9P/[e@/@+3# >#2#H#<z#@z#D#H[#L#PF#T#Xe#\C#`#dX #h#l#p#tt#xhS#|eof S#}$#oS0 HK#*N#AQ#T# p$Y#_#bz#!iO#rO#_vO#gzO#|~O#O#3O#A1$z,&-#.#p/#.0z# C,dP@P@qBwn+Bs+zBt+zB-z Cn.P@>Q@6C~bCzCpCdstCQ@>Q@srcCZDI@Q@Q@CF~H$D>HzqDsLzDQ@R@D~Dccz&E\zZEsipbSR@!S@E~aEaSER@R@ cuS v!7"6#w08#w18#p09#p1999:B:;:;#i< <#n0=z#n1=z>>?B? ?@$@$#l%@ &~'h'p@ 'cA'i |޲ .z   p [ 'eqsK    \ cS S(7$'ip)  z$3)0  Yz$\3$<F A*%S$S@b@F $CF$ScFi&3F'ST(SF+9 ,H -G-AG-G-'I.2.>-JBJ-VvJ-bJ-n4K-zRK.-K-K-K-L-L-M... -6N/ O, -_N-(N-1 O-:P-CQ-NR-YrR-dR-oS-ztS-S- T.-vT-T.-U.0_@ .1H n - V^@b^@-" V1` -1 V -=W - W25H@28zL@2X=K P@2@T@2OCX@3A 4?5O @ 6V6YS6 ]6aS6 d6 t26# ~S66] Sfb@'d@h"intXI5Lf7e~8wt]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20~y24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o #0 o.Z %1 id2#73# pid4#.5# 7#8#>9#:A#4<#A=#!AO>  lin G]4 OLDNEW| SC S#s ڶ# ۶# ܶ#  ݶ# Y# > 3# > #2 (#H #< #@ #D #H[ #L #PF #T #Xe #\C #` #dX #h #l #p #tt #xh Y#|eof Y#} $#Y`o b@c@WS*c@'d@)X|))SUX+uX+Xg+X+Xi,X/Y 5/ 9  \ uz(d@j@h"intXI5Lf7e~8wt]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20~y24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o #0 o.Z %1 id2#73# pid4#.5# 7#8#>9#:A#4<#A=#!AO>  lin G]4 OLDNEW| SC S#s ڶ# ۶# ܶ#  ݶ# Y# > 3# > #2 (#H #< #@ #D #H[ #L #PF #T #Xe #\C #` #dX #h #l #p #tt #xh Y#|eof Y#} $#Y`d0e(d@d@RY+/e~Yto/eYout1+tptab2eYGed@Rf@Z pE ;ZEeNZFemZoutH+t`IeZJe[K=[Lthe@ cPL[[ Ven[ $Ye[  Tf@Vg@'\ S\sep\ \out+tdhwethc2oetlcole]EY#],Xg@h@C]p˶o]˶]i0Ͷ]i1Ͷ]th@h@ ]~ b~!Q#h@h@^?""Swh@j@C^)So^^^g^^i'_j[__i@i@ ]~ b~\@`@# Y# Y# Y# Y#9 e# e$ 5$/ 9+ea j@:w@h"intXI5Lf7e~8wt]"}l(e)3 'e(e)e,(e)eD*e+e",3-e.e20~y24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o #0 o.Z %1 id2#73# pid4#.5# 7#8#>9#:A#4<#A=#!AO>  lin G]4 OLDNEW 5Ep#n9 hf    | C #s ڶ# ۶# ܶ#  ݶ# #f > 3# > #2 (#H #< #@ #D &#H[ #L #PF #T #Xe #\C #` #dX ,#h ,#l ,#p #tt 2#xh #|eof #} $#H 0! GH KG#* N!#A Q!# TH# p$ Y# _# b#! ie# re#_ ve#g ze#| ~e# e#3 e#Lmsg$v&%v#6&#Mtj@j@_'dRj@j@_j@j@`Hj@j@B`n```&`j@j@ !end0a"#$# Tj@ k@Ca S%iS&` k@>k@oaq ]%a^%b^_q _q~@k@k@a'spa\k@{k@ ~ ~ ~ s~mk@l@aP 9lb lP _b'alb'blb(\n~tx(dn~ttAl@,l@b >!pb-,l@l@b %s1%s2%s3)newl@l@*cA 'dirVc bc l@n@c )c, d,Edg,}d,d&e!l0#e!l1Cece)e!ief4f f: g* q p"g)len+0 plg)len n@o@gR bgh/hHOh+H !out R oh)c!L!t"h #eh%o@Lo@*ehho@mp@i HCip yi(btli,outR tpi>pp@r@iv 's1=j's2=!j!t1?v Aj!t2@v jj Aj+h !c1ELj!c2FLwk+ k| L6r@s@Tl  >5s@s@l-argX.i3l.mvl4s@s@/&vtP[s@t@l0{Yl0Ym0^Y@m0CZm0cZm+ .p^'n-arg_X1i`3/>aD2b:n.newcvMn04Tt@ u@an"{SS^SuIu@1u@nJ= H>4u@[u@n} >=-e?3S\u@"v@n+ 13o 3$v@:w@%o2 >Qo/j+vd@//\@v/h@/\l@/p@/UOt@ 3 Y33 7R 38R 3 V3 tE31 w3# ~3 S3 3 3 3 3 4 584/ 9R )5 I<7@ Q 6 c+@ ASB$ob&op'R o  Hd|w@w@p >G>plenIdRt8Nw@x@h"intXf~t]yv{o3w@w@]p   3 d d Bw@x@p X3p &d d04pp^/x@pt/|@Y3r _3 >q{x@y@wh"intXf~t](O"]yodx@Wy@ q ad9q bdq dr lcmdEr mdcr ndr qd rdIUdXy@y@r fdT3r bufTr Td s bpV+s W>sXd \d ]oQsY33y@X{@8 Z!0P:oh"intXI5hf7~t]( 'y.v%1Tid2# 73T#pid4# .5# 7# 8# >9# :]# 4<# A=Z#! : ]O>]4`  O s :Ey@Cz@zs OsOs04s6% tv z@:z@z@:z@+t@Dz@{@It5O5Ov5utf6t0466B%t rG@bH@7{@X{@tOO046%!u 7$ k8$ AK @ 7 H @!21O @ kT5X{@(@8!oh"intXI5Sf7l~t](l 'ly.a%1?id2#73?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K  P'Q#R:#  %  *Y#Z#=[# d X{@V|@5uexaufu=t` uiuk v 'Yv:mv@ vvp  d::  b X|@|@v exc  |@|@ wwex 6w':lw` sŁw :|@x~@wkׁex ٍw: % xܞ+xin݇Wxbuf?wxp?x'xlimxy&Eyc:ye:y : k Vy:x~@@y'xzfx/zx:zx  zr:z0o@(@{exn #: 6x1 K(@(@"h"intXf~t]r v`@3Ss V(@(@"855o/ Q@% >(@0@"oh"intXI5Sf7l~t](l 'ly.a%1?id2#73?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K V ^ >`#f:#Mg#valh:#  % :   n XO?(@N@0{ strئ\{chr:R9P@=@z{@8{::{o;:tdtop<:{tem=?| len_:i`:.| lenp:iq:W| ?GA:@   ? :@@@|GA:|@}  ~  ~ ^ :a:t Ic%v?ހPG,?_p-Ӂ.T'/:0:1:Mv2:G?pK':˅:6:v:6 V a:@0@ GA: @ !?@!v@!.?@!!:@!:@"8z V# p? @# :d@#:h@#h:l@#: @"0@n@%V ^j >`j#f|#Mg#valh|# puoint|h"Xf~t]yu X|0@N@2 GAS| @T2 Uj V= W8C V % H|P@n@ GAC| @D2 Ej F= Gb#p@@ &h"intXf~t]yqvo-3p@@:v.]fs/k e3i4]ƈv#@@P&h"intXf~t](Oy$d@@"arg#Fa%tp len&dӉ  c-I o  {$@ @'h"intXf~t](O20]ytm$" #3#$3#+%3#&3# '3#(3#)3#*3#+3# r3B33 Y3 &[@$@ R)X srcY lenZd3 o  M$@@R R)J~ srcK lenLdƋ$$t*tp$l$  0o$ct*tp$l$1k3aibja4o3b4p3 Bq3 r3 ms3 t3 Du3 <v3 {w3 tmd@ @R s Gda  tp ut3E ns3%3tv? i dp fw#`@D'@O@4@ @ ~}@pad63R73ז83935:3Ea;nr<buf=R TD @39A3hB3g%C3D3@j(3A@}@$uOXa:&3gtm.ltm/lt0o5FOF Y.!c@@Iu"@@   ǟ ڟ#####3_nS3ZS3 S3_nO3ZO3B O3{{30K3ˠ{3Wxd3! u@@)$8"u@@#5% $@R@)$K"$@R@#5! W@x@)$z"W@x@#5|_n3Z3 33@@ltm\t]o"@@dj3_n3Z3 3~l3@lenmd nd6(k_n3Z3T 3@ M7vdH@{@_ne3 Ze3 e3X=b3_ne3Ze3' e3j He duIhJu wlenKd_n\3Z\3+ \3H 4ͪlen5d h_n73Z73E 73 _n3Z3 3# _n03Z03 03_n3Z3 3&b 'b (&u 'b & )b *5M @3&@@&+h"intXf~t](OyC@D@joD@c@nidsid/ pkoO_od@@m p^on^d۰Qo@@BnPd' pRoG r O 3  ;h@T~~o ?8@n}'@@+h"intXf~t](Oy#"@@en!do':@@L,h"intXf~t](Oy.&@@ӱp$n%dAoK(U@@,h"intXf~8at]"}VKWo@@lptrVDVbV3 o (u@@S-a/@@'.IJ,+.1.>p0n0c1ɴnot8ipOhc1t int   o'm)! @N@.h"intXf~t](Ob+]oyz(&)o(.3 )0@ ! 4$ '  O& "(  @$ & $ # U$ $# $ ' " % 9  FA HKA# *N# AQ# T# p$Y# _# bd# !iO# rO# _vO# gzO# |~O# O# 3O#A m"L "3   O# #end#S S# !S# ! >"z | " M( # % $ %  7  ! ! ' & s& v# h& {" & z!  4( l  :! $ G  ($  " E& " !^Y"A3 !'   # # > O# $ O# Nw y%RO# (SO# 'TO# 'UO#K)LF"V% 'Ww O $] f!# "# &# {# &#  U #U# >O# $O# I@@QopPlocARarg3QX@Ʈ@}opPlocAR3Q^3/%Ȯ@@ȷnoplocAarg3FendAYA!AptoA?%@"@oplocAٸ3^3+endAVA!AptoA&@$@ʯ@%O&L@xbAOںpret@7!Ozj%̯@@DpDendA}&JI3}ret%3p1AtpAI'@ @(pATendA}}&J3ڽp1AtpG! @@% pD$endAC}&Jb3p1A?@@dc >ret@ Q~@g@ rz Ͽ{ |O #} }L_  h@ղ@O   {Gx$g dز@Q@ k'c 3d  e #f dmsgh a"i d G!`$30 "r j3k3T(!p$''/AL0Ap2A!>!A# T#a&2$/&3e$^3T@@ r] % d& '( ( ) ( ) ) ( ( ( * ;@* 4@')" +$ c3, 3@!$Q "'-p";!%) -p'"L'"(&*/#+&,!#@ "#>["&?-A3$9 @@\@'5 >6 d7 r8 c= Ac1= Ap1L bO A#R [pY <LZ g,^ t|'d A4"i A$l A"q A&v D.#F@.5ֹ@.@.<@.>@.#9@.-:J@.$_@.>#{@/  '0( 0ϸ@O@""kA1@O@k32PK" % z z0@j@#"" A17@j@ 30x@@S""[ A1@@[ 31@,@""w A1@,@w 30c@@""A1@@30'@@"" A1k@@ 32(>3#>3 B0@w@I""xA10@w@x3'O1@@@""A1@@3/  &, &" & '((8 R)D 0@@"" A1ؽ@@ 32H_& p^% O0H@@I""} A1@@} 30@@y""o A1@@o 32""u A'u 32ret @2ret @|2str ~2(Istr |1@@a#  wt ch 3]'@str9 c0=@˿@"" A1@˿@ 3/Q X &y &m &c 'x) ( ( 06@@"" A1z@@ 30@*@,""A1@*@30@F@\""pA1@F@p30@c@""A1@c@30@@"" A1@@ 30C@@""A1@@30@@""A1M@@30@K@L""A1@K@30t@@|""A1@@30(@@""A1l@@33 @@*& & 1@@( 02"".A'.30f@@6""A1@@30@D@f"")A1.@D@)32&'vA1@@""A1@@31{@@""A1@@34A564z74A5) 3\@@ 'u#3ret@,tp'iO'-@@,'*X.+dxr, ret.@! 3W-s1-s2-len3"p1 Wp2 W]A-3@ @$"r& %'"!(3b"'!(3pos)3* '+3/3>p10A 9#9 = =d@-:@pGA,LHAt~ MA,Pt~T(\ldIO#o"p  zltz p}&JO#j  3-K$J.v @."8@.G(@.#h@.%@.$@.%f[@. C@.1 !Q@.!c@.!vp@.'@.&8@.z'A@.p#q@.P m@.u"&@.&@.t!@.@..(7@.f @."%@.$'@.A @."$A@. n@."w*@.?&K@."^@._(x@.f'?@.7'm@.!8@.' m@.#A@2"M&M2`ptrR$"'xptrY$"2ptr$"&2ptr$"D2BcAmnot2)ptr]$"1K@{@r[25!0e@@srO'P'%0@x@%W25!0@Y@J"CO%-"AZ&1@Y@%W2p'%2'%|2p2A2@idx}32Xc2A1@@notL3x1$ @p @idxl32x/ptro$"2Iptr$"2cptr$"H2}ptr$"q2'0@@'%2"`&`'Pptrj$"s2hptr $"29ptr$"0@@Ur2optr$"0@@r2ptr$"2rA2ptr$" 2a d2#: ## j#$3 2(' rZ 8\@@S&4&(&&1\@@)@)K2@ '% 2X ptr$"l0@@ r2p ptr$"R2 ptr4$"{2 !ptr$"2%!ptr|$"0h@@A!r2[!ptr$"2u!ptrs$"2!ptrj$"2!ptr%$"D20!ptr$"m2H!ptr$"2`!ptr}$"2x"ptr]$",g&`@*"9*!3 @"@"r %!3" !3pos3 '33 3$@S@=D#r ,+>3pos3  3!3;$"r "%"!3"""!3"#3""&3" "'3val3p$3%3#:.$dlim3%3$cz3T@@i%r %!3W"!3?#3w"&3 j'3%D#&#&#&#&#&#&z#&n#&b#&V#'(#;#tp;#tl(#])#*#[@2j%(/$}'( $($)!$#3@ @:&r ,+>3#3 "&3 &% 3@N@f& ,+! b" d s'# & $ 3*ret& 3,' _`,( G@len) 3x&* 1@.@rI O4$"&5&4z&5,!&@,vz@4z3'7p,%TE'@"'4dZ'5,&l'@J'<:2 @A`@@;  c=Ag )CA@@  cBA @@ @@ 3(RA@4@)! cQAU! @@Sv 1 H@2@S (WA@@W@t! cVA!(\A`@u@! c[A!(aA@@ " c`A6";K-/) )@@*<7 @int{-<* )@@R<h"intXf7Z~tyZ](Z)I;J#&K#*Lh#>Mh# 3 Nh#*OM#B)OM;YM#&ZM#WA[#*\Z# >]h#Y*^h#*s3x)z3 ) s cO nz i3  ) ptr*3 v* *3WA~ )d s1 s2d nzQ)kb*k)xW)xjqoZ ) s c3 nz i3d)@@U")@S@"ptr"minM"maj## -:hW#S@@`@ @m@@[@~@@[@u#@@*h*h &@=@!G*`@@#Z">h##sth# maj @@$8#%m`~$x$&'>@?@B$'Y*=zn$7)?3$*@a$pA>%:Bhg%majC%minDM&\)EMX'>Fzk'`@*@ZS3@8@P`)@+@`u@@p`:Dh(`@@L@@:h:(&2@@@X(p('>z(ptr@)minM)(* z):.h)Sn@s@0`@@m( qs.$$7BM*X$*`#@(@i`n@x@^& @@8*'* zd*'> z*(*3p* ~@@@@)R*)b@*2*c @+*eM,3**f3t@**g:@*)h:@*g*k:@**l:@*)m:@-*q.A/* )@@>h"intXf~t]*#]@@*str"*D"+b"3+*$],*%3P,k:&|,('3, o Y3q0*(@@K?h"intXf~t](O!@@,b ,num d(-> dS-* s-*%  tmp& i'3-  3 AF1++@@?h"intXf~t](O3+%3@@-s1# .s2#@.n$dv.oZ1Y++@ @@h"intXf~t](OR+#AyF+43@n @.s12.s22.n3d1/us17g/us28/  o  o ;+%3p @ @/s1$/s2$0us1'20us2(P0cQ2++ @Q%@@h"intXf~t](Ob+3+G3 @!@0sF0+Fd1lenH3Z1iI3m1  o+{3!@3"@1QwczQ1sz1+zd2len|382i}3l2 +~3 o+3@"@#@2buf2wco&3 +d#@#@\3"bufQ3str"3lendP4 wco4 +d4 +3,5 +J5 {+Td#@$@5tbufSQstrSlenSdf+d $@%%@5buf͒5wcs6lendP6+ h+d6+3/7+c7   o+9d0%@Q%@7buf8wcs8len8d3++`%@%@Ah"intXf~t]++`%@%@7p*7ch*38c,Qo3,+%@%@Ah"intXf~t] ,*3%@%@8s1)F8s2)8oT4,+%@ &@2Bh"intXf~t](O,)%@ &@8s&8c'3 9n(dM9p+R    A4(,+&@'@Binth"Xf~t](O)A&@'@l9#,:91,:9.:d9dstB%:srcCY:tDd: }&@   o   |56,+'@~(@ Ch"intXf~t](OR+#A?,%Oy)<'@~(@>;#,:j;c0:3;.:d; t=d; c?zf< dstA< o5 6,((@.@Ch"intXf~t](O,#d(@(@<s"<[,"d=len$d/=  o V,/(@B)@M=Cn.Oy=s.C=b.O= st0IKi1O=y;O/> (t5O YY ,]P)@)@M>stry>E,3]>.3> @c,)@)@?strDJ3)@)@.?1s1s2z,)@*@Z?,ɸ?end?˽],̽_bͽ^neg3?N,3@outb*@ D C, +@ +@.@, end Es, +@@+@Z@K,endb,EV@+@-@@,D@DD*AbD3VAFVAnegG3lBout+@,3-@-@Bsk,1-@.@B1,Db3yx7t-*-.@0@Dh"intXI5Lf7e~t](e 'ea-0Zzo y , >-# 0.#  ,/-k.@/@B,jZC>jZCZ.jCil3&D qZDD.rZup,e/@/@D%-dAD0dA,F4/@0@D4-ED0E-GdiHZE$;HZ8ER-90@0@VE^i:Z,6$@.4 @  R61 @  ,2 @8-*-0@_2@Eh"intXf7Z~t](Z' B(#>)o#--*zo  -&-'#-(O#  -a0@41@E2 -`OE-b2ic3E -O@1@1@Ey -NOF-P2iQ3ZF-,O1@_2@xF -+F-+Oid-OF-52F-<2i=3F-#,@-$O(@9.*-2@7@Fh"intXf7Z~t](Z 'Za-0|Ooz 3 pid4O# .5O# .6o# Z.7z# K.8 '$ B(*# >)o# -$-*Ao .tpids|.sO$;u3"/v_.r2@2@ Gpidp|.pO"/q;.b2@!3@5Gpida|.aO"/a3$.S03@a3@aGgpidQ|.QO"/RO/Cp3@3@GpidA|.AOlenAoZ.B; .A3@3@G-3@ 5@G{pid|H /;0H.oOHZ.;nH.OHV.{"/K`g\xrH}A H!.15@*5@Hpid0| /0;.0oZ.0; ""/2!<.;05@5@H#pid|#I$ /;CI$.ocI$Z.;I%9;I%"/I%+/OI&x.35@6@Ipid|J /;(J.oHJZ.;hJ93J"/J&-O 6@y6@Jppid|J /;K.o;KZ.;[K9O{K"/߉K'.L6@7@K,J|K.JO$L.KoDLZ.KzzL"/M.NzL(.3O4@).:*..0@0;w/6/ 7@A7@Hh"intXf~t]om/ 7@,7@Lc/ 07@A7@L|></P7@=@VHh"intXf7Z~t](Z 'Z3pid4O#.5O#.6o#Z.7z# K.8 o   ' B(#>)o# - -*y(V >)#9*#90+1 T0P7@v7@M$;31M/͙ V /7@7@QM$;3}M/00C7@08@M >BMiD3M/E/08@8@Nd >INi3rN/N |/8@8@N >N/NM0e8@M9@ OR)d9O>dooO9hO 203P9@:@O_ >O9P/3IP/uP9@9@&0 /3:@:@P7/P3P0#3;@;@Pstr"Qsep$1Q/.oOQ >/03;@;@mQ 0\;@<@Q!pidZ|Q.ZOQ">Zo"Z.[z #"/]zud#/^ouh#/_oulB0_oR$i`3up/a /6<@=@RU5=|DR=@=@/AUWR@=@=@>CwR >K9LR #/-l8@ %Y3V>1a1=@C@Jh"intXI5Lf7e~t] 'ey 0#A 1-1   3 N10#:1# 13#010i0ou03=@=@Rs0sR13 S 03=@9>@@S0slS13S0&3@>@>@S0%1%3T 1>3>@?@FT^=3rT0=T1=sUi?3ZU[1os?@?@U0nsUidpZ@@03?@@@U0s13 @@E@@V0s03P@@@@IVi43N13@@A@uVcsig3VcVoldr W iN1 0A@A@CW13oW0B1W0H3B@qB@W1G3X0[SXX1gB@B@qX1{B@B@X<1z3X0k3B@C@Xw pidjz1j3YG!0+w`@!0,@!-D@"Y397@n2a1 C@K@KZ!0P:oh"intXI5hf7~t](" 'D*",Oy.v%1uid2# 73u#pid4# .5# 7# 8# >9# :]# 4<# A={#! : ]O>]4  * ?2 1 |2 1 ' B (# > )# - - */2'8 g2(8#fd)O# 1+O# M2,O# dupO C@4C@@YkfdO1O@C@TC@lYfdOG2OO`C@C@YfdOY2iOZ 1OC@D@$ZfdOPZcmdOZ2[iOX[dD@D@sap%argO[D@D@ap%argO[1POD@E@[g2O8[2\*\i]O=\1:E@E@P\ 2~8F@RF@|\7fd}O\!2iO\1`F@ G@\fdO&]bufF]";f]" ]# 8]#_2]ret] $)2G@G@#^ZfdOO^bufo^";^" ^# 8^#_2_ret#_#2G@4H@L_fd~Ox_" ~_"X2~O_# 82`7f@H@H@[` fdeO`He>e# g8`M7oOHH@I@`fdGO`"HGa">GUa# I8a#M7Qa28 I@,I@a%fdO& ':O0I@J@b-b1Ob(1l2bfdOb# %8c)af 87cJ@0J@|f8Uc*f8~c+:,-2:OJ@K@c99(20 @ (23O@. 68. 78.88. YOB2a1K@9K@Mh"intXf~t] 'Oyo21dK@$K@c2'd0K@9K@dB 3a1@K@)N@LNh"intXI5Lf7e~t](e 'e(e)e,(e)eD*e+e",3-e.e20sy24`Va#,b#c#d# e#f#]g#9i#_k# l#$m#(n#,o#0o.Z%1p id2#73p# pid4#.5# 7#8z#>9z#:A#4]4|  243@K@GK@Ad 3 3  2C3PK@WK@md B3 B 23`K@jK@dN  ޾ 23pK@zK@d   2 2K@K@d =1 33K@K@e 7 ̾2R3K@qL@IeDfQDue2QJeposSse   33L@L@e 3e2JffDRf 2y3L@M@pf xf2xJfz3+g {DTg M@M@dir rg | 33M@)N@gg2Jg34hfDRhM@)N@buf}2(@ Y3OD,3a10N@P@Oh"intXf7Z~t](Z 'Z' B(#>)o#- -*o y 33 )  pid*|#3+ #,3# u3BCCpidA|iC333DC W3nvpidm|io333pC3|0N@.O@ph&pid|h&#i3Ci33CWiHN@kN@#.ui7IN@$O@V(aij 3'3|0O@SO@iX&f3T`O@O@ipidS| j33VCoutfO@xO@O@V#@.4j7>3P@P@Rjqpid}|~j.}O>}ojZ.~zj33C k XK#p.)k7!#.9#:A#4<#A=f#! _o AO> R!"S### _  DIR&l%" >&"#D'#>(l#)#*#b+# _2  4-4t0Q@RQ@ksdirss s~ 3i`Q@Q@kdirhs3]~Q@Q@ ldir\s3C'Q@7R@6l'dirBsbl3D-l3Jl3P'l w 2"453@R@ZR@l_dir4s4*s`R@iR@m >) _VG@6/pR@R@)Rh"2>intXf7e~t]orpc"pR@R@Jmpid!Zvm #ZP +42>R@R@mDpid0Zm 0Zm .0Z nlen1Z,n Z.1zWn 33P 84:Th ZT DHG46/R@R@Rh"intXf~t]oA4R@R@vn(H|4R@[@Rh"intXf~t](Ooyo' B(#>)d#--*  & (5 5 4 5q4/ 51&/52#W53#5&# o64p]pcwd}4v53O4]pr5pcwd}4v5(3i)35FvDlenEd/5EW5E4Gv o4iR@'U@n7hn]hpnh3 o85jugposk*o5luh/5mul4nvo4wdo !!!! "#.T@xT@(!!!!( "#xT@T@[!!!!@ "$T@'U@!!!!X "%4}0U@U@Ep&7qp4v'4pp(`U@U@'}p'.dp@5@]pi3j434v)5:d]9p>;di<34=v4_]]pH]}4^ib34cv%{5}U@Y@pZ&7 q4v*4pud53'>deq'4}xq+6HV@V@r!Cp ,Nq"Y"d-| ! ,q,q",q,r- !!, Dr,)mr,4r+@HX@X@!!R@!"^,jr"t.X@;Y@!!!p!,r,r/a5}Y@[@s&72s'QD}Rs*]pul'>d}s'4vs-@!+!R!"^,js"t.Z@#[@-!!!!,s, tK56/[@,\@Th"intXf7Z~t] 'Z(Zo5'o[@[@t pid(oKt58o[@[@^t pid7o 9ot5Vo[@\@tm 5TO uidTz 6T TUo pidWot 5k\@\@t 6z \@,\@u {4uRL)66/0\@C\@9# :]# 4<# A=Z#! : ]O>]4`7  O :6  O  O  :h6   6v# u6#arg#6##fp$## k_64Op\@\@ufp3#3ap3%65 t66h`6<O\@\@ufp;#;ap=%*>OP6/O\@*]@u%arg.%#v,+.Cvn.Oyv  6(O0]@R]@varg'%c':vQN+76`]@*b@Vh"intXI5Lf7e~t](e 'ey.Z%18id2#738#pid4#.5# 7#8z#>9z#:A#4o AO>  _ >]4K 73 7`]@]@v04Yo]@]@w83]@]@u{888^@^@wR)8wpos3,xc3Jxo"63^@^@hxc3xg2^@^@cs>u{63^@L_@x nexstrY8y83P_@_@zy7strYy 7/_@*b@y~>70z71~~>2zV>V37)@ $`@ %d@&h@Y3 P760b@r@HXh"intXI5Lf7e~t]o(e 'ey.Z%1?id2#73?#pid4#.5# 7#8#>9#:A#4<#A=E#! z AO>]4K3pid4Z#.5Z#.6#Z.7# K.8a 7id8#79#8:#7;Z# [7<?Iid@#7A#8B#7CZ# Z.DI# AX s8EOyidP#8QcUidV#7W K  z=8& zres {K#8 |#%]8g2 V72%>173Eg2%0b@7b@ezc8@b@Eb@z83Pb@ab@zg2B_3pb@yb@z^93b@ac@{_g2A{H?{3{> S7_"" ?out8b@ R8R3pc@c@|g2Q=9M3c@c@?|g2LHL?>L8G3c@c@k|g2FHF?7d@d@|src|7|8}g2}>J}9h}#88/{}d@d@Z.}  A  X83e@xe@}7g2}>~83e@e@,~ug2X~ +8yp!73e@tf@~"g2~#Z~/9hsf@ g@g2g: 8npos|/w 7N3g@g@dg2M MsX2M3H$(9g@g@tg2!9g@&i@Z.̀78 g2Y>8830i@i@:%str7g27f8%3i@i@c$3=g2$&ch&zu{l83i@5j@\c3g29E!8@j@l@ "R) "7d"8"g2ԃ#H78 8\'0" />(H")'`" /*̄>,`k@8l@*i3+9E8F3l@l@ g2E<,cGzr78]?m@m@u R)\?.\3g2\,i^34,c^3R!8Km@p@p "J"J-8L?up.msgR +7SE*iW3#/~#g2:/"+S7_ z 08p@,p@7l30p@q@ 59k܇8k Hm _7n|7o,srcq2,dstx[/".} A 1!7r@r@M "7Lj""u7#a =+7V-m7-@-'.Z@-8/@282 Y3RN96r@t@[h"intXI5Lf~t](Zoy' B(#>)o# --* G3er@Rs@[ d3 msggd /hzVi,A, 3a9E`s@ts@G9M3s@s@҉s Lus H31s@t@ 03*s@ t@i43U 5u U9(@Y3 S:6 t@@\h"intXf~t]Z!qP{o73 d {63 d 3 { h6  6# u6# argd#]: ;9:+: ;9g99 90 ?:39:>:O9V:99{D D : D#9 ]#9}'9|buf|;|O:2V t@t@h:1Vp91OҊx9193Vrem4OO:Lt@Ju@.9KVIbufKz9KO9KOƋpMuX9N.u`OVPOx9QOup 93Pu@wu@1m6m]c{:3u@v@6m,+ n3)"i3vp:3 ;3 v@ev@!":Ӎ"$;3#:-pv@z@!,;$ap,f%;.ud"#/3D%$;03ul":03o":03Đ"913":23X&i33#U:3z@@đ !6m!($apf &t"p:3"1{P"D  OQ";!O"."O"I:#O'$O"~:%3$";&`(^:?z@)"&ret23)" &ret=3)#'",+)@# &len3q&pad3)p#e&ret3.*@1@&ret3)#&ret3*{@|@&ret38*@@+ret3P)#&ret3,@؉@&ret3̟,=@_@&ret3,*|@|@E&retX3v)#-bufl %9m])$&ret~3. $}/01])H$ +buf "k:3)$ &len3*@@+ret13P*@@!&retH3P*@@@?&ret 3y)$Y&ret#3*@ņ@w&ret?3*؆@@&retC3+*@)@&retE3T)$&ret-3r)%&ret3Ǥ,؉@@&ret)3*@@ &ret^3f)%: "9:)H%T "9V*@@r &retS3$%&retY3X)% &c{%&ret3, @@+retc3P2{ 3 45{6 BV6 @@7`h"intXI5Lf7e~t](e 'e20sytm$".#3#$3#+%3#&3# '3#(3#)3#*3#+3# o.Z%1 id25#73# pid4#.55# 7#8z#>9z#:A#4@]4 )  ; *; \; ; h; +< < 0< ; ; &< x; Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec !< A< ; ; }; /; ; Sun Mon Tue! Wed" Thu# Fri$ Sat% ;& m;' ;( AM) PM* ;+ <,| @@;{+{K;k;3<3;}&@   `@@Ч <__J<bu|F<o@ @  <na;@+@(6;;0@:@Tb;b htm@@J@ <ԋ;P@W@ <݅z`@@بstrW;z<4;tmbЩi.c.>znz7I;N;H;i .3..;D@@˫tCEut;G P  3& tm"@5<%L@<;&L@r,;3@@b,X66@i@0bZ!0P:oh"intXf~t]y7O :6O O : h6  6# u6# arg#V:<O@@yc;ap;%6=la6CO@ @BapD%*EOP6,O@P@Ѭarg+,++n+O3len-O6%OP@i@iarg$c$:5Y<6p@@bZ!0P:o7LRggn:int 6{gng : h6  6A# u6p# argn# m<  H!# p:" #:~P<&gp@@Karg%Kc%:z<-g@ߑ@H, ,7ap,%W6.l]</`*0gw{<<g@@H;;ap=%*>gPiZ =6@v@%ch"intXf~t]b+3oy(&)d(.3} > #  # o <3 wc} <3 wc} <30 wc} <3M wc} <3| wc} t <z3 wcy} <l3 wck}=P3@@wcO}DO+]} @3@c\3@@T@-8|`@t@YV@@t@@M@@ݯ_ 0@@(BT=3 @9@wc}<3@@|@Qwc}0%;MP@X@@@o%<3@@-wc}<3@@Ywc}<3@@wc}б=}@@wc}<}@%@:Jwc}f=80@v@ >7i93 < @ [/=6@@!doh"intXI5Sf7l~t](l 'ly.a%1?id2#73?#pid4#.5# 7#8#>9#:H#4<#A=E#! % HO>]4K 8='@@ @=%= %h p%: $=&:  % 8 Vz\=6@@dh"intXf~t](OZ!|Po73 o 63 o 3 h6   6# u6# argo# T= "W H#W# =$d# p:%d#s=)3@$@޳arg( c(@ J=C30@@!HBW>BdٴBapBq$6D db=EX*F3DK=U3@@WHTW>TdTapVq*W3P]=6@@keoh"intXI5Sf7l~8~t](l 'l20y.a3/H%1`id2#73`#pid4#.5# 7#8#>9#:H#4<#A=f#! % HO>]4l % >&#D'#>(s#)#*#b+# %   4-=$!!QD#' l -%=*:Pg2)!@ە@n=C@@QDB'۵g2D w2@@D=P @P@E?QDO'qdirQ!&@9@Q)e2?@L@S=>:P@Y@g2=! =X2=:=0`@@۶g2/!5=  _-6/@Ֆ@vfh"intXf7Z~t]o=!@Ֆ@[- O- Op__>@@fh"intXI5Lf7e~t](e 'eo 3 pid4Z# .5Z# .6z# Z.7# K.8y >HJE >KE# DL3#@ >Mz#D 0?NU#H U? Ad%>3@1@?res3"/Ʒx>3@@j@dev>z@>p@ݗ@S6ؒ<@S\GAz|pos3>3@M@6 GA3uppos3$R>P@˜@76GA3csupret3@ %>CИ@@vQ >B>l@T@;cmdkι#k3pidm<>pzuhq;'?rul3>zp?zV.J%7>Ydirʺ &>z>h J Y h wf>X`@ @W3>YmsgZ>1@Μ@H >0>2msg3 ?NМ@@tpidM1aO?V?@f@Rhh"intXI5Lf7e~8wt](e 'ey.Z%1Cid2#73C#pid4#.5# 7#8#>9#:A#4<#A=P#! Io AO> HidI# Jl#X2K3# ?Ld V F?.@f@ g2-̻ -l X2-3 9?/da?6/p@Ý@ih"intXf7Z~t]?%zo?Op@@O>O idO{?z@@ idO ?o ?@Ý@ͼ idOb@6/Н@@ih"intXf~t]otd?3Н@@nOsni c@6/@@ih"intXf7Z~tyZ]u@$h?%o&p@'#@(z#b@) }@! > O 1 O ptr" @1@%.  h @1@@^@Q>0O10O ptr2P&2h&p)@7`@{@}>6O6O16O ptr8Y@G3@@3Q@F>FOHOս?@U@@Q@T>TO$d@6/@ܞ@jh"intXf~t]o@@̞@@ О@ܞ@@ld@@Ȣ@jh"intXI5Lf~t](Z)3 'Zo A$ A A @ ) D*# 9+z# len,o# LA/& num0o# 7A1&#5 A4z ppb5z# @6o# gA7o# @8o# ]AQoldP@PoAPonewRA"A>b?5tAY@L@lYppbzo oleno.Aomi3Q?A3P@@ppbzoi3RGA3A@@+ppbzAol@+GA3 i3Qarg 3Ab3b`D`9alenao Aco $;d3newe!"""!#$@3bshm3 >opi3 3A3 z @@3 @@9@9b shm36p9b%&&&#%1&"a"V"K"B&&'l#w#(Y@@k"""&'#) '"&8'##''''#?A@Ȣ@'* Ţ@9Sshm3sretȇ+Y3f9BBТ@@Olh"intXf~t](O' B(#>)d#-(&##9$o# -*q mBNТ@@ ]M  WBVd@@7 ]U A @@R ]~ $;3R~n3 Ao@@0 ]\ $;3|EBݿ{Bo@b@H]$;39 oGEB&X'B(p &Bop@ܤ@ ]B9oJBB@ @$ ]AP B@@{' ] $;3 9oBx@@BW /Bh@@un ]g 9go4m aB6@@]7A+@B,3@@B-@gB+ @ڦ@Zmh"intXf~t](OB&zyB%d @ڦ@/s$[%${s1* bit+o tbl,Lidx-3  o ohB+@1@mh"intXf~t](OB*@1@dst)src):n)drp'd,Qs-R o  FiB+@@m@Cnh"intXf~t]B#@@m@to""B$o iC+p@@nh"intXf~t](O C&p@@)str%Ulen'dC( o  QjC+@ާ@nh"intXf~t](O"C$d@ާ@str#s%R oMj)C+@@.oh"intXf~t]>C2@@s18C112C3tok3#c43Wsc43j PC@ o   IC`@@} s_8C_a@k\Ca1@ɨ@oh"intXf~t]yoUC'3@ɨ@'kleCa1Ш@-@oh"intXI5Lf7e~t](e 'eyo.Z%1?id2#73?#pid4#.5# 7#8z#>9z#:A#4]4K  DIR&K nC&3Ш@-@ 7%%3f)N'dir-l  V dY3lD0@ˬ@ph"intXI5Lf7e~t](eo 'ey.Z%1?id2#73?#pid4#.5# 7#8z#>9z#:A#4]4K  Z D[#C\#C^z# >_#  a,D`dcCd#Cfz# >g#  aCh C30@@C3LD?ul>D?YC@Cw'Cz>zH#8  V  a  uC33@ˬ@C1C1CYD243 D5wC6>DG?LDH?&C_@C=@C2@ @ˬ@Cmze>nzxHo#8r  a Y3nDbD̬@@qint~]ohf"D%D,DXDtEDDE DDDlow`#D`#  s llv D DM nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww Dkm1km0k E_̬@@n^d^'`A7-'LWbm!xt`$@'@p@@GpgoDbD@S@rint~]ohf"D%D,DXDtEDDE DDDlow`#D`#  s llv D DM nL dL rpLnnN ddO rrPd0Qkd1Qkn0Qkn1Qkn2Qkq0Rkq1RkbSkbmSkww Dkm1km0k#ES@S@uRvRuwT'VA7-(LWbtPmxRd@h@'Į@S@Ec% $ > $ > : ; I  I$ >  : ;  : ; I8 : ; I8 .: ; '  4: ; I ' .: ; ' @: ; I: ; I4: ; I4: ; I 1X Y  41I!I4: ; I? < % $ > $ > : ; I : ;  : ; I8  I&I $ > : ;I  : ;  ( : ;I8  : ;I8  : ;I!I/ &I : ;I 8 .: ;' I@: ;I: ;I : ;I 4: ;I.: ; ' I : ; I4: ; I4: ; I  4: ;I .: ;' @!4: ;I " U#4: ;I$1UX Y%1&41'41( U) * +4: ;I,.: ;' -: ;I..: ;' I /.? : ;' I@0: ;I11UX Y241 34: ;I 44: ; I 54: ; I? < 64: ;I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I &I  : ;  : ; I8 $ > : ;I : ; ( (  : ;I8  : ;I8 I!I/  : ;I 8 .: ;' : ;I 4: ;I.? : ; ' @: ; I1UX Y 1 U 41!41 "4: ; I#.: ;' I@$: ;I%4: ;I&4: ;I '4: ;I(.: ; ' @): ; I*.: ;' @+: ;I,&I-4: ; I .4: ; I/ U0 14: ; I 24: ; I34: ; I4&I54: ; I? < 64: ;I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I &I  : ;  $ >  : ; ( : ;I : ; (  : ;I8  : ;I8  : ;I!I/ &I : ;I 8 .: ; ' I@.: ;' I@: ;I.: ;' @: ;I 4: ;I 4: ;I!4: ;I ".: ;' #: ;I$1X Y%1& ' U(4: ;I)4: ;I* U+.: ;' @,.: ; ' I -: ; I. /4: ; I04: ; I1.? : ; ' I@2: ; I34: ; I44: ; I 54: ; I64: ; I 74: ;I 81UX Y941:41;1<< =4: ; I? < >4: ; I?  ?4: ;I?  @!A4: ;I? < B5I% $ > $ > : ; I  : ;  : ; I8  I &I  : ;  : ; I8  : ;  I!I/ $ > : ; I: ;I : ;I8  : ;I8  : ;&I.: ;' I@: ;I4: ;I .: ; ' I@: ; I U4: ; I .: ; ' I : ; I : ; I!4: ; I"4: ; I# $ %.? : ; ' I@&: ; I'4: ; I (4: ; I )1UX Y *1+ U,41- .41/4: ;I04: ;I1' I2I35I4: ; I 5&6< 74: ; I? < % $ > $ > : ; I  : ;  : ; I8  I &I  : ;  : ; I8 $ > : ;I : ; ( (  : ;I8  : ;I8 I!I/ .? : ; ' @: ; I .: ; ' @: ; I4: ; I4: ; I4: ; I  U4: ;I? < % $ > $ > : ; I  : ;  : ; I8  I &I  : ;  : ; I8 $ > : ;I : ; ( (  : ;I8  : ;I8 I!I/ &I.: ; ' I@: ; I: ; I.: ;' I : ;I: ;I4: ;I4: ;I .: ;' I@ : ;I!: ;I": ;I #4: ;I$ U%4: ;I& U'1UX Y(1)41*41+ ,!I-.: ; ' @.4: ; I /4: ; I04: ; I1 : ; 24: ; I3: ; I 4.? : ; ' @54: ; I? < 64: ;I? < % $ > $ > : ; I : ;  : ; I8  I&I $ > : ;I  : ;  (  : ;  : ;I8  : ;I8  : ;I 8 .: ;' I@: ;I4: ;I4: ;I.: ;' @: ;I4: ;I .? : ; ' @: ; I U4: ; I.: ; ' @4: ; I.: ; ' I@ 4: ; I!.: ;' ": ;I#4: ;I$ %.: ; ' &: ; I'4: ; I( : ;) *.? : ;' I@+1UX Y,1-41.41/1UX Y0 11 U24: ; I 3I4!I/ 54: ;I 64: ; I? < % $ > $ > : ; I  : ;  : ; I8  I &I  : ;  : ; I8 $ > : ;I : ; ( (  : ;I8  : ;I8 I!I/ .? : ; ' @: ; I .: ; ' @: ; I4: ; I4: ; I4: ;I? < % $ > $ > : ; I  : ;  : ; I8  I &I  : ;  : ; I8 $ > : ;I : ; ( (  : ;I8  : ;I8 I!I/ .: ; ' I@: ; I: ; I4: ; I 4: ; I4: ; I4: ; I  : ;  U.: ; ' @  4: ; I!.? : ; ' @": ; I #4: ; I? < $4: ;I? < % $ > $ > : ; I  : ;  : ; I8  I &I  : ;  : ; I8 $ > : ;II!I/  : ; ( (  : ;  : ;I8  : ;I8  : ;I 8  : ; .? : ; ' @: ; I .? : ;' I@: ;I .? : ;' @: ;I4: ;I  4: ;I!4: ;I"' I#I$' %: ;I &&I': ;I(4: ;I )4: ;I* U+ U,4: ;I -4: ; I .4: ; I/4: ; I 0: ; I14: ; I24: ; I34: ; I? < 44: ;I? < 54: ;I?  64: ; I?  % I!I/ $ > $ > 4: ; I?  &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I .? : ; ' I@% $ > $ >  $ >  I&I.? : ; ' I@ : ; I '  I .? : ; ' @ : ; I4: ; I4: ; I 5I4: ; I? < % $ > $ > : ; I$ >  I&I.? : ; ' I@ : ; I : ; I 4: ; I 4: ; I 4: ; I4: ; I U4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I .: ; '  : ; I 4: ; I&I.: ; ' @: ; I1X Y 1 41.? : ;' @: ;I : ;I4: ;I U4: ;I .? : ; ' @: ; I 4: ; I? < ' 4: ; I?  !4: ;I?  % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ >  : ;  &I .? : ; ' I@: ; I4: ; I  U4: ; I4: ; I4: ; I&I' II.? : ; ' @: ; I : ; I : ; I' .: ; ' I@4: ; I? < % $ > $ > 4: ; I?  5I% I!I/ $ > $ > 4: ; I?  &I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  &I  : ;  ( .: ; I@: ; I: ; I .: ;' @: ;I4: ;I4: ;I 4: ;I U4: ;I U.: ;' I : ;I.? : ;' I@1UX Y1&I.? : ;I@ : ;I !4: ; I "4: ; I? < #4: ; I?  %  : ;  : ; I8  : ; I8  I&I$ > $ >  .? : ; ' I@ : ; I &I .? : ; ' I@% $ > $ >  I&I.? : ; ' I@4: ; I4: ; I U% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I U  I &I% $ > $ > : ; I : ;  : ; I8 .: ;' I : ;I 4: ;I .: ;' I@ : ;I : ;I  I&I.: ; ' I : ; I4: ; I: ;I4: ;I&I.? : ;I@4: ;I 4: ;I4: ;I : ; U4: ;I  U 1UX Y1 41!1X Y" #41$1%1X Y&I'!I/ ($ > )!I/*4: ; I % $ > $ > : ; I .? : ; ' @.? : ; ' I@: ; I 4: ; I 4: ; I? < 5I ' 4: ; I?   II!I/ $ > &I% $ > $ > : ; I.? : ; ' I@: ; I I% $ > $ > : ; I.? : ; I@: ; I I% $ > $ > : ; I.? : ; ' I@: ; I : ; I  I &I $ > % .? : ; ' I@: ; I4: ; I : ;  U U4: ; I $ >   I &I $ > % $ > $ > : ; I I' II : ; ( : ;I  : ; : ;I8 : ;I 8  : ;I8  : ; : ; : ;I : ;.: ;' @: ;I : ;I : ;I: ;I4: ;I4: ;I.: ;' I@4: ;I4: ;I&I4: ;I .? : ;' I@ .? : ;' @!.: ;' I ": ;I# : ;$ %1UX Y&1' U(41)41* 1+.: ;' ,4: ;I -: ;I. : ;/1UX Y0 1 2 U31X Y4I5!I/ 6$ > 7!I/81X Y9&: ;41 <4: ;I?  % .? : ; ' I : ; I$ > .1@1 .? : ; ' I@: ; I 1 : ; I 1X Y  1 1X Y .? : ; ' I@% 4: ; I?  $ > % $ > $ > : ; I : ;  : ; I8  I.: ; ' I .: ; ' I  : ; I 4: ; I  .: ; ' : ; I4: ; I 141&.? : ; ' @.? : ;' @: ;I4: ;I U4: ;I1X Y1X Y 41 4: ;I 1X Y!.: ; ' I@": ; I#4: ; I$ U%1UX Y &.? : ;' I@': ;I(1UX Y)41 *4: ; I +4: ; I,&I-4: ; I .5I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I 4: ; I? < % $ > $ > : ; I.? : ; ' @: ; I: ; I4: ; I 4: ; I 4: ; I  ' I I I&I!I$ > % $ > $ > : ; I.? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I .? : ; ' I@% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I 4: ; I 4: ;I 4: ;I.? : ;' I@: ;I 4: ; I 4: ; II!I/ $ > .? : ;' I@% $ > $ > .? : ; ' I@: ; I4: ; I  I&I% $ > $ > .? : ; ' I@: ; I I&I% $ > $ > : ; I.? : ; ' I@: ; I U4: ; I   I & &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I : ;    I & &I% $ > $ > : ; I .? : ; ' I@: ; I: ; I 4: ; I  I% $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I  I &I .? : ; ' @ 4: ; I U4: ; II!I/ $ > 4: ; I4: ; I.? : ;' I@: ;I 4: ; I  : ; : ;I : ; I : ; I % $ > $ > : ; I  I' I $ >  : ;  : ; I8 I !I/ .? : ; ' @: ; I4: ; I4: ; I4: ; I : ; I .? : ; ' I@4: ; I4: ; I?  % $ > $ > : ; I : ;  : ; I8 <  I $ >  : ;  ' .? : ; ' @ : ; I4: ; I4: ; I.? : ; ' I@: ; I 4: ; I4: ; I % $ > $ > : ; I  I' I  : ;  : ; I8 : ; I8 < $ > .: ; ' I : ; I: ; I4: ; I.? : ;' @: ;I : ;I .? : ; ' @.: ; ' I@: ; I: ; I4: ; I1UX Y 1 U4141I !I!.? : ;' I@"4: ;I#: ;I$: ;I%4: ;I&.? : ; ' I@'.? : ; ' @(4: ; I )4: ; I? < *4: ; I?  % $ > $ > $ > .? : ; ' @% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I < .? : ; ' I@: ; I4: ; I.? : ;' @: ;I4: ;I4: ;I.: ; ' I@4: ; I4: ; I.? : ;' I@4: ;I : ;I : ;I UI!I.? : ; ' I@ .? : ; ' @!: ; I": ; I #4: ; I $4: ; I %4: ; I? < % $ > $ > : ; I : ;  : ; I8 I!I/ $ >  I '  I  : ;  : ; ( .? : ; ' I@: ; I.? : ;' I@: ;I: ;I &I4: ;I4: ;I : ; I .: ; ' @4: ; I: ; I&I4: ; I.: ;' @.? : ; ' @ : ; I !4: ; I "4: ; I? < % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I  : ;  ( <  : ; .? : ;' I@: ;I .? : ;' I@: ;I : ;I4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I : ; I.: ; ' @ .: ; ' I@!4: ; I": ;I#4: ;I$&%: ; I &: ; I '&I(4: ; I ) U* U+I,!I/ -$ > .4: ; I? < % $ > $ > : ; I$ > .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I $ > .? : ; ' I@ : ; I &I.: ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I I!I/ 4: ; I 4: ; I? < % $ > $ > : ; I  : ;  : ; I8 <  I $ >  : ;  : ; I8 .: ; ' I : ; I4: ; I4: ; I.: ; ' .? : ; ' I@: ; I: ; I4: ; I1X Y 1 U41411X Y : ; I .? : ; ' @ : ; .: ; ' @ 1UX Y !1UX Y ".? : ; ' @#4: ; I $4: ; I? < % $ > $ >  I.? : ; ' I@: ; I 4: ; I I !I/ $ > % $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > : ; I : ; .? : ; ' @: ; I : ; I .? : ; ' I@: ; I4: ; I&I% $ > : ; I$ >  I$ > .? : ; ' @: ; I 4: ; I .? : ; ' I@ : ; I I !I/ 5I% $ > $ > $ > .? : ; ' @% $ > $ > : ; I I : ;  : ; I8 < $ >  : ;  (  : ;  I!I/ .: ; ' : ; I4: ; I4: ; I.: ;' : ;I4: ;I4: ;I.: ; ' I : ; I&I.: ; ' @: ; I4: ; I 4: ; I4: ; I U 1UX Y !1"41#1X Y $1X Y %.? : ;' I@&: ;I'4: ;I( ).: ;' I *4: ;I +1X Y,41-1UX Y.1X Y/.? : ;' I@% $ > $ > : ; I I$ > &I.? : ; ' I@ 4: ; I : ; I 4: ; I : ; I .? : ; ' @.? : ; ' I@% $ > $ > $ > .? : ; ' @: ; I '  I% $ > $ > : ; I$ > .? : ; ' @: ; I % : ; I I$ > $ >   : ;  : ; I8 : ; I8  I ' I I &I : ; .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > &I .? : ; ' I .? : ;' @: ;I .1@.? : ; ' I@: ; I : ; I 4: ; I : ; I4: ; I1UX Y .? : ; ' @4: ; I4: ; I I!I/ !I/4: ; I?  4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I &I : ; .? : ;' : ;I.: ; ' I : ; I.? : ;' I .1@1 .? : ;' I@: ;I : ;I4: ;I : ;.: ;' I@: ;I4: ;I & 4: ;I !.? : ; ' I@": ; I#4: ; I$.? : ;' @%: ;I &4: ;I ' U(1UX Y)1*4: ; I+4: ; I,4: ;I-4: ; I .4: ; I/ U0.? : ;' I@1!I/24: ; I? < % $ > $ > : ; I I$ >  : ;  : ; I8 < .? : ; ' @ : ; I 4: ; I 4: ; I 4: ; II!I/ .? : ; ' @.? : ; ' I@: ; I '  4: ; I4: ; I? < % $ > $ >  : ; I I I' I I &I  : ;  : ; I8 : ; I8  : ; (  : ;  : ;I : ;I8 .: ; ' : ; I: ; I.? : ; ' I@: ; I4: ; I4: ; I: ; I4: ; I 4: ; I 4: ; I U4: ; I .: ;' I@!: ;I"4: ;I#.? : ;' I@$: ;I%4: ;I &4: ;I'4: ;I( : ;) U* +4: ;I , -4: ;I.1UX Y/10111 2I3!I4$ > 5I6!I/ % $ > $ > : ; I  : ;  : ; I8  : ;  : ; I8  I  : ;  ( ( .? : ; ' I@: ; I4: ; I4: ; I &I: ; I &I: ; I4: ; I4: ; II!I$ > !I/ 4: ; I % : ; I I$ > $ >   I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I 4: ; I 4: ; I: ; I: ; I.? : ; ' I@% : ; I I$ >  I' II$ >   &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I : ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I I' II : ;  : ; I8 &I .? : ; ' I  : ; I 1 .? : ; ' I@: ; I : ; I : ; I.1@1 11UX Y 1X Y : ; I4: ; II!I/ $ > 4: ; I % $ > $ > : ; I  : ;  : ; I8  : ; I8  I .? : ; ' @ : ; I &I 4: ; I? < % $ > $ > : ; I  I I' I I &I  : ;  : ; I8 : ; I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I.? : ; ' I@: ; I 4: ; I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I  : ;  I !I/ $ > .? : ; ' I : ; I&I.1@1 .? : ; ' I@: ; I4: ; I4: ; I1X Y 11X Y : ; I % $ > $ > : ; I$ > .? : ; ' @: ; I % $ > $ > : ; I  I$ > &I  : ;  : ; I8 : ; I8  : ;  I!I/ !I.? : ;' I@: ; I 4: ;I4: ;I.? : ; ' I@: ; I .? : ; ' @: ; I4: ; I4: ; I4: ; I 4: ; I 4: ; I4: ; I: ; I U .? : ; ' I@% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > : ; I $ > .? : ; ' I@: ; I 4: ; I : ; I 4: ; I .? : ; ' @% $ > $ > $ >  I&I.? : ; ' I@: ; I % $ > $ > : ; I $ >  : ;  : ; I8 .? : ; ' I  : ; I 4: ; I .1@ 1 41 .? : ; ' I@: ; I 1UX Y 1 U4: ; I.? : ; ' @% $ > $ > $ > .? : ; ' @% $ > $ > : ; I  I$ > &I  : ;  (  : ;  : ; I8 : ; I8 I!I.: ; ' I : ; I: ; I4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I4: ; I .? : ;' @: ;I: ;I: ;I 4: ;I 4: ;I 4: ; I! "1#41$&%1UX Y & U'41(1X Y )1UX Y *: ; I +4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ;   I .? : ; ' I@ : ; I .: ; ' I@ : ; I 4: ; I4: ; I.? : ;' I@: ;I4: ;I4: ;I U4: ; I.? : ; ' @ 4: ; I % $ > $ > : ; I.? : ; ' I@: ; I: ; I4: ; I 4: ; I 4: ; I  I &I I!I/ $ > % $ > $ > : ; I.? : ; ' I@: ; I U4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I4: ; I  I &I% $ > $ > : ; I.? : ; ' I@: ; I4: ; I  I &I% $ > $ > .? : ; ' I@: ; I: ; I4: ; I4: ; I : ;  I &I .? : ; ' I@ : ; I : ; I 4: ; I % $ > $ > .? : ; ' I@: ; I  I&I% $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > : ; I .? : ; ' I@ : ; I: ; I 4: ; I U&I4: ; I? < % $ > $ > : ; I  : ;  : ; I8  : ; I8  I $ > I !I .? : ; ' I@: ; I4: ; I4: ; I  : ;  U4: ; I&I 4: ; I? < % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U414141   % $ > $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;' I  : ;I4: ;I 4: ;I  I&I.? : ;' I@: ;I1UX Y1 U4141 41   ../../include/arch/i386../../include../includecrt0.cstdint.hstddef.htypes.hio_struct.hstdio.hP@@YY^-//_9wL<?+:ju3w /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sys../lib/posixanalyze.cstdint.hstddef.htypes.htypes.hstat.hdiff.hregex.hsystem.ht@v==g=Z|0#%V`#~ %~t&~$KN^Ivq~XML[Ihgqf $.ZD%sp'$ZpDp&f ~BKXr<mz fqaX"~=]tt*YzJ%Yz $ UFX<~t#fgfLPs=<8 -,^ $m\!f</#[׻~ JK| @Wg==叒ueL/e[y0L|r!v{K w eON!--Yؓ/y<<0!vXh %0!vXh֟!ytKsY-Z/"})!&cX>_yf 7=z 0Y0z -aJ wX t}u<~ȑ\LA"q.]/i#m.}Nt%"J7[JB\ؾ;i0/z00 &`~}t;"ufu"v<|t<@t} lX}׉ /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sys../lib/posixcontext.cstdint.hstddef.htypes.htypes.htime.hstat.hio_struct.hstdio.hdiff.hregex.hsystem.h@f} .2is.}Jg[Yut}Lw/L=huLgK>gLZ+pk/~/ .= f!ڮ  +o#$%&<YLYz f~)"~ (0 <#~4X~ZX(<~%~&0S">e0aT2=uK#$'&))1ȇ.~仯W~tXiXleQy3~.~thX}g"L+{ uyx%*}v<kX.gtct^!tZ&V*tP6/L4tC=tY40żu'q&|X~.u<}֟~t~t~t~t~.~~x<~tzu#~~~t~~t,Y[t~J~t~t~~~t~~~1K/}ut}qu }ȡv +K&ZD{KIw@gz<]"ZY~ }~ tt*8~tȭiJ  {JEtd-f 0uR<$~}q}X"  /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sysdir.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hdirent.hsystem.hdiff.hsetjmp.herrno.h@@1՟$~2~Nkt f"(w~'x׳,"gjyt J8{0$?<t#Y!nf_"t6 `/ggg*hPʭh#Δ=~z|10sf; qXzG_w/&z | .sA"0pXzG_w/M||ft}& f<ۅ)~:$h&~,gg?L.tt~0 /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sysnormal.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.hdiff.hsystem.hb@gK`tl[!K!W\=Wz /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sysside.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.hdiff.hsystem.h(d@/Ʌgwx0/h>09A<XjYK.1dXXGg@PfvKg:?Lvgf L"qY[UszsotL~ZIX&t^ h;jh;hd#6Y /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/home/tyndur/lbuilds/work/diffutils-2.8.1/env/include/sys../lib/posixutil.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.hdiff.hregex.herrno.hsystem.hj@=<>\>X/lil.t< >ɭx=>2/u @/u iY`k12~̇=ubucXvwX=V*tVtXJ僉 *Yxx~J SXyf=iLlJ#\O"}>YD<.<4UfZ=0 hg0m*9f5[kgahgB}gu.hYh8Zgy tI ȃ~gg==?3[YgnLrWnkgKsXgYrugYfgCL#yE\xJtt?<_bK>&  version.cc /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includebasename.cstddef.hDt# sqX# w /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includecmpbuf.cstddef.htypes.herrno.hx@K JuYtt Jsv .B0fJ=3  X /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includeerror.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hy@,g{vt ttftەgi޻ .QNgJBk .gJg.` /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includeexclude.cstdint.hstddef.htypes.hio_struct.hstdio.hexclude.hX{@i\rhu1!entfLyJYy.k$.uuu==jYgwXt! ZvKMs"KYJ(X>KRuok#XiXKYXotot#/L=WBwlugI'! exitfail.c'! freesoft.c /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includegetopt.cstdint.hstddef.htypes.hio_struct.hstdio.hgetopt.h(@Yhu2y.5J  y5qJ/K*w(׃pot/K*g~f$X)g0v|gh)Y X]|  /A> <n0g}g~u~ȯɔv-~.u}t>if} ft~ȑ^.vP"g~<tQodJ' f=F>`<~t)gj.0up1tF,/=>{J~*/hA(rtPfzX#(y֮u~.~/J>Xbv~/WhK}Xu"/%zX`k%$~$e$w$$˻z. yA  ~3PȻA %p$&1m=|A3u/$~.4  ^*Nq}Lc#uqXYIDf~XX|t.|W~.<~t{L{?wt= {>t%Rxtg&$zm~t|%~h zQ~tn~ Gs|t!yf{~ft$p /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includexmalloc.cexitfail.hstddef.h@g/j iw,pfgw,ofiw,~a /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includemalloc.cstddef.h@!gL=d0=b /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includerealloc.cstddef.h@%hLge>d /home/tyndur/lbuilds/work/diffutils-2.8.1/env/includestrtoimax.cstdint.h@<y ,  fnmatch.c@.  w<~<([_~  ]yX%%`?ʢY' f10a *vg􄮽6u0/zp82 t+f+h5IE*/WzyWttp't5(i*ff,h=yL? ~ /home/tyndur/lbuilds/work/diffutils-2.8.1/env/include./posixregex.cstddef.hwchar.hregex.h@!=/ .u/ XsMK; .$gsMIJ .O[Pv'ZX.Xx6vtZ/#K!di==`>ͽ*fst Tt<qJy XtgKu~.u g]g=j`LM=Zu]<=q$ t)z~q,rJ1iLj%p"f>זw|ʼ]# "rf %A|t}t/J ^rx#/}<}.J|w5J{  >~ # ktJ J||Jr) tt {%vt r \& ~gNDYz=פt|Jv(f 4G ..|< uI";|<f#J{{ ZQ;J% zt}JtJeJ\J(?zXgv7% B H  'x2ɴuJ&00ysAȘ #%4s+   JJyx/bJ|J}t$Yx <uJ <XYJW$Kx <ut <XYJ J#`<~%־wguw%Wn J3[Kv.N2.V$~ im"vm.ȃ<~<tDK JrF<;xX "$f :u~E=׭v fB< [r G!4x*3pM$(sJ  s .8 f}JB&I@ggJxdt~J+ .  3.'."x.%g0!z X 2$/x;J$+ }r[ ,n=,*h~." w. . . <9z.5$ /`9g.7x  .D#- 8'=`  > {yNx<c4r[ ,g)/79g~.^z* &wz8<./77g.].=,*h}3#<  $w"4JQ|.. ح,򥟟a Jau~,["e<txf$7 %}u>.m|~u <y%{ztY!/] tVvL,P>)t /[`%JGt ,yS{)~x.'t&h!ttt.zXvvt~z0,$?vf *wgz. !~z1v    |fzyw |y>YKYfy fzXi|9f|Vz3K՟wY2}t*fzv 5FKz(z J twJt <6x<|fJ}X;Pʃ\fLt[ ȴ 0!P4t!fa"i'"<woy!J~}X!ʮ׿ YT׿gvCqng  ctype.c@XL>?XL>?<=sY?<><><>g1!W.=i<=eY?<><><=XX)tff!-.=ɯ<=<=$ errno.cZ_ ../../include/arch/i386../../includeliballoc.cstdint.hstddef.h@>$ {<Xw+wtzf,{st>د:v5 t\ ȃ{f|f&z< tB~3)7%[.%.sJ 2*9gu==uv O-/1߮ .!~~X t*bj>::0:0'?1 vX f6ifyXm.!?J .x;YM{-=/~J}N=,wg=;>=;0[9iUi|fX~$n-=g/t~ =0uu=gg~t-Yiv;uug!<=rtYugXlzX?/>^z:<z.? J:z<XBw+wzz<tSht@L{IJ8 ../../includestrtol.cerrno.h@"{;^z.P f3gȑ;0>:sf"Ju[vI$Qj ȃ;/Xx#0]XDc4 ../includesort.cstddef.h@ 8j*@ڻ+@8/Yy. Z: ../../includestrncmp.cstddef.h@$>9LV2z K ../../includestrcasecmp.cstddef.hbsdtypes.h@3=L=]d$Z3zi=e"[91eu;K< ../../includemultibyte.cstddef.h @%SXAvt]YI_z{hh' )V0,!-z>:T.<R3<M<3<Mfɡ) )L0==_PzX&zX&z.A-Z %;/x\#9[WiZrZ=xs ../../../include/arch/i386../../../includetimer.cstdint.hstddef.hcollections.h0@@Ysc@W sy/sOfYyM"=[ea ../../../include/arch/i386../../../include../../includesync.cstdint.hstddef.htypes.hrpc.hcollections.h2@t=*ng)og)ng(}.gYZfZ;u=YC x<hYzZ:YC.[XK;>,_h@,dhZ,01=I/LVh>d>Z,0\\.h>d>Z,0\~.tY />:@I/=l3 pv.c 7@=xi= ../../include/arch/i386../../include../includeenvvars.cstdint.hstddef.htypes.hrpc.hcollections.herrno.hP7@gZj/fgZj=@  t<fsvX~.$z<n\w X .gj=iq\*2.2oQu$;g~fg;g[+1.ruy]ֽ+12u[G?n#$u.-/Y;/[JMyXDsu;=M]zg~Ȑ#b@M[=IqX[gs \\ZJm-=3ڃKy Cyf y ../../../include/arch/i386../../../include../../includesignal.cstdint.htypes.hsignal.herrno.h=@t?^xtt?^xtw^ztK<itH>Y82w tw< .gwU?NMuK~gpg~i&xuhr>kYXp^K4gp=^t>?9wwu Xqt>^AK[91G1kfg~=xZ"VX>,/^ ../../../include../../../include/arch/i386../../include/sys../../includeposix_files.cstdarg.hstdint.hstddef.htypes.htypes.hio_struct.hstdio.hcollections.herrno.hfcntl.h C@#U/#U/֬]\7 fsڄ:0}][8n5P.U+<oA_]?uXP.<~֐=mM8 fדZ/u=dzh.g z9tQ[8 J0ntfg;])33/ Yp t0V0Sg;])33/ Yp t0V0J=[+14B=vbtgOyVg;g[+13+13/zx<~p ../../../include/arch/i386../../../include../../include/sys../../includestat.cstdint.hstddef.htypes.htypes.hstat.hio_struct.hstdio.herrno.h@K@3#+1 #+1#U1 #U1 #U1Pgz P~8Mv+1Y>[=,u/;gKhy8u[9tt=/P;/-~X >*2.u;/\k  ../../../include/arch/i386../../../includewait.cstdint.hstddef.htypes.hcollections.herrno.h0N@i+hC ../../../include/arch/i386rpc.cstdint.hpR@!X@Kxx< [3 sleep.cR@=xM ../../includelost_path.ccollections.hstddef.hR@ JuJ [:`O<fytQS_JNYZ=.@F=iM{@YZ=sutYZ=u2YZ=utYI/Ou/ B:JZH>t"~ZU1xv(~[1YI/Y~`;/-2  "p/~tuʦz=tf塉 <~ Yt\F@0yhKL ~tuʦgu~~=tf塉 <j guK#j ../../../include/arch/i386../../../includecreate_process.cstdint.htypes.h[@&>z f>Cy ?9# f(=w f>z=( set_rpc_handler.c0\@=gP ../../../include/arch/i386add_intr_handler.cstdint.hP\@ = ../../../include../../../include/arch/i386../../includefprintf.cstdarg.hstdint.hstddef.htypes.hio_struct.hstdio.hjprintf.hp\@3g==hwfA\jg;"xg;Ku ../../../include/arch/i386../../../include../../includestdio.cstdint.hstddef.htypes.hio_struct.hstdio.herrno.h`]@hGgs>iuW=Q91x=5%rXl<..\ifLi):=.>tlP,>/u'J׻j2Y<'8\]uuu =u=Iv=u=I*fg#ytf="xXf=#|JWfA9rA/CzJZjzYXt>JZoy19?Z|3 JYsy:0Zt>JYjz19?]"/#Ot> JYsxy*;uXg~ti+?r<jJ<" t^(4nX)T;uXZk*& -737A)ygv:>e=7~=JYvK-/1=~=5f0:==;@~.̃ȅ$\z.0AgWYzvؓ?iy!pXY -g}th,=;=-=k@*j>vuo$ <u.*b2Z>1Bq<<c<g<l</wKuuw8I>(Lfg=@fA/-/m uf+im,05 lXدc1ZXKx<K<Kz:>-/k3;2t . } ../../../include/arch/i386../../../includeexit.cstdint.hstddef.hcollections.herrno.hr@??>0Tfgh Zs<\*\/TZ,>d>-z=eJ ../../../includejprintf.cstdarg.hjprintf.h t@1N1y.@8m00 hr> ;=vi=IY;/w2,(xY-/ /x` .hZxfu0,f<<f*~9?^3^OJYg uRK`Yn!ta .m , 0~Xhw.hg  g'm g gd6%Io\T2$he=0gW=3iry)An-e=h! g/tg/ t ",0J.^KzXBzfth~ȱ,0~XJ~.0etC Zl=Y;o 'orfxw  uuKw(w<^Xo7 rw<w v ~f=v=-/4ׄK[t u< .wI ../../../includeprintf.cstdarg.hjprintf.h@;i:LYfA`=jbtgvJ ../../../includesprintf.cstdarg.hjprintf.hp@%u>:J>?8us@qwLNwfA\U ../../../include../../includewctype.cstddef.hwchar.h@<> <> <> <> <>g6<> !W.= f<=sY <<> <=jXuX iJ. fXL> C!-.=ɲ<=dZ <<= <=~kdx<6Ey ../../../include/arch/i386../../../include../../includeassert.cstdint.hstddef.htypes.hio_struct.hstdio.h@&gI38W ../../../includesnprintf.cstddef.hstdarg.hjprintf.h@(g]1vt tZ:<>?7=p=LLOfA ../../../include/arch/i386../../../include../../include/sys../../includedirectory.cstdint.hstddef.htypes.htypes.hio_struct.hstdio.hio.h@#g/tg0k]J>%Uf-.Yf-fJ>qR/w.:0 \E ../../../include/arch/i386timer.cstdint.h@ =x ../../include/arch/i386../../include../includeinit.cstdint.hstddef.htypes.hrpc.hinit.h@NT>$,02=nfg"\:>0:0=/;NZ4A) &:LV?=ׯ~t=''@/?9-=:>-/lh-/tpf.p.;/K1>Y Jw. w< h'i ../../../include/arch/i386../../../includeshared_memory.cstdint.htypes.hp@?Dx ?Dx =3 puts.cН@>( ../../../include/arch/i386../../../include../../includemem_allocate.cstdint.htypes.hsyscall.h@ ic?9 fi='=% wait_for_rpc.c@=xi=x\r ../../include/arch/i386../../includeparam.cstdint.hstddef.htypes.herrno.h@fB]I>:1N=y.bv.=N=yjT<@2>>,{@@3u^֐<-/j.uuq3u>:> .<.<:Uf-=fXoto<i/-=jY;=/ w:>H0:>=;=*@8{1!j8kW;/2;/[ H ../../includelist.ccollections.hstddef.hТ@!W.=<=>V0Xg-./gϏYHQggrt/=g@<MO JkK=L/e,0.3bXk/;0~tj+?/O x=Wgs[+/h2 tK1Lzo,02KE~t=NgLI1xtggwH ../../includestrcspn.cstddef.hbsdtypes.h @$ v. v< <ϟe=;Mw0,>:>G?G t)?,>x Z: ../../includestrncpy.cstddef.h@)Xg[ye_8 strcpy.c@@"JiS9 ../../includestrdup.cstddef.hp@%$T9 ../../includestrlen.cstddef.h@##+.?>\ strtok.c@1 ٦lJ =zvrJr#X].*i6 unlink.c@&? ../../../include/arch/i386../../../include../../includeaccess.cstdint.hstddef.htypes.hio_struct.hstdio.hdirent.herrno.hШ@%t? JvN73x<T ../../include/arch/i386../../include../includelost_link.cstdint.hstddef.htypes.hio_struct.hstdio.hio.herrno.h0@@5/-/iBgx< <1M;/D[XytQt|~lzJf;/Y-/m/-= f-=n!9.䃄|^t>V,02=-&% Cgx< <1u;/jȡ A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h̬@}Y/g?LNf~= uZ!LM A ../../gcc-4.2.2/gcclibgcc2.clibgcc2.h@~"Y=g[vNJ= =XK  g~tuZ!Z0 =sM| P@!AB F|  4t@2AB FH.(4@c AB I/.g..4 @nAB Dk.H4| @%AB IK.M.Y.. ..N.. d.U..N.| $@AB FJ. ~. |@AB Fn.  @<AB BJ. H@iAB DK. b.L@$AB FS. .\.P.O.S.O.P.K..U.P.O.S.O.  @ZAB DK. _.@4!@AB FS. .^.Q.Q.P.Q..Q..W.#@AB F($@AB FU.y. W.[. ,%@gAB D| %@AB %@}AB  ,&@cAB BS.|. (&@AB FZ.Z. Q.`'@1AB M.\.'@'AB $'@OAB FQ.d. L., (@o AB Ie..{. .|2@IAB I.2@D  F AB Dr.e.}. _.7..S.~. H..d.. Y.A..b.0U.i....N.T.g...W.H.W.L.g.Y. Y.| @@\AB F$(A@AB Be.J. O.<A@_AB FP.T.J..X..b.X.F@AB | \$F@AB P.\DF@AB P.\dF@AB P.,\F@7AB ES. U.[. a.Z. f.$\G@AB ES. U.V.$\H@AB ES. U.R.| D`I@AB }.$DI@AB F.. DK@AB FZ.,D@M@AB Fu.l.d..D,O@=AB p. DlO@gAB \.Y.e.$DO@AB ES. U.p.| XdP@CAB A XP@AB FP.X@Q@OAB Bb.$XQ@AB Bh..O.XR@AB BU.4X$S@AB I..d. ..| Lb@AB P.$Lc@#AB FS. X.R.|  (d@mAB Fo.(d@AB F{.g.Q.(Tf@AB Fo.e._. Xg@IAB F*. h@HAB De.W.,h@AB FS. ^..].|  j@'AB  j@AB  j@AB  j@>AB FQ. j@AB  k@2AB AI. @k@UAB DI.f. Z. k@jAB DT.f. \. l@(AB BG.$ ,l@hAB Fz.V.  l@PAB BG. l@AB F. n@4AB FS. o@AB Fg. pp@AB F. r@ AB S.$ s@AB Fi. I.( s@=AB F..J. t@AB P.  u@!AB T.E. 4u@'AB DV.E. \u@AB X.( $v@AB FK.`. h.|  AB Fc. Y.l. q.| @AD @AD @/AB @AB  @AB @@AB `@.AG @/AB @AB @AB @4AB @@AD `@AB @AB | l@AB l@AB FIl`@AE El@?AB Fl@@VAB Fl@3AB D| 4@AB F| h@AB F| @KAB DD| @~AB Fp @tAB F| $ @AG C $!@AB FFE$@"@AD A$#@AB F$#@!AB $ $@AB F$0%@!AB | `%@.AB | 4%@>AB A| d%@9AB A| &@AB F| '@AB F| (@9AB (@AG FP)@hAB B)@AB )@ AB )@AB F+@ AB  +@ AB @+@oAB F-@#AB -@!AB |  8.@vAB FIF8/@AB  8/@AB AFF80@>AB | 0@dAB F@1@oAB F1@AB E| 82@:AB D82@1AB 803@1AB 8p3@0AB 83@AB 83@IAB F85@AB A805@AB ON85@YAB X8 6@YAB X 86@AB IFF|  7@ AB 07@AB | P7@&AB 7@'AB 7@AB F08@gAB AG8@AB 8@AB MFP9@_AB L:@GAB FF;@AB L;@AB ;@AB F<@AB F| @ =@IAB D@ =@IAB D@ @>@IAB D@ >@AB E@ ?@_AB D@ ?@%AB @ @@%AB @ P@@aAB  @ @@AB MFF@ A@WAB D@ B@qAB D@ B@AB @ B@"AB @ B@IAG | ! C@AG !@C@AG !`C@yAB C!C@ AB C!D@AB F!E@KAB !F@RAB AF!`F@AB O!G@AB O!G@tAB LF!@H@IAB !H@AB L! I@ AB !0I@AB E!J@"AB | #K@AB #0K@ AB | #@K@AD #PK@AD #`K@ AG #pK@ AG #K@ AG #K@AB  #K@AB FHE#L@EAB D#L@AB FI #M@AB IFF| %0N@AB C%0O@#AB %`O@AB E%P@AB F%P@&AB | %Q@0AB | %0Q@"AB %`Q@#AB %Q@AB %Q@AB IH%@R@AB %`R@ AB | |&pR@AD |&R@DAB E| &R@ AB | &R@7AB C&0U@AB F&U@AB F&Y@AB F| '[@ AB '[@AB '[@!AB D'\@ AB ' \@ AB | (0\@AB | D(P\@AB | p(p\@;AB p(\@!AB p(\@JAB IFp(0]@"AB | (`]@$AB (]@AB (]@ AB (]@NAB D(^@AB BF(^@NAB D(^@\AB D(P_@kAB D(_@jAB H| )0b@AD )@b@AB )Pb@AB )pb@ AB )b@AB D)pc@+AB )c@-AB )c@.AB )d@AB FK)e@xAB D)e@aAB D)e@AB FF)f@AB D)g@zAB D)g@#AB  )g@fAB IFF)0i@RAB FF)i@EAB D)i@UAB FF)@j@UAB F)l@RAB D)m@AB II)m@6AB C)p@AB )0p@AB I)r@AB F| ,r@bAB E,`s@AB ,s@GAB ,s@HAB B|  p- t@dAB FLGp-t@AB Fp-Pu@'AB p-u@AB Fp- v@EAB Ap-pv@0AB Fp-z@uAB C| \. @AB F\.@'AB \.@AB \.@AB \.0@ AG \.@@ AG \.P@AD \.`@AB AG\.@AB E| `/@6AB `/@AB `/@@AB FF`/P@AB | /p@ AB D/@OAB G/@!AB | @0@ AB @0 @AB @0@@AB @0`@AB @0@AB @0@AB @0@.AG @0@/AB @0 @AB @0@@<AB @0@AD @0@AD @0@AD @0@/AB @0@AB @0@AB @00@FAB B| 1@?AB |  2@dAB FGG 20@[AB H 2@(AB | 2@AB 2@0AB 2@ AB 2 @0AB 2P@ AB 2`@`AB FF| <3@AB | h3@QAB Ah3@@*AB h3p@mAB Fh3@mAB BCh3P@rAB FIh3И@7AB Dh3@DAB Fh3`@AB Dh3@AB PFh3М@+AB | 4@fAB D| 4p@AB 4@AB 4@AB | ,5Н@AB | X5@AAB LFX5@@AB X5`@AB X5@AB X5@AB | 5@ AB 5О@ AB | 06@lAB C06P@VAB C06@jAB F06 @`AB F06@HAB L| 6Т@AG 6@!AB 6 @yAB HF6@AB  6@AB FFF6p@lAB FF6@)AB D6@AB MF6@OAB D6@!AB | 8 @AD F| H8@QAB B| |8@@-AB A| 8p@JAB FI| 8@AD |  9@AB BD 9@"AB | X9@ AB | 9Ш@]AB D| 90@dAB F9@+AB JI| :̬@'AB E| <:@_AB EresultGNU C 4.3.2__ctor_start__short intcall_constructorsbuffer_posuint8_tcrt0.clong long intunsigned charlong long unsigned intuint32_tbuffer_sizebuffer_ptrshort unsigned intc_startppb_sizebuffer_mode__ctor_end__/home/tyndur/tyndur/src/modules/libpid_tio_resource_id_tppb_shm_idresidungetc_countungetc_bufferio_resource_tFILEequiv_countyoffinsertedbdiagfdiagdiscard_confusing_linescountsuint64_trealindexesbufferedbmidxlimbig_snakeignore_regexpbminlabel0xoffoldxanalyze.cequiv_maxbxbestrunlengthuintmax_tst_inonewline_anchorconseclo_minimalparentlinbuf_baseno_subother_changednot_bolfirst0reg_syntax_tlast0last1bufsizethisdmaxnlink_tline0line1gid_tminimumfile_datalinbufst_blocksst_uidblkcnt_talloc_linesdeleteduid_ti_endOUTPUT_NORMALspeed_large_filesprefix_linesbxybestequivsst_atimemissing_newlineadd_changebuild_scriptcorrespondingptrdiff_tGNU C 4.2.2st_modeprovisionaldiscardsOUTPUT_CONTEXTfile_labelfmaxfmidregs_allocatedbriefly_reportOUTPUT_EDfminpartitiondev_ttime_tOUTPUT_SDIFFvalid_linesyvecfxybestfastmap_accurateOUTPUT_UNSPECIFIEDignorest_nlink_Boolmanyoutput_stylebriefOUTPUT_RCSst_blksizefiles_can_be_treated_as_binarybuffered_linesst_ctimeno_diff_means_no_outputxvec/home/tyndur/lbuilds/work/diffutils-2.8.1/src/diffutils-2.8.1/srcst_rdevprefix_endcomparisonlabel1ymiddiff_2_filesshift_boundarieschanged0changed1re_pattern_bufferdminsuffix_beginOUTPUT_UNIFIEDnondiscarded_linesfilevectoo_expensivepartst_gidOUTPUT_IFDEFxmidignore_blank_linesmode_tcompareseqst_devlen0len1first1OUTPUT_FORWARD_EDblksize_tlcm_maxflag_spacefxbestbuild_reverse_scriptfind_minimalundiscardedhi_minimalylimnot_eolbmaxst_mtimediagschangesre_nsubino_tpr_context_hunkthreshtm_hourlinenumprevmarkprint_context_functiontrans_atrans_bprint_context_headerfunction_regexptm_monmark_ignorabletm_yearunidifftm_isdstlastnon_ignorable_thresholdprint_context_labeltime_formattm_mintm_ydaylinelenprint_context_number_rangeoutfilecontext.cfind_function_last_matchprint_context_scriptpr_unidiff_hunkUNCHANGEDtop0top1find_hunktm_wdayfind_function_last_searchfind_functiontm_mdaytm_secprint_unidiff_number_rangeinitial_tabpatlenreason_msgidIGNORE_TAB_EXPANSIONmodern_usagesdiff_half_widthline_format_optionstrip_trailing_crnewlenreport_identical_filesspecify_valueoptionvecBINARY_OPTIONOLD_LINE_FORMAT_OPTIONprogram_namesdiff_column2_offsetauthorship_msgidfrom_filefiletypemultiple_regexpsUNCHANGED_GROUP_FORMAT_OPTIONHELP_OPTIONNO_IGNORE_FILE_NAME_CASE_OPTIONexcludedSTRIP_TRAILING_CR_OPTIONswitch_stringhorizon_linesFROM_FILE_OPTIONshortoptsleft_columnLC_NUMERICsame_filesIGNORE_SPACE_CHANGEnumvalmsglenlongoptsTO_FILE_OPTIONfunction_regexp_listUNCHANGED_LINE_FORMAT_OPTIONunidirectional_new_filenumendoption_listoperandfree1add_regexpshow_c_functiontry_helpLEFT_COLUMN_OPTIONoption_help_msgidoptargNEW_GROUP_FORMAT_OPTIONpaginateIGNORE_ALL_SPACENORMAL_OPTIONsuppress_common_linesspecify_stylegroup_formatC_ifdef_group_formatsOLD_GROUP_FORMAT_OPTIONignore_file_name_caseoptindignore_regexp_listcompare_filesignore_white_spaceline_formatIGNORE_NO_WHITE_SPACELC_CTYPEsdiff_merge_assistSDIFF_MERGE_ASSIST_OPTIONignore_casefree_software_msgidocontextfnm_argNEW_LINE_FORMAT_OPTIONLC_ALLexit_failurecategoryset_mtime_to_nowexplicit_contextHORIZON_LINES_OPTIONcheck_stdoutLC_TIMELC_MONETARYversion_stringexpand_tabsexclude_optionspr_programreglistsetlocalediff.cSUPPRESS_COMMON_LINES_OPTIONfree0summarize_regexp_listLC_COLLATEmaingroup_format_optionexit_statusLC_MESSAGESstarting_filedir_arghas_argcopyright_stringINHIBIT_HUNK_MERGE_OPTIONuintptr_td_reclenreadingd_namecompare_namesnnamesdiff_dirsnameorderdata_allocfailed_strcolldirentname2handle_filedirdatadir_loopfile1file2jmp_buflocale_specific_sortingdir_readcompare_names_for_qsortprint_rcs_scriptprint_ed_scriptprint_ed_hunkpr_forward_ed_scriptchange_letterpr_forward_ed_hunked.cprint_rcs_hunkbeg0beg1next_lineuptothenoutifdef.cformat_groupprint_ifdef_hunkgroupsgroups_letter_valuebad_formatspec_prefix_lenend0end1do_printf_specendcharelseoutformat_ifdefprint_ifdef_scriptdigitsscan_char_literalprint_ifdef_linesvalptrlinbuf1prefix_countprime_offsetbufendwas_binaryguessed_linesbucketbuffer0buffer1srclimslurpalloc_lines0linbuf0repetitionseqs_indexsame_length_diff_contents_compare_anywayeqs_alloccureqsmiddle_guessequivs_indexfind_and_hash_each_linehashing_donefile_block_readappears_binarydiff_length_compare_anywaycurrentguessed_bytes_per_linebuffered_prefixfind_identical_endsalloc_lines1skip_testpretend_binaryprepare_textread_filesequivclassprefix_masknbucketshashsuffix_guesshash_valueeqlineguess_linesequivs_allocfile_sizenormal.cprint_normal_scriptprint_normal_hunkout_positionleftnext0next1out_boundcontrol_charprint_half_linespacestext_limittext_pointerin_positionrightprint_1sdiff_linelimit1tabstopprint_sdiff_common_linesput_newlineprint_sdiff_scripttab_from_tolimit0print_sdiff_hunkside.cindentaptrtranslate_rangemsg_chain_endprint_message_queuemessage5show_fromprint_number_rangedebug_scriptprintfuntranslate_line_numbercurrent_name0concattrivial_lengtharg3print_scriptpr_pidcurrent_name1msg_chainsetup_outputoutput_1_linelines_differcolumn2trivialfinish_outputstderrarg1analyze_hunkhunkfunbegin_outputpfatal_with_namedir_file_pathnameutil.cflag_formattotal_sizeshow_towstatussepcharzallocline_flagfind_changearg2arg4print_1_linefatalformat_msgidwerrnobptrcurrently_recursivefind_reverse_changeperror_with_nameomit_slashversion.cbasename.cbase_lenbase_name/home/tyndur/lbuilds/work/diffutils-2.8.1/src/diffutils-2.8.1/libc_stack_diec-stack.csignoprogram_error_messagestack_overflow_messagec_stack_actionreadlimbuflimcmpbuf.cssize_tbuffer_lcmbytes_to_readnreadnbyteserrnumprint_errno_messageerror_at_lineerror_print_prognameerror_message_counterror_one_per_lineerror_tail__builtin_va_listold_line_numberold_file_namepatoptsadd_funcbuf_allocmatcheradd_excludefnmatch_no_wildcardsmatchedexcluded_filenameexclude.cnew_excludeline_endadd_exclude_fileexclude_allocuse_stdinbuf_countfree_excludeexclude_countexitfail.cfreesoft.cprint_errorsPERMUTEorderingexchange_getopt_internallongindbottomREQUIRE_ORDERpfound__getopt_initializedambiglast_nonoptnextchar_getopt_initializeindfoundoptstringopterrgetoptfirst_nonoptposixly_correctgetopt.cnameendmy_indexRETURN_IN_ORDERoptoptmiddleoption_indexgetopt_longlong_optionsgetopt_long_onlyopt_indexgetopt1.cposixver.cposix2_versionquotedquote_system_argquotesys.cmy_strftime_localtime_rb400to_lowcasememcpy_uppcasembstate_zeroa100maxsizesubformatbig_enough_multiple_of_7bufpformat_endufmtmbstatestrftime.cmy_strftime_gmtime_rb100memcpy_lowcasenstrftimeto_uppcasenegative_numbermodifierformat_charnumber_valuedo_number_sign_and_paddingchange_caseftime_tm_diffzoneintervening_leap_days_deltasubfmtubufa400iso_week_daysold_start_incrhour12underlying_strftimedo_number_spacepaddo_numberxreallocxalloc_msg_memory_exhaustedxcallocxmallocxmalloc.cxalloc_diexalloc_fail_funcrpl_mallocrpl_reallocrealloc.cendptrstrtoumaxstrtoumax.cfnmatchcstartcendfnmatch.cprivate_preglabel_dummy_failure_jumpreg_info_dummymany_times_okreg_errcode_teflagsthis_charprev_prev_backslashre_registersmcntbest_regstartintegerregfreestring1this_elementre_syntax_optionspendre_set_registerswchar_tbest_regendinner_group_locbyte_reg_unset_dummybyte_bcmp_translatebyte_re_match_2_internalbyte_fail_stack_typestring_temphandle_closecompile_stack_typematch_endREG_ECOLLATEactive_reg_tnormal_backslashhandle_altbyte_store_op1byte_store_op2jmptableold_regendlaststart_offsetsame_str_phandle_openre_set_syntaxadvanceis_upperbest_regs_setnum_regsbyte_re_search_2regnum_tREG_ESUBREGhandle_plusset_regs_matched_doneregex.cregcomplabel_duplicatelabel_wordcharlabel_on_failure_jumplabel_succeed_nlabel_no_opre_matchend_match_1end_match_2errbufbeg_intervallabel_stop_memoryold_regstartcompile_stack_elt_tlabel_wordbegrm_sojust_past_start_memsucceed_n_pREG_NOERRORre_match_2is_a_jump_npfrombyte_group_match_null_string_pbegalt_offsetlabel_maybe_pop_jumpre_opcode_tend_charsize1size2path_can_be_nullrm_eoregmatch_tlabel_endlinesucceed_labellabel_beglinere_syntax_tablelabel_notwordboundregoff_told_bufferpdummylaststartbooleanbitskeep_string_pbyte_fail_stack_eltregex_tlabel_on_failure_keep_string_jumpfixup_alt_jumpdummy_low_regmsg_sizeREG_ESIZEprevcharlabel_wordendstring2label_succeedhighest_active_regcflagsnormal_charre_searchREG_ESPACEnext_backslashunfetch_intervallowest_active_regis_lowerregnolabel_jump_past_althandle_intervalupper_boundunconditional_jumpstartserrbuf_sizelabel_anycharstartposdend2group_in_compile_stackREG_BADBRbyte_regex_compileREG_EBRACElabel_notwordcharREG_NOMATCHREG_EBRACKreg_dummyREG_ERANGEbyte_re_compile_fastmapregerrorbyte_at_begline_loc_pavailbegaltinvalid_intervalREG_BADRPTlabel_charset_notinit_syntax_oncelabel_set_number_atpattern_offset_tlabel_start_memoryreg_nolabel_jump_nbyte_insert_op1byte_insert_op2dummy_high_regrange_startbyte_common_op_match_null_string_prange_start_charzero_times_oklabel_charsetbyte_at_endline_loc_pREG_ERPARENirangethis_regendposre_error_msgidre_error_msgid_idxbyte_compile_rangewint_tfastmap_newlinelabel_wordboundREG_ECTYPEsdummyhandle_on_failure_jumpwant_reg_infoREG_EPARENthis_group_regnuminner_group_offsetnext_nextregexechad_char_classthischarlabel_endbufp_ptrlabel_pop_failure_jumpever_matched_somethingbyte_fail_stack_elt_trestore_best_regsbyte_alt_match_null_string_pfailerrcodepmatchlabel_jumpon_failuredestinationre_compile_patternpending_exactbest_match_pREG_BADPATlabel_begbufbyte_register_info_typeREG_EENDlower_boundis_activewctype_tREG_EESCAPElabel_push_dummy_failurelabel_exactnfail_stackend_of_patternre_max_failuresisprintisgraph/home/tyndur/tyndur/src/libisalnumisdigitiscntrlisalphaislowerispunctisspacetoupperisblanktolowerisupperisxdigit/home/tyndur/tyndur/src/lib/stdlibcerrno.cstartedBetliballoc_minorcdestlsrcnew_mininit_memory_managerliballoc_unlockl_possibleOverrunsldestl_memRootliballoc_memcpyl_inuseliballoc_fill_dwordliballoc_freeliballoc_majorliballoc_memsetl_allocatedl_errorCountl_pageSizereal_sizel_bestBetliballoc.callocate_new_pagereq_sizecsrcl_warningCountliballoc_allocbestSizeliballoc_lockmagicnobjla_lockpagesl_pageCountmajSizefirstoverflowretvalstrtol.cstrtolsort.c_tmpcomparatorstrncmp.c/home/tyndur/tyndur/src/lib/stringstrncmpstrcasecmpstrncasecmpu_charstrcasecmp.c__internal_wcsrtombsmbstowcsour_strmbtowcour_wcsintbufwctomb__internal_mbsrtowcsbufposslenwcstombsbitposcurlenmblenmultibyte.cstrchrstrchr.cstrcmp.cstrcmpmemchr.cmemchrdst0memcpy.csrc0memset.cu_intpositivedecimalitoamaxlenstrtoullstrtoulstrtodstrtoldfracstrnlenatolnptrstring.cstrtofatofatoicaller_pidmy_pidmsg_handler_tregister_intr_handlerregister_message_handlerlibrpc_c_rpc_handlerpadded_fnnameintr/home/tyndur/tyndur/src/modules/lib/rpcinit_messaginghandler_function_tmessaging.ctimer_registerlist_nodetimeoutusectimer.ctimer_callbacknext_timer_idlist_ttimerstimer_cancelitemsync_rpcrpc_get_dworddata_lengthsync_rpc_has_responserpc_send_dword_responserpc_get_stringresponse_trpc_datarpc_send_string_responserpc_get_intinit_sync_messagessaved_datasync_rpc_response_handlercurrent_correlation_idrpc_send_int_responseresponsessync.crpc_get_responsefunction_namerpc_send_responseactual_len/home/tyndur/tyndur/src/modules/lib/syscallssyscall_vsyscall_ppv.cgetenvgetenv_indexrespnormalized_pathname_sizeresponse_sizenameleninit_envvarsenvvar_listgetenvvarchdiroverwriteenvvars.cgetenv_countputenvrpc_get_envvarsnew_valueunsetenvenvvar_tvalue_sizegetcwdgetenv_name_by_indexSIG_SETMASKsigaddsetsigsetinit_signalssigfillsetsa_handlerbitmaskSIG_UNBLOCKsigismembersigactionssigmaskkillsigdelsetraisesecondssignalsigemptysetsa_flags_signal_default_handlersighandler_tsa_maskold_handlersigactiondo_alarm/home/tyndur/tyndur/src/modules/lib/posixsignal.csigprocmasksigset_tSIG_BLOCKoldsetsignumpwritefilenoF_SETFDF_SETFLfopen_flagsfcntldup2fd_flagsposix_files_initfdl_elementfdopenlseekpreadfd_list_elementF_GETFDnewfdfile_flagsoriginold_posio_resposix_files.cF_GETFLflags_sizefd_to_filecreatfd_listnext_fdgetpidgetpid.cgetppidumaskmkfifostat_buffchmodinode_numlost_statmknoddevicefstatstat.clstatmkdirrunningwaitwait.cwait_childrpc_child_exitwait_listwait_child_delwait_child_addwait_child_getinit_waitpiderror_codestrerrorstrerror.creaddirio_direntry_type_ttelldirposix_direntryrewinddirname_lengthposix_dir.copendirio_direntry_tseekdirclosedirsend_messagemetadatayieldsleep.cresolve_relative_serv_pathdotdotpath_sep_tlost_path.cfree_elementcur_sizePATH_SEPget_path_elementsnew_pathelement_stackresolve_relative_pathio_split_filenamecreate_path_stringPIPE_SEPcreate_path_elementNO_SEPleft_sepescapedeliminate_dot_elementsright_sepio_split_dirnamecwd_listio_get_absolute_pathcalc_path_lengthSERVICE_SEPlast_elementinitial_eipget_parent_piddestroy_processcreate_process.cget_pidcreate_processget_cmdlineset_rpc_handlerset_rpc_handler.cadd_intr_handler.cadd_intr_handlervfprintfjprintf_argsputsn_fctfprintf.cfprintf_handlerfprintf_args/home/tyndur/tyndur/src/modules/lib/stdlibcfprintf_putsnfprintf_putcputc_fctpfn_putsnpfn_putcputchargetcharperrorstdio_initstdio.cstdout_bufpath_fileread_bytesint_resio_read_request_tshm_ptrstreamdst_pathfseekio_writefreopenget_shmrenametmp_filesrc_pathfile.cattrblocksizeio_tell_request_tferrorshared_mem_idfclosefgetcfull_pathtell_requestread_requesteof_requestfgetslostio_internal_filesetlinebufclearerrfputcungetcio_write_request_tblockcountfputssetbuffopenfflushnewpathfree_bufferfreadshm_sizeio_eof_request_tfeoftmpfilewrite_requestfpurgerequest_sizenew_buffersetvbuffwriterewindftelloldpathsetbufferatexitexit.catexit_listabortptr_typedivisorremainderulong_long_typeradixlong_double_typequotientulong_long_valuearg_typejprintf_putccharsuppercaselong_double_valueldtoadivmodulltoadividendjprintf.cppformatunsigned_type_flaguint_valuelong_doublejvprintffind_percent_signbytes_writtenarg_indexjprintf_putsnunspecifiedwidth_indexprecision_indexintegral_type_maskmax_indexptr_valuepositional_parameterparse_pos_paramsuint_typeprecisionread_indexaFebaFridatestrctime_stringnstrBUF_SIZEmaxsaMargmtimeaMayLocal_dateaDecaThuDATE_FMTaOctdflcasetime_fileLocal_time__timeschaltjahrtimer_ptrasctimemktimeDFL_FMTaSataJanaWedaSepaAprmonataTueLASTtime_ptrtmp_yearsaJulaSunaNovaJunaAugasctime_bufaMonlocaltimesprintf_putcsprintf_handlersprintf_argsvsprintfsprintf.ctypesiswgraphiswpunctiswspaceiswcntrliswxdigitiswloweriswdigittowloweriswalnumiswalphaiswprintiswupperiswctypewctype.ctowupperiswblankexpressionassert.c_assertassertionvsnprintfsnprintf_argssnprintf_handlersnprintf_putcbuflensnprintf.cdirectory_closedirectory.cis_directorydirectory_readdirectory_opendirectory_createdirectory_seeksyscall_timerrpc_namepath_backupdir_leninit_dev_listabs_path_lencmdline_copy_argvinit_executeinit.cinit_process_exitinit_dev_register__init_execprogram_lenprogram_pathinit_service_getbus_data_sizecmdline_get_argcinit_service_registerinit_dev_descinit_service_get_namedevsrpc_sizeabs_pathbus_dataseek_requestlio_seekseek.c/home/tyndur/tyndur/src/modules/lib/lostio/clientio_seek_request_taddropen_shared_memoryclose_shared_memoryshared_memory.ccreate_shared_memoryvaddr_tsyscall_putsnputs.cphysmem_allocatemem_allocate.cmem_allocate_physicalmem_free_physicaladdressmem_freedma_mem_ptr_tvirtpaddr_tmem_dma_allocatewait_for_rpc.cv_and_wait_for_rpcppb_dir_sizeppb_entryppb_from_argvold_sizeparam.cppb_builder_finishppb_data_usedppb_entry_typeppb_builderppb_builder_initnum_entriesppb_get_argcproc_param_blockpgreallocppb_dir_usedppb_is_validremainingnew_sizeppb_copy_argvppb_add_entryPPB_CMDLINE_ARGinit_execvPPB_ENV_VARlast_listlist_get_node_atlist_get_element_atold_anchorlast_indexprev_nodelist_poplist_pushlist.clast_nodelist_destroylist_sizelist_createlist_is_emptylist_remove/home/tyndur/tyndur/src/lib/collectionsnew_nodelist_insertu_longstrcspnstrcspn.cstrncpy.cstrncpystrcpysavestrcpy.cstrdup.cstrdupcopystrlen.cstrlenstrtok.cspanpdelim__strtok_rstrtokcontunlinkunlink.caccess.caccessio_create_linklink_dirend_free_pathlink_lenname_lentarget_pathend_close_dirio_unlink_request_tdir_idlink_pathio_remove_linkend_close_filetarget_idlost_link.ctarget_fileio_link_request_tlink_filenamelink_dirnamehardlink/home/tyndur/lbuilds/tmp/cross-gcc/build/gcchigh__cbtmpDWstruct../../gcc-4.2.2/gcc/libgcc2.cUSItype__udivmoddi4DWunioncomplex long doubleUDItypecomplex float__udivdi3complex double__umoddi3tt1uPP1uPPSu S1u eeu1SS1SacP 1WSPSuu2tP.SR/VQ0W45u57u7 t4UPU t~4^R^ t~4jQj t~ P t~4[[7 t~7 B PB t~4dd t~HMPP  Pt tt t&t t5t tt t[t tDStTStXt~tHtLtPt~ tH *t~*t\tLtPt\#t~#@tL@]tP]stLs!t`!&t~&1tH1Ht`HtLt~tdt~tLthtLt~tHt~)tL)1tP19t\9At`ALtPLtLtHthtd tL r tHr  tP / tH/ 4 tL4 H tPH ` tL` w tdw th t~t~ t~1APD^PPP{PPtlt~Wt~Wt~tltptltltpW` tl` w t~w } tp} tl t~PPP PPVV PV1VAV Vj { V ` Vw V L QL P PP  Q# / Q4 D QLt~ t~ P t~  t~/ H t~ u u  t P S S  S R R Q  Q P  P u u -t / / -t S S A Ss SSs SuPPSs SuSs t~t~t~7t~-t~i q Ps V PS^VV|V'V-V A t~d t~s t~ it~v-t~<t~<Wt~WFt~K c Ro R SiSvSW$Q$,W,IQI<W<VWVFPWPcQcdWdpQpWs tH  P * R- itHv-tHs t~7t~F-t~s t~7t~F-t~RqRQ@RRpyRQRV8UVVFVSsS:SSFpSySSSgsQsS7Q7:S:IQSpyS~QSR[qR@RRRPKuP|PgP}PPyPs t~ it~v-t~s t~ it~v-t~s t~ it~v-t~s t~ it~v-t~ P7FPs t~ it~v-t~s t~<t~7t~-t~s t~<t~7t~-t~s t~<t~7t~-t~s t7t-ts t7t-ts t7t-tV#V#QVVVn|VVs tP!tP!>Q>GtPG[Q[atPajQjtLttLWQHSHQWQ`tP`uQut~SQt~QtLt&S&.tL.1Q1:S:aQatPtLS7tP-tPs tttn't-ts tttn't-tQVQVSQ^gQVQnQQQQWSSW^kWWn@W'W-WQSVS^W^kVkW|W@W'W-WSS|S.SSs t't7t-ts t't7t-ts t't7t-ts t't7t-t'SW^kW"W"jVj@W'W'0V07W-W'SR^gR;R;HSH]R]jSjRR RRR7Ruut--5t5:V:<S<gVgtttcglPPuuhtPhtlR6R>WRdhREVHaVdhVFWHbWdhWP-6Phiuikukth|P|Vh|R|S~PPPuu tPRQuu4t<<4tttl 4tl]hthhvPvthP th  P 4thtd 4tdBtQ6tP Q tP<tT tTEt`tXt` Mt`MYtXYt`Bt\ t\SS 9SP`SSW W4W45u57u7t4KP4KR4KQuuFtFttlFtlthPthPthPFthtdFtdQVQV.FVR{RRR5:RAFR=SRSSJt\t\Ft\t`t`.t`RSSS:FSRSS.:SHIuIKuKtHcc|S|QSQSQSQS\xt`xtpt`tpjtdtduu tP V ~ V VR S } S S Q $ Q u u t  S t S t  t uutuutUPW[PfmPw}PPPPuutPVPVPPuutPESISR$R0FVVGWIW)>PIQPNQQZhtshqPtskRRq{P{PPPuutPPRRuu't"P()u)+u+wt(9P9UVXwV(=R=TSTXRXwS(=Q=VWVXQXwWxyuy{u{ txtyyf tf m m tx t x:S:tuSutSf tf m Sm t:'S2S9aS S9 L St { SQmRrRt}2t}S9t}at}hyt}S~t}~S! t}! ) R) i t}i S t} T t}T \ S\ f t} t} S 9 t}L g Sg t t}{ t} S t}Ws9WaWW2W6 W) W f W 9 WL t W{ W t} t}yt}f t}m t}#t}t}yt}f t}m t}TYP[mPuP2ePqP6 > P@HPh m Pk z Pp Qt}?9t}at}t}6 t} t} f t} 9 t}L t t}{ t}S?KS ) Sg t S S P9 > P u u 1 t4 8 u8 > Q> ? u? A uA 8t4 M qM 8t@4 S qS 8t-mSS`eSS V<VS`VV4fVVVV3V5V?YV]VmVVyVVIVVeuVVV V18V S<S^S~S-S4SSSfSSS0SmSSySSISSeuSSS S18S RV ?SV8RQSVSVSRSVRQSVRQekRQSV tdPGtdG\P\tdPtdPetdepPptdP8tdjQIQQQ18QVS.V5?VPPPR.fSQQoVVVVVmtXtXIetXtXXetXtX 1tXSt\S P mt\t\V^P^et\t\Xet\t\ 1t\FOPPuu\tP&tp&,P,RtpRTPT\tp)RR\R\]u]_u_t\nPnVV\nRnSSPPnPPPPuuCtCtt C{RRPRR3Ps~PRR<tYtsCt<tYtsCt<VVYVsVlVVCVq<SS$St<WtWYtsCt<tYtsCttW<tYtsCt<tYtsCtRPRPRUZRRDEuEGuGWtuut !u!#u#=t@AuACuC]t`auacuct`tVOVtttttptptlVtlthVthtdVtditdt`Vt`lt`t\Vt\tXVtXSP'SQSuu\t\tZVtt\tttp\tpSP S\]u]_u_:t\:ttt:tttp:tp~SPSV!:Vuut P EQK[Q`pQvQQERK[R`pRvRRuuCtPCthRtdRCtdFQKWQQ&3Q>>Ct SWS&W&(Q(FWFKQKWQ"W"&Q&CWtoPtoPtoPCtoR/RKWR&+R+3R(tpZtp6CtpoR$SS(R/KRRRP"$R$&RPPPPP"&P PPPDEuEGuGtDUPUtdD^R^t`DdQ[SSJSPPPSVSVVSVSPSJVuutPtH?RkrRQtGt S S#P%5S9?S?ORirSrRSRSRSR[SSRSV W 6V67W79R9BWBgVgkPkV%R%fVfvPvVPVRVPVEWPPW/7WCWWuu tPRRQ  u ust @@sttuuuwuwtttttSttStptltlthVPVVuuCtPP:CPRR:CRQ:CQ&S(8SACSDEuEGuGtDUPUWWRSSUPQQRRuu+tStS t +SVt V t +V+P,-u-/u/(t,5P5S(SOUPP P PLVV(V()u)+u+t(3P3oSrSS(7R7pVrVVuu~t  ~t  ~t /7tX(-tXPP tXtXtXtXeoPR&^R/7t~t~~t~OWWWW,9W/7tdtdth%td%'S'4V45S5VtdSVtdStdV|S|tdS-td-~S~tdStdVrSrsVstStVthtdSthtdthVtdS2td24S49V9ItdISthS`S`otdo~S/7t~gt~ot~t~mQmrt~t~Qt~,t~9It~ISQ[`Q`~t~sW(gWuWWVrVVI`V/7t~]gt~ot~t~t~t~t~,t~9It~`ot~JQ9IQP'RgoPCrR"RR/7t~t~~t~/7t~t~~t~/7t~4gt~ot~t~t~t~t~v,t~9It~`ot~-SS9IS/7tltlVtl(V(gtltltlVVtlWVWtltltltl ,tl9DVDItl`otl/7t~>gt~ot~t~t~t~t~(,t~9It~`ot~y~t~P(-P-JP/7t(-t tttt/7t(-t tttt(-S  S / P/ 5 PB S PS S S y Sy P P P  S % P1 I Px P S P P P P S P9S9FPFeSekP{{S{PSSPSPP P"P/1PDRPR^S^vPPSS/7t`(-t~ t` S t~S t` t~  t`  t~ ) t`) t~ t`t`t\t`t\t`/7t(-t tttt/7t(-t t tttt/7t(-t tttt/7t(-t tttt/7t(-t tttt/7t(-t tttt/7t~(-t~ t~t~t~t~/7t~(-t~ t~t~t~t~/7t~(-t~ t~t~t~t~/7tL(-tL p tLp t~ tL q tPq | tL|  tP @ tL@ F t~F tP tL tP tL  t~ tPtLtPtL/7t~(-t~ t~t~t~t~(-S & SJ S S S _ S SFKSSRSSSS R R R R R/7t~(-t~ t~t~t~t~(-S S S S _ S S SFKSSSSRR&/R=DRKRRuut !u!#u#Ct JJCtJRtp_CtpJRtl\CtlJRthCthJRtdCtdJOV'V*CVCPWPYPY(W*CWuumtPKSOmSRMWMOROmW&LVORPRbVbmPpquqsus*tpPpR*t\pQ*tXStdStdDSDGtdGStdS*StlStl *tlV*VPRRRR.ARDqRRRRtpWtpWtp*tp,-u-/u/.t,@P@uSuSS.S,\R\VRV$P$.V,IQIW.WuS.Sgts.ts01u13u3yt0XPX`tl`zPz;tl;OPOytl0XRXythE VyVKWyW|}u}utuu[t[ttp[tptltl[tlth[thtdtd[tdW\W\V[Wt`#t`#SVSt`[t` t\[t\uu't()u)+u+0t01u13u38t89u9;u;vt8HHLPLvt8LLNt Nv8LLNtNvJLWLNVNYWYsVstWLrSxyuy{u{tuutuut S tuu~tAAHSHZPbdSd~tAA~t AA~tA A~tuutVuutuu`t++?S?BtB`SNPW`auacuct`yyQt Q t`t   t `t  t` t  t`Pt  PttP tPtT tTtX tXt\ t\t` t`VWVAWAVWWV VW}tsP5ts5;P;DPD|ts|PtsPPtsPtststd tdth thtl tlR>RDWRRRRWlRsRuuLtCCXRXtRt@R@Lt**Lth00Ltd6 6Lt`Ktl@LtlXVV@LVXtp@LtpXWSWW@LWLMuMOuOtLooVtVLoot cWWvSSuuwt!!wt!!wt WDWFwW VCVFwVtl<R<FtlFKRKotlowR!SSPSPSBSBHPOSSPBSFwS!tstsPtsPVtsV\PctstsPwts!1PSsPPP<>PIUPXwPxyuy{u{tuu* t R& S, - u- / u/ i t, ; ; i t, A A i t, W W W  t @ W@ F tF i W, W  W V  t ? V? F tF i V, W W S  t > S> F tF i S  V S  t@l m um o uo t u u t u u t u u t1 t| u u t S Suu=t  Pt*P*3t3;P;=t1P3;P@AuACuCt@Tc}Suutuu't##'th4rtl|tltp'tpuustVtNVNQtQYVY\t\pVpstSt MSQUSU\t \oSFFQtQ\\jtjs>QQ\jQ".P06P$<WtuuuwuwttWttt ttSVPPPuut P NVPVRMSPSQ&&t^rPw~PuuDtS t DS V t DV ttDEuEGuGtit|uutPtPt66t td-WW+6tk6>R>RtkRoRtkRR6tl6`VqVV6tp>ARRRRuu3t45u57u7t4FFStSwRIhRRuu tPtP t tftg.tg tgth thV0gVgtpV VyPPPtRRiWW0iWW WS0ySSSS SPP0;P PMtltl !u!#u#t //tl ::CSCKt KYSYat aSt S ::KRKaRaRRvVVPuutuu&tP&Q()u)+u+t(9P9tX<\t`\tlM_tp_thRR RkVVVkVVVuu t@@DtDPP6t6WQW^t^xQx tt vvt $t $PPt  t CCxt xt t +t +::ht h)t )GGt   t   t   t 55 t vtvy yt  t  MtM^ ^+t+: :hth  ttGGRtR< < ] t] tBBatatt"t"  t  t tStS+tS)GtS tS tS tS tS8APvxP+PP P 7 P P  P/ : PO Z P PvtTtT tT7 tT / tTl  tT tT tT tTV V7 V V * Vl  V V V G V] V V VvtXtX? tX7 tX / tXl  tX tX tX9 O P  Pz  Pvt\t\F t\7 t\ / t\l  t\ t\ t\vt`t`M t`7 t` / t`l  t` t` t`vtdtdT td7 td / tdl  td td tdSv|SS SS^S:hSS"SGS S  S SVV VV^V:FVVVVRV V  V Vt@t@ t@Mt@^t@+t@:ht@t@"t@) t@cyPP$PlP:IP[^PPReP  PtDtD tDMtD^tD+tD:htDtD"tD) tDtHtH tHMtH^tH+tH:htHtH"tH) tHtLtL tLMtL^tL+tL:htLtL"tL) tL u u  tuut !u!#u#>tuuBt P@@P P "t|9>t|>@P@Bt|"R3BRuut7S7;t;S(W(3Q39W9;Q;WWWQPQWQP(V(3P38V;cVcPVPVPVP!Q!(P(3R35P56R;=P=FRFTPTRuuxtPxth$R4FRmxRQxtdxyuy{u{txPthxRRRxQtduuat]]tt..att t t \t \))?t ?t t ||t $ $ t  t t t GG^t ^t Bt B{{t ^^t t fft t 4t 4CC}t }t DDat ]W]tWt.W.at t;VF2t=t  t  tFtFWWt22tt}}tt==at  t tWWta@tvtv.atvJtvwtwwtvtwtvtwtv\tw\)tv)?tw?tvtwtvtwstvstw tv tw tvtwtvtwtv.^tw^tvtwtvBtwBrtvrtwRtvRWtwW^tv^twtvtwtvtwtv4tw4CtvC}tw}tvtwatv0tw\ tw\ ~ S~ tw tw tw$htwhmtwmtwSatw6tvW)tv)?W?tvtvWtv.tvWatvTtvtv.atv]tvtvtvtv0tv05tv5tv&tv&tvtvtv tv tvG tvG _ tv_ k tvk z tvz tv #tv#tvtvtvtvtvtv.^tv^tvtvtvtvtvtv-tv-tvtvmtvmtvtvtvtvtvtv4tv4CtvC}tv}tvtvDtvDatv]tvtv.atv]tvtv.atv3gSP V S S S S  SF K S6 ; S S S, 2 S^ z S SS?DSP[SS#2SglSS&+S SS %SYVV^V]W W W W.aW]SUSS?bSSSSSS.ZS^SS]tvtv.atv]QtvQ\tw\tvtwtvVtvVtwtv.LtvLQtwQtvtwtvtwtvtwtvCtwCatv]tvtv.atv]QUQQQ\Q))Q?EQbwQQ-Q@QQKQQQ D QJ Q C QK g Q; Q Q& R QX Q#uQQtQQQ2QQQ.MQQQBQQFWQ+2QQQ4CQ}QQQ%QqPRmP $ PPQ@rQQQ]QUQ?EQQ4RCRRQQRQR.MQ^jRRV =V=S4VS}VV=aV]thth.ath]VUkVkqPqVV\V?VVVVV ^ V; VVVVV2V.?P?[VV;WV+2V25P5yVVVV4}VVVV%VKQe"S1W4VS S P =S}SPSS3=SBMSMWPWS=?S?DPDaS QQQV@rV^ ; VV4DVV+VVVVV%=VW@rW ; WW4DWW+WWWWWW%=W@RP & PPP +PP P]tvtv.atvP]VUVV\V?VVVVYeVegPgV ^ V; VVVVV2VVP.[VVVFWV+2VVVV4}VVVV%V]QUQ?EQQQQQQ.MQ^QQ]SUSS?bSSxSPS.ZS+-S-2PC`SOS)SSV)V]VVP)VEVV\ V P?VVVVV ^ V; VVVVV2V.[VVFWV+2VVVV4}VVVV%V]SUSSS)bSSS.ZSS]VUVPVV\V?VVPVVV ^ V; VVVVV2V.[VVVFWV+2VVVV4}VVVV%VRRjrR]VUVVPWV\V?VVVVV ^ V; VVVVV2VV.[VVVVFWV+2VVVV4}VVVV%V]SUSSSP\S?bSSS.ZSSSPS]VUVV\V?VVVVV ^ V; VVVVV2V.[VVFWV+2VVVV4}VVVV%V]VUVV\V?VVVV V ^ V; VVVVV2V.[VVFV+2VVVV4}VVVV%V]SUSS?bSS S  P \ S S S S.ZSWYSY^P^SS]SUSSQ\S?bSSSPS.ZSSSSP4S]SUSS?bShqSq{P{S.ZS3S`}S]SUSS?bSS.ZSWbSblPlSSSSPuu4t45u57u7St4LLSt4LLSt JLPNSPTUuUWuWstTlllPlntnsPsstTllst tuuuwuwtttPPuut  PtPtuu)t  Rt)R))t  P)t uu tuutPtPtAAt t AAtt5BtRttt(tVtVtlJVJSVth^V^xSx|tl|thStlYSY~V~tlthV*V*VSVV(tLtLrSrvPvStSStS'S5GSGtsStSaSotSS^tS^|ts|tSYtsY~S~tstS*S*VtsVftSfPAtTtTS1S{SS%3SAPWP<W<DSDPWSP#W#>P^|P|SPSPhPPWW&(W*VWuutuu.t((,S01u13u3Xt0<P<UVUXP0BRBTSTXR0XQ0@@GPGXtXYuY[u[tXjPjWPXpRpSRXgQgVQXnnQtXnnsPst uu2tPtpP2tpRRQQ Q#Q-2Qt##2tSS#t ##-t-2VPV#*VV V-2VRRRR%(R-2RW!W#+W02W45u57u7t4CPC[W]WW4mRRRR4KQKZV]VVSUPmvRv|PRRU]tctctctcUYSSSS u  u rt.PAGPejPR=SAnSnrRQ>VAoV#,RArRtuuuwuwottPot`tRot\tQWQWQoWVVVQ&V&0R0EVERRkoVtpSAtpAfSfmtpmoSpquqsustxPuutRQStStuu=t;S;=t@AuACuCt@TTiPitPt@T TVtVtV[mRRRuultlt'=R=NRtRRPRP R PRP(R(7P7KRKYPiRRQP R 7P7CRFWPW^R`PRRP9<R'=R=NRtRR R7BRRRR.0R9CRRR9<RVVlVS't`'-S-3t`3=S=mt`mSPSt`St` S WSt`S9W9ISIWSWt`Slt` VWVrWrWWW9IWWWWlWt_lt_lmumouo2tlP2t|lRlQt|Dt|i|t|t|t|"t|"#t|#b$t|n$A&t|Q&*t|*/t|/2t|l2t! + t| t| P t|. t| P =t|=CQC[P[lQluPuQt|Pt|t|Qt|LQLUPUdQ b$t|b$i$Qi$&t|& 'Q ' 'S ')'P)''S'(S( (S'(C(S}((S((P((S((t|()S9)J)t|J)m)Qm)v)Pv))Q))P))Q))t|))S*[*t|[*i*Qi**t|**SK,P,SP,U,QU,,S,,Q,,Q,!-QE.\.Q.0t|00S00Q00P0b1Q}11S11Q11P1F2Q22Q! ( V P V P V P. P VP u Qu V P Q P V V PV t Vt P V P VPVPVPVP8V8PVPV3P3VPV)P)VPQPQPP Q PVPVPVP*V*PVPV9P9OVOP V %P%[V[PVPVgPgwVwPVP[V[PVPVPVPVP V  P [!V[!!P!!V!"P"#V##Q##V##Q#A&PA&~&V~&(P()Q))P))Q)9)S9)@)Q@)J)PJ)O)VO))P))V)*P*F*VF*,P,,V,,P,,V,,P,,P,,V,-PE.T.RT.f.P..P.e/Ve//P/)0V)0q0Pq00V00P01R1 1P 11R1(1P(1.1R.1R1RR1X1P}11P11R11P11R1 2P 22R252R52L2P22R22P22V22P! + t|@ t|. t| V t|Wt|W\t|\eWk!t|!"V" #t| ##S#%t|%:&V:&V&t|V&Y&S_&&t|&&V&&t|&&W&x(t|x(}(t|}((t|((t|(9)t|9))t|))W)*t|**t|**t|*M+t|M++S++P+K,t|K,.t|.)0t|)0B0WB00t|00t|00W01t|12W252t|52;2W;22t|22W22t|-tp-,-P,-2tp(t|( (Q (2t|! + t|P t|. t|2t|! + t|Z t|  V  t| V t|. t|6V6t|nt|nVt|V\t|\qVq!t|!!V!)t|))V)2t|! + t|F t|. t|2t|! + t|d t|. t|2t|! + t|n t|. t|$t|o%B0t|q02t|S . S! + t| t|. t|2t|! ) W I W W W. WV w W #W%WWWW3W)WWWOWWW9WWWgWWWW2WW W !@"W""W#b$Wn$$WA&V&W9)J)W))W))W**WF*[*W..WD/v/W//W/)0W00W ! S S. S SV y S 1SSSS3LSS)SSSSSnSS)SSS9ZSSSg|S9S2SSSS !!S!!S""S##Sb$n$S:&V&S))S[*r*S..S! + t| t|. =t|=CPCt|Pt|2t|! ( V V V V. V V VV V V8VV3V)VVVV*VV9OV[VVgV4V2[VVV V !V!!V"#Vb$n$VA&~&VJ))V))P))V))P))V*F*V[**V*+V+K,V.e/V//Vq00V! ) W ! S! I W W#=W=SWSWnSWWSWESUS6 ; S!!Wb$n$WJ)s)Sv))S))W[*r*Sr**W**S+*+S++S..S W W6 W2+8+W++WP""P! ( V V V V. V V VV V V8VV3V)VVVV*VV9OV[VVgV4V2[VVV V !V!!V"#Vb$n$VA&~&V&(V(9)VJ)O)V)*V*F*V[**V**VK,,V,,V--VE..V.e/V//Vq01V12V&22V! + t| t|. t|2t| ' S S SSS![!S!!S))S)*S{**S*+2+SP,U,S=.E.S..S{//S!0)0Su1}1S! + P P. P (P ((S()P))S)*P**S*2P! ( V))VK,U,V[-f-Vf-i-Pi-*.V*.8.P8.E.V..V& 'S))S--S--S-*.S..S ! SLSnSS!!S##S  P * POP!!P##P Q  Q  Q QKQ !!Q2!8!Q/0Q R !(!R2!N!R."="R$$R..RT/b/R22u22u234t2333V33t34V44t4 4V 44t434V2333t 3334t 44434t 2333t33P33P33P333W33W4454u5474u74p4t44b4b4p4t44b4b4p4t 44b4b4p4t`4i4Pn4n4Pp4q4uq4s4us4S_tp44P4S_t~p44R4s=t~s==P=_>t~_>j>Pj>+Ct~+CHCPHCLt~LLPLNt~NNPNOt~O$OP$OeSt~eSjSPjSSt~SSPSSt~SSPSSt~SSPSSt~SSPSSt~SSPSS_t~p44Q4S_t~p4667t7\9\9TtTTTWtWWWaXtaXyXyX^t^)^)^S_tp4*6*67t 7?9?9Tt TTTaXt aXyXyX^t ^)^)^S_t p425257t7?9?9TtTTT^t^)^)^S_tp4? ?"Bt"B*T *TTtTT TCUtCU[ [V\tV\H] H]Y]tY]] ] ^t ^S_ p4667t799TtTTTWtWWWaXtaXyXyX^t^)^)^S_tH5M5RM5 6tD 6&6S866Qq77tD859tD59;9S?9S9Q99tD99R99P99R9::tD::a:Ra:;tD;';R';Y;tDY;;R;;tD;;P;;tD;<R<<tD<=R=a?tDa??Q?6@tD6@@W@@tD@+AQ+ABS"BDtDD DR DBDPUDDtDDEREERE HtD H>HR>HHtDH+IQ+IdKtDdK|KP|KKQKKPKKtDKLRLcMtDcMMRMOtDOPRPPRfPPRPPtDiQQtDQQRQQtDQQR7RARtDKRStDSbSRbSjStDjSSPSTtDTTSTTtDTTRTTPTCUWCUUtDU?VRqVWRVWWtDWWQWWRWWtDWWRW XtD XLXQLXaXRaXqXtDqXyXSyXXtDXXRXYtDYYPYvYtDvYYPYYRZ[R[[tD[[R[[tD[[R[Y\tDY\b\Pb\m\R{\\R\\tD\=]tDH]Y]tD]^tD)^k^tDk^q^Rq^^tD^^R$_L_RH5*6tpq77tp8?9tp9KtpKKRKQtp7RWtpWXtpXXRX^tp)^S_tpH5*6t~67t~8?9t~9Wt~W^t~)^S_t~H5*6t~66tT66tX67t~8?9t~z99tT99tX9+;t~+;7;tX7;=t~=K>tXK>)At~)A"BtT"BdCt~dCCtXCJt~J[KtX[KLt~LcMtXcMMt~M4NtX4NUNt~UNOtXONOt~NOOtXORt~R2RtX2RSt~SStXSTt~T1UtX1UWt~WWtXWWtTWWt~WWtXWXt~XYtXYYt~YOYtXOYYYt~YYdYtXdY[t~[,[tX,[6[t~6[[tX[[t~[[tX[[t~[[tX[[t~[[tX[\t~\\tX\\t~\]tX]^t~)^S_t~H5*6t~67t~8?9t~9Rt~)RWt~W^t~)^S_t~H5*6t~77t~8?9t~9Qt~RRt~7RWt~W=]t~H]^t~)^S_t~H5*6t~77t~8?9t~9Qt~RRt~7RWt~W^t~)^S_t~4<t~<'<R'<&=t~&=_=V_=Gt~GGQGGSGGQGfKt~fKKSKZLt~ZLLRLOt~OsPVsP}Pt~}PPVPPt~PiQViQ7Rt~7RARVARLUt~LUfUQfUUSUZXt~ZXaXVaXXt~XXRXdYt~dYYSY[t~[[Q[V\t~V\m\Sm\{\V{\Y]t~Y]]V]L_t~L_S_VH5*6t~%77t~8?9t~9Qt~7RWt~W^t~)^S_t~4(@t~(@(@P(@1@t~1@;@P;@@t~@@R@S_t~H5*6t~/77t~8?9t~9Qt~7RWt~W^t~)^S_t~H5*6t~977t~8?9t~9Qt~7RWt~W^t~)^S_t~47t~*8^t~)^S_t~47t~7S_t~47t~7S_t~57t~7S_t~57t8S_tH5*6t@77t8?9t9Qt7RWtW^t)^S_t57t7S_t57t7S_tH5*6tG77t8?9t9Qt7RWtW^t)^S_tH5*6tq77t8?9t9Qt7RWtW^t)^S_t$57t8S_t+57t8S_t77PPPP[[P77POOP\\P77PT;Y;P77P99PFRKRPH5M5Q77Q::n:QzRRRRRQRSQSSQSTRTTQW XQyXXQ[[Q[[R ^ ^Q^^QH55S::J:S??SA+ASRRSSTSTTS*TbTSWXSyXXS[$\S ^^S^^S77P SSP[[PH5M5R77R09?9R99R99R9":R+:a:RY;;R;;R;=R_=e=R=>RK>>R> ?R??RA AR)ATRUVWRdWWRWXRLXZXRyXXRXXRXXRXXRYYRYY\YR6[@[RJ[V[R[[R[[R[[R[[R[[R\\R\\R]]R)]H]R ^^RA^q^R^^RY[ZQ^3_Wq77Q:Y;QiQvQQQQQQQQQ::Vq77Q;Y;QvQQQQQQH5*6t~q77t~8?9t~9Qt~7RWt~W^t~)^S_t~77Q99Qc;;Q;;QARKRQ77Q99Q;;QARKRQH5*6t~q77t~8?9t~9Qt~7RWt~W^t~)^S_t~H5*6t~q77t~8?9t~9Qt~7RWt~W^t~)^S_t~77Q99QY;c;Q+=F=QF=[=P[=_=QOOPO;PQfPPQPQQ7R:RQ:RARPARKRQZXaXQm\{\QY]}]Q]]Q99RY;;R;;RfPPRAQiQRN_S_R77Q99QY;c;QP;PS;PIPQIPTPSTPjPQjPmPSmPPQARKRQ\XaXSm\{\S99RY;;R;;R8PPR77Q99QY;c;QfPPQARKRQ]]Q77P==P\\P77P?>K>P~[[P77P>>PXXP77P>>PXXP::?:P0?f?P??P??PSSPWWPWXPyXXP ^^P)^A^PH5*6t~q77t~8?9t~9Qt~7RWt~W^t~)^S_t~77PCCP5Y:YP77PIDUDPYYP77PwDDP YYPH5M5R77R09?9R99R99R9":R+:a:RY;;R;;R;=R_=e=R=>RK>>R> ?R??RA AR)ATRTTRUVWRdWWRWWRWXRLXZXRyXXRXXRXXRXXRYYRYY\YRZ[R6[@[RJ[V[R[[R[[R[[R[[R[[R{\\R\\R\\R]]R)]H]R ^^RA^q^R^^R77PBENEP\\PH5M5R77R09?9R99R99R9":R+:a:RY;;R;;R;=R_=e=R=>RK>>R> ?R??RA AR)ATRUVWRdWWRWXRLXZXRyXXRXXRXXRXXRYYRYY\YR,[@[RJ[V[R[[R[[R[[R[[R[[R\\R\\R]]R)]H]R ^^RA^q^R^^R77PFFP1[6[PH5M5R 6*6R77R09?9R99R99R9":R+:a:RY;;R;;R;=R_=e=R=>RK>>R> ?R??RA AR)A"BRYB\BRCCRCDRUDDREERFFR G'GR'G5GP5G;GR;GJGPJGhIRIIRJJR[KLRcMMRMINROjOROORPPRZRzRRSbSRSSRSSRTTR#T>TRTTRCUVWRVWdWPdWWRWWRWXRLXZXRyXXRXXRXXRXXRYYRYY\YRdYzYRZ[R6[@[RJ[V[R[[R[[R[[R[[R[[RV\]\R\\R\\R]]R)]H]R ^^RA^q^R^^R77PGGP[[PH5*6tq77t8?9t9Qt7RWtW=]tH]^t)^S_tH5*6tq77t8?9t9Qt7RWtW^t)^S_tGGPH5M5R77R99R99R9":R+:a:RY;;R;;R;;R<<R= =R==R_=e=R=>RK>>R> ?R??RA AR)AHHRHHRI9IRMIhIRIIRJJR[KmKRKKRLLRcMMRMINROjOROORPPRZRzRRSSRSSRTTR#T%TR*T>TRqVwVRdWWRWXRyXXRXXRXXRYYRYY\YR6[@[RJ[V[R[[R[[R[[R[[R[[R\\R]]R)]H]R ^^RA^q^R^^RH5*6t~q77t~8?9t~9Qt~7RWt~W^t~)^S_t~77PxJJPTYYYPH5M5R77R09?9R99R99R9":R+:a:RY;;R;;R;=R_=e=R=>RK>>R> ?R??RA AR)ATRUVWRdWWRWXRLXZXRyXXRXXRXXRXXRYYRYY\YR6[V[R[[R[[R[[R[[R[[R\\R\\R]]R)]H]R ^^RA^q^R^^R77POK[KPE[J[P77PKKPXXP77PwLLPXXP77PWMcMP?YDYPH5M5R77R09?9R99R99R9":R+:a:RY;;R;;R;=R_=e=R=>RK>>R> ?R??RA AR)ATRTTRUVWRdWWRWWRWXRLXZXRyXXRXXRXXRXXRYYRYY\YRZ[R6[@[RJ[V[R[[R[[R[[R[[R[[R\\R\\R]]R)]H]R ^^RA^q^R^^R77P(N4NP;[@[P77PNOP Y%YP77PPPP[[P77PSSPTTP77PaVqVP\\P77PFWVWP\\P77PXXP$])]P77P_^k^P^^PT_U_uU_W_uW__t__u__u__t__u__u_Pbt___Pbt____t _{`{``t ````t ```aPa[at [aaaaPa bt bPb____t___Pbt__ __t_{` {``t`` ``t`a a8at8ama maataa abtbHb HbPbt____t___Pbt____S__t_{`S{``t` aS a[at[aaSa bt bPbS____V__t _}`V}``R`8aV8a[aR[abVb bR bPbV____t$_```t$`Pb__ __t(_` ``t(`Pb __P9`v`P``P``P``P[adaPaaPaaP5b?bP__th_Pbthma{aP{aaPaaPHbKbP{`}`Ra6aRabR__W9`?`Ws``W``W`[aWaaWa bW5b?bWPbQbuQbSbuSbubtxbybuyb{bu{bctxbbbbVbbVbpcVccVxbbbbt ecct cct xbbbctxbbbbRbbtbbRb cR cctccRbbVpcwcVwccPccVccPbbSbhcSccSccRttuttu !t!#t#Ou ++<R<CuCORPQtQStSiupqtqstsuttuttuQttuRtt$u01t13t3DuPQtQStSuP[[QttuRttuRttuRttuttu**qSqu9S9CuCS6tV'VCVnQ'QCQQ.;PPPttXuP P VEPEXV*QEXQ.JP|PEXP`atactcu`kkuPuhYuhuhuh1PRGNPSNkPRPRP^PRPRPRSLS?TS;Q;>P>{QQPP1FQ^lQPPQ+QQVQ.V.1W1;P;]V]WVWVNWP^Q^gPq{V{WVQWW;AS`wSwRSRSSSS?STSFQkulP$PR$,ulR,ulP+ul+-P-<PR<FulRFulP,6R6=P=FR1FRFTRttumVpVuVuVWpu pWu Wu WS W PfWflSlnWpySSPyPP S/lSySPpyPpulpuptt3u3u3u )0PttuFSFSWSSWS(W(*u*cSczWz|u|SWS*u *cc|u |FF*u*UU|u|uU'VcyVPV\*ulc|ulul*6us6>P>uslvQQQttukku,,/R/u ,,uk ku 1FWFkSkqWqSWttKu7V79u9KV6S69u 9KSKQtt~uRuR\\~uRu R\\~u XSX\u\~SYV\mV2W2BupBZWZ\up\~Wttuuu VVWupWupWupttu))VuVuV^^vu vu QlRttCuWuCWVu CVCuSSPCSQ'CQPQtQUtUuP``SuSuSuSuP``Qu Q !t!#t#u 77WuWuWuW 77Vu Vu Vu V JJuuuJupupJSPSSPSSPjlPR79ul9WPzPPultt!u01t13t35u0GG5u0GGWu Wu 5W0dduuu&u&5dVRVRV R VR&VdSS S&SG&ul05ul@AtACtCautt.u,P,.utt>u  )S)+u+8S8>u  >Rtt9u'u',,9u*S*,u ,4S49u 9Qttuuu Wu|W|~u~WVrVzSS[SoSVS{V~SVOQulQulQ%Q%)up)LQLNupN~QQQttu9V9<u<Vu!2MQu2<R]iPiuhPuhupRupRIRSRYPYSulPulStt9u  9Q  9R*P33P@AtAHtHu@VVu@u @VVSuFiQirRrQRQPPtt8uVu6V68u RR*8RS*5S@AtACtCGuPQtQStSYu`atactc|u`qqSu|S`qqWu |WVhVm|VTQttuttutt/uSWu|W|SWSV/Woou /uu/u 'SV'.u`V.bu`bhSVhu`SVu`Vu`SV+u`+8SV8lu`l|SVuX/uX01t13t3Su`atactcuttvu**FWFJuJWuWuWuvWvuh**CVCJuJVuVuVuvV=@SPSPPPPPSPttuRttvuvu-S1@S/W1tWttuttdu^W^du]VpqtqstsupWuWu~VVttu!!ur}S~VrStt:u@AtACtCquttuttutt uttYu'P'Yup'R'Yul'Q'YuhOuOY-MWOYWKS`atactczuttuuu u uVPSttiu66iu66iu 66iu6 6iuACVMeV24P<?P?bSpqtqstsupupu pup uVVPPSttgu'V'[u[gVgupSWS[u[gW gul'PVtt utt!utt&u""&u01t13t3Wu0RRWu`atactcu`uuWuWnVVttGuP1W3EW0V3DV/S3CSPQtQStSkuPddkubiPpqtqstsupSuSpu u PVtt_u_uppu _u --u_P-S`atactcuVSttOuOu R/<R5V<OVPQtQStSeupqtqstssupsu`psu\mWttMuPupMupWKWJVttIu1S13u3ISR3u 3IRPQtQStSuP__SuSP__lRlu RttuRu Ru ttuHQHuQuFVFHu HVu Vu VHRHuRu.ESH~SSttOuSuMSMOuPQtQStSuuttuttu !t!#t#u EEfVfmumV EEiWimu mW EEcScmumSttWu7S79u9KSKMuMWS*9REMR`atactcu`ssSuSuSPPttutt"u"u01t18t8yu0FFuRuyu ttu !t!(t(4u@AtACtCu@PPWuWuHSSttuWu7W79u9BWBDuDzWz|u|WuWuu V6V9AVDyV|VVS5S9@SDGS|SSGxSSttuqWqsusWpVoSttutt2uPV'V)2VS&S@AtACtCu@]]u@u @u@ u uY[PVrWWRRRttu  uu u2 27u7Y Yu  PFV"BWYW2FRWYRRttuuWu Wu WVuVuVPSS !t!#t#iu 22iu09PRgPpqtqstsupupu u puuPSPVtt uttu,,SuS!u!Su,,Vu VkPP*8PS!SSPP!PJXPPPXPP !P8HPXkPPJ]PPttuttu !t!#t#)uttuttu !t!(t(*u01t18t8:u@AtAHtHJuPQtQStSgupqtqsts1upPSpR+WV@AtACtCu@aau@aagSgmu mSu _mPmPttFuVuV5u5DVDFuWu FWV5VDFVPFSPP5FPPQtQStSuPzzuSuPzzWu WvxPVzSPttuW;up;RWRTupTbWb|up|WupWupu nQVbVPSTSJPSStt#u01t13t3u0DDVu=SSttuWuWuWu up2VV,S,SSttutt0utt"u01t13t3Su`atactcvuttuuPWSPSPVVtt*u01t13t39uttuR !t!#t#du BBbVbdu BBdu BBdu B BaSadu BBdQtt utt7u*PbeP%R%7u`%Q%7u\LSLYVYqSqrVuSV7S7V7S%sWu7W%upVWupWSupVupVup"V"0up07V@AtACtCu@ppuRTPSPWVttuSuSu9S9uUVuh^V^uhnVV.V9HSj~SWWSS,nSSW_WaWululVUVaVS_P_WWaup_WttuuuhFVFIuh%aV{V>Sa{SIS#/P/aW{WWIupGWtt u Ptt#u""P01t13t3QuNOP`atactclupqtqsts|uz{Pttuttutt;u@AtACtCaupqtqstsupupVu VputtuPtt$u01t13t3EuPQtQStSYu`atactcu`ssSSutt2uWu2WV2VS2S@AtACtCu@SSjSlSuttuSuSuRu Ru tt[u9S9;u;[S`atactcuP4S7iSlSPINPPttuttu !t!#t#1u@AtACtCIuPQtQStS1uPaaSuSuSu1SPaaRu 1RPu1u@AtACtCkupqtqstsuttuttuPup RZR+QZQKKZuZVWZW2VKSVVPttHuSuHS"-P:FPPQtQStSuP^^gSgiuiSttDuVuDVS;DSPQtQStSuP^^cSciuiSuciututcgSSttZuSuZS;;=u =Z;;=u=Z`atactcuttuupulWuW!u!W SuS!u!SVV!mVVVttRu`atactcu`SttuSuSVu Vtte uT T [ u[ t t w uw e FF u  D D e u FF u D D e u$ $W u * W* , u, A WA X uX e W?V W" ) V; A VA X WX e V Sdu`P u` e u` S; X S> S PM Qp q tq s ts up  S u S u{ u{ t t u  V  u V   u  u W W S S t t u  u  W u  W u 4 S  S W W S4 S V S V V t t uttu,,u,,pSpFu FS$&PCVFVZFu_u_pSBSttuuu VuVPWttbu^^bSpqtqstsuttutt(u"V"(u!Sttdu"u"%uhu %duh''du' '`W`dupqtqsts*upSu *upu*p *up*uPRPRQR'V01t13t3Wu0@@OROWR0@@IPOUPUWu `atactcu`uuul`xxuh`WuWuWSVVttEuP4S6CS!#PPQtQStSuPuPuRuR#u#&R&8S8xRxCuC~R~uRPRPuRu R uR-u-0R0NuNTRTVuVaRacucnRnuP  V[[pVpV  +V+;;CVCuhPuh VSVcpVsVV+6VCVScoSs&SHSC-S9hS{SWcqWsWCPWUWSupSXPX\up\`up`iPiupqWCWttuPuPWWu u R;u 'R'u P u R u P u P u (R(u R+u 3u WWu~u11& u& ? S? x u~x u S u~ u u~ u y u~y u u~ u <S<u~SuSu~KuKu~88u~uAu~AIuITSTau~auu~cucu~uu~QPQudWudAWAWQW]WudWudWudVWVlPlWRudRud W " Wy W R ud<WFZWWF W P ud +W+3ud3TWxWiWwWudWW/aWWcyWS>u>WSW u SuSuWu~1 u~bu~bePeu~8pu~pwPwu~ PkPPP %PFQPc}PPyu~yPu~Pu~Wu~1 u~u~8u~Wu~1M u~M Q u~ Q u~u~8u~WqRR1CR_ } R  R& > R ? R R B R R R<ARS_RR8hRxRRRNiRRRR R/;RRWVVV1 V  V Vy V<VVK_VVV8oVxVVVVNiVwVVV/aVVcyVWu~1 u~u~8u~Wu~' u~u~&+u~8u~PP P PPP(RPP P~WWFWWaWcWWSSS1S} S S S<KSSPSaS4SFcSSVSV1Sa V} S V Sy V V V S<VV<?V?KSKXVVVVIaViV%cSVP P1PP}  P?KPP%QP\cPPP P1PP}  P?KPP%PFQPPP PPPPP P1PP}  P<KPPP PpPPPPP P1PP}  P<KPPPP P1PP}  P6KPPPP PPPP P PPSSS1S} Sy u S S S SuSwu /uSVV1a V} V V Vc V V V<VFVKXV_bVVVVNViwVVV VIaVy|VVSSS1S} Sr S S S\SiwSS SySSP P~PP P-PNaPP P P-aPdkPP PzPPPP PPPPP Pr PbeP%QP\cPyPP PbeP}PPP Pr PbeP%PFQPyPPP PPRIPRPR" c VW<FVWsxVWVWVW VWP Pg P~PP Pg PPP PDIPP P1PP}  P PPttuuu 9QQQQNVhVSQuSttuttutt uttu !t!(t(*u01t15t57u@AtACtCu@jjuu@~~u u %%4u 4u @jju@ u  %u%T Twuw u u u >u> u u ToPPrPfPP%/PFW2W4W_S0S4?STSPSjSS_V1V4VVttuQVQSuSwVwyuyVuPSvSyStt6u@AtACtCZu`atactcu`~~Vu V`~~SuSttuPtt u !t!#t#ou eemSmou eeou eeouclPpqtqstsutt utt#u"""P01t13t3DuPQtQStSdupqtqstsuttuttuQttuRuRtt)u01t13t3lu0;;lQpqtqutu~uttuttuRttuRttuRttuR !t!#t#fu --VVVXuXdVdfu'USXcStt?u9Q9?u9R9?u 1P1?u ?uttdu!!HSHTuTdS!!<V<Tu T\V\du pqtqstsupVupSu pup uPttuttu !t!#t#Pu ??Pu=GPLNPPQtQStSYu`atactcu`u}PPttuttuVuVSSttuttQu OS24PIQR`atactcuttuuu WuSttmukWkmujV iSpqtqstsuWtt'u01t13t3tu0SGuGjSjtu0##+u +tS!P:CSjpS2V3WP9IV5DVeqVP+3W5EWV+2V5DVtt)u01t13t3uttuttfu!S!#u#dSdfuRu[RQ[fu ttuP !t!#t#3u22P@AtACtCSuttuttAuPQtQStSnupqtqstsuttuPttutt uttuttlu8R8?u?EREbublRlu *1P8:PLVP!P!;S?bSbgPghS<V?iVpqtqstsupWupu {Stt:u7V7:u:u 6S@AtACtCu@bbSEuE`S`uZ\PEaVdV#EuXOduXuXlCWd$WgWPdP.Eupup:CW$W:Eulul:Euh"uhttuu PVttuR !t!#t#Au **3P35u5:P:AuPQtQStSuPePehSpvSvPSceQehPrQPQPQQQttuuu Pttu  _S_iuiS  eWeiu iWEVZbV{VTVPXvRvxPxRtt uSu SV Vtt9u3S39u@AtACtCu@ggSuS@nnu u @ggpPpuPutRPttuS u Su  u !t!#t#AuttuunSnu nSUiPttQu0V02u2OVOQu,u ,22Qu /S/2u2=S=MPtt-u-Q+S+-u ttJu++FWFJu@V')PttuQttuVHSH|W|~V~WWSV|u |u ||uuxPPP|}PPPQRttutt utt]u,S,.u.JSJLuL]S&P.8P:DPL[Pttdu,,nSn1u1GSGLuL_S_duPSP1SGLS_dS!VdVIKP1WLdWwQb1uppqtqstsupuNNyuyupSu /S/Nu N_S_au awSwyu ySu Su puS/GS_aSwySSDFP]lPluSuPSuh/yuhuhup/?up?DVDNupayupPupDVNyVVWPJWNyWWQul/Nululuu't,,'t0Pt0't!2Q<MWOxQQQWQ 'W<Ot\t\ 't\)6tl6<R<tlR'tl,LVOVRVPVPQPQP V QQ"P<OtXtX 'tX<LVV<Otha|thth th[zPPP<HRR 'R<LVV 'Vuu_t<Vt <>VW>PVt P^VW^mtmVWVt VW Vt  _t""<Pt<_t'>QDSQ^mQQ_W^mtt_tt0DtpDPRPtpR tp _V5DRPfRfmtLmRRRP_tLBPP^cPPPP^mtXztX!tXtPP2RT_R:PT_P L` 4 H / L` 4 H / v` 4 H / L1AL19s19Ay` ` w /` w w Sw / 4 H  o A d i i-x i7x  7x i- HHIp i7Hx)i<uuh#h''=n'7H'7jnH'7&8:g:BXc8:$>:F@.:2kf m  \ f h ) t { 9 L 18 I]!5?5?!5?I^S^w<s<7s<<_EPEPs~<<_<C^!:(CKg-K(-K"(-K"(JJ<* + (V|o~`]-(Vo~`<]_-A(]|_g-A(- (-}mr)_s P b , @  { S = D ) 0 ) }mr)_s P b , @  { S F  =  # RR*.I*DI* 5XvC @LFw> <FwW  U i : l H ^ (-8>-8^Fmd_laxv   )G+5:l  /  7    G":h^S  $@3;'U^aw% =a}2FF24'F2<;F2< 3}<=a X ; %=+ S S^rC`+2'T?b)5?UE)ktFW )?FW )?tHrn{QQe{W  WQ\4nb`}BvQVY|^k|^|(*Vl%lo~W!( .  . P //9)J)~&&#b$##=""!."n ..*K,[**J))b$n$ 6 2+K,A&V&""A&V&""02)0B0U,.**)*(9)&(o%:&  ^T'\''(((**(())12b1}1b,H.22H..0b1D##!!D##!!22n$o%B0q0(($o%B0q03q344U7_7]]\\\\[[SSPPOOPP[[OO\\_77=;Y;99ARKR9+:[[[[STKRSRS[[+:<:^L_k^^V\m\dYZXUUGG??+:<:$_L_^ _k^^jZZGG??:;QQlQQ'<<hVqV-VKVU)V<=MWVWW$WqVV+=[=Y]]m\{\ZXaX7R:RPlQOjPfPjPQlQPfPm\{\ZXaX==\\>K>y[[r>>XX>>XX>?)^A^ ^^yXXWLXT#TSSCCJ[V[[![YYdY%Y:YSSCC0Y:Y'DUDYYUDDYY ENE{\\}FF,[6[G`GVWdWGG[[GhI)]H]LXZXdWW#T*T>HPH3I\IhIVJJJVJJOYYY-K[K@[J[KKXXZLLXX5McM:YDYN4N6[@[NOY%YPP[[qSSTTKVhV\\$WMW\\XX])]A^k^^^___Pb__)bPb` b_`[aaHbPbaaY`q`a baa`[a{``*3*@&(&(*@&(*@*A$p\\T`~)03X_r02 (:(:@O/25;8X8L$9;57HO`d"*8 *8"8^8EZ^VX(P7xJSU7y~~z|9j37h0s0\_{npjl'K  (h,/Kh>@:<3jX e jX e   X "  DJp 7;>Wca?ca(1Fcpy& , cy"/w2 j "/w y"iw8N_< y Fyiw09Nk(1Fc ? Nx y "8x<F /I ;@hjHdhj/<13V_`mV_`mLjlXZx\bhh. #.HXp,8K0DL]GIT8BP'BP'"`p_"`p_.symtab.strtab.shstrtab.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges@ !@ܮ'|@|-@B9 5@\?@@@FH@HMP@PRT@T$X@x ]x f@ u^(}ԛp )sp:0,-EY (`-) 0 @@|@@@@@H@P@T@ @     @@H@(@;P@H@^@ mX@ t@@ D@L@<@P@T@P@!t@2@c @ @ @ @ @ ) @n8B@ \@ u@$#@4!@|@ @<H@i @Z$@%@%%@}.,&@cD&@O`'@1X'@'f'@Ot (@o @ @ @ @ |2@I@ @ @`@@8 `@@T/@2@@dT@wo`@H@@\(A@@  @$ F@F@7G@H@`I@/I@>K@P@M@],O@=jD@ tO@dP@CP@Q@R@X@ P@ T@ @@L@ H@ c@#(d@md@*Tf@<Xg@IU\@ [`@ ah@ryh@ l@ p@ d@ \@ t@ x@ |@ %y@0@ E@ Xbx~@w(@&P@@ @ @ @ @ @x$@x,@ 9CLVblt@@Ȯ@(@2$@̯@ @@j$@D7@qF@ V@X*i@ s@*@ `@x@ @ @  @ @ @  @ ! `@3 t@ ? H O Y f r {       $@  ,@ (@  2@ 2@  3@I! 4@ 8 = G 8@ S 08@g] f @  n @@ v B@ P@@a `@ D@  @ @ E@K F@R   K@ @   @  P@! , @@ ? K Q Y e R@7w      @  d@ @ @ @  @   v@E ! @`, @$ / @; @H @@O X b k @`q z            @y @ @ @   ' 0 9 B K @ T ] f r r | pv@0 @ @4 ]@N @ @ @@- 0@  @Q 7@ j@ p3@0R@ P@\u@*;@:0N@Bp@J|@[;@j @`x@"@ @!5@+@ @d@ @Oj@>`2@05@@  j@@ )i@U0s@=9@OC @@%O $@dQ@0mX{@5@Y@)P@@(@@ Y@@pK@ P)@h[@ @ @ @f8@"@+@ 8PK@?p@lH@@<Q @ W)@_@gpc@+r@{^@@+ @ @ 0U@P@V0@d @ 0K@ b@@Q@O$@* @ 6U@Km@Q @ f@/pDz@~]@ j@О@ T@&@@@ b@@1@o0Q@"`]@$ @  @ J@"P@& P_@k%@C@*2@:Cm@6x@@@'@@2@@dF@@k@U f@H@!DF@6М@+L0@FS@b@\$F@me@tP7@&]@K@@> @ @`R@ @@ @  @ `@.@@A^@N0@%@>t@"@@/ C@3[@!BН@P8@W@mh0@ r @ l@R@!p@m+@ s@G @@w@Xy@a 6@Y@ز@yh@ n@4#@+{@X1 @ FT@Yl@f@>@Ir8@@ .@vi@Ek@jl@  t@dG@@@ @ @' @@@*`@34u@'D@jR`O@aL@f @ng@fuШ@]|`@`x@\@  @l@(@H@@ @ g@#p@ r@@% 2@1 @ 4s@H9@G@P=@IZc@.a@@n@.w @ -@#@\@J0]@";@D@07@ @ r@b/@1@ @@0I@|w@@%@- @ 9h@mA@DM`%@.T0@dc0i@RiP@ x@R@ A@_x@s@C@  @ K@  @ r@  `F@ `C@y [@  B@"2 !@9 Q@A p\@;J \@ V | @%c B@qi `@{ @ h@H >@ u@crtstuff.c__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN____JCR_LIST____do_global_dtors_auxcompleted.2730p.2728frame_dummyobject.2742__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcrt0.cc_startanalyze.cadd_changecompareseqxvecyvecfdiagbdiagtoo_expensivebriefly_reportcontext.cfind_function_last_searchfind_function_last_matchpr_unidiff_hunkfind_hunkpr_context_hunkfind_functionprint_context_functionprint_unidiff_number_rangeprint_context_number_rangeprint_context_labeldiff.cexclude_optionsfiletypesummarize_regexp_listadd_regexptry_helpspecify_stylespecify_valuecompare_filesrecursivereport_identical_filesunidirectional_new_filenew_filecheck_stdoutfunction_regexp_listignore_regexp_listlongoptsshortoptsoption_help_msgidauthorship_msgidcopyright_stringgroup_format_optionC_ifdef_group_formats.2931line_format_optiondir.cdir_loopcompare_nameslocale_specific_sortingfailed_strcollcompare_names_for_qsorted.cprint_rcs_hunkpr_forward_ed_hunkprint_ed_hunkifdef.cgroups_letter_valuedo_printf_specprint_ifdef_linesformat_groupformat_ifdefnext_lineprint_ifdef_hunkio.cguess_linesprepare_textslurpsipequivs_allocequivsequivs_indexprime_offsetnbucketsbucketsnormal.cprint_normal_hunkside.ctab_from_toprint_half_lineprint_1sdiff_lineprint_sdiff_common_linesnext0next1print_sdiff_hunkutil.ccurrent_name0current_name1currently_recursivemsg_chainmsg_chain_endpr_pidversion.cbasename.cc-stack.cprogram_error_messagestack_overflow_messagecmpbuf.cerror.cerror_tailold_line_number.2045old_file_name.2044exclude.cfnmatch_no_wildcardsexitfail.cfreesoft.cgetopt.cmy_indexexchangefirst_nonoptlast_nonoptnextcharposixly_correctorderinggetopt1.cposixver.cquotesys.cstrftime.cmemcpy_uppcasememcpy_lowcasembstate_zeroxmalloc.cmalloc.crealloc.cstrtoumax.cfnmatch.cregex.cbyte_store_op1byte_store_op2byte_insert_op1byte_insert_op2byte_compile_rangebyte_common_op_match_null_string_pbyte_group_match_null_string_pbyte_alt_match_null_string_pre_error_msgid_idxre_error_msgidre_syntax_tablebyte_regex_compiledone.2363byte_re_match_2_internalbyte_reg_unset_dummyjmptable.3684ctype.cerrno.cliballoc.cl_errorCountl_possibleOverrunsl_inusel_bestBetl_warningCountl_memRootl_allocatedallocate_new_pagel_pageCountstrtol.csort.cstrncmp.cstrcasecmp.cmultibyte.cstrchr.cstrcmp.cmemchr.cmemcpy.cmemset.cstring.cmessaging.cmy_pidtimer.ctimersnext_timer_idrpchandler.asmlibrpc_rpc_handler.1librpc_rpc_handler.2sync.csync_rpccurrent_correlation_idpv.cenvvars.cenvvar_listgetenvvarsignal.csigmaskid.1786do_alarminit_signalssigactionsinitializedposix_files.cfd_listnext_fdposix_files_initfd_to_filegetpid.cstat.clost_statinode_numwait.cwait_listrpc_child_exitstrerror.cerror_message.1085posix_dir.crpc.csleep.clost_path.cget_path_elementscreate_process.cset_rpc_handler.cadd_intr_handler.cfprintf.cstdio.cstdout_buffile.cio_writeshm_sizeshm_idshm_ptrexit.catexit_listjprintf.cread_indextime.cmonat.1189tmasctime_bufctime_string__timeprintf.csprintf.cwctype.ctypesassert.csnprintf.cdirectory.cinit.cseek.cshared_memory.cputs.cmem_allocate.cwait_for_rpc.cparam.clist.clist_get_node_atlast_listlast_indexlast_nodestrcspn.cstrncpy.cstrcpy.cstrdup.cstrlen.cstrtok.clast.930unlink.caccess.clost_link.clibgcc2.cparse_pos_paramslongjmpxalloc_dieputcharxmallocxalloc_fail_funcstrcpyasctimeinit_dev_listunsetenvtranslate_line_numberrpc_send_responseyieldsetjmpfinish_outputrpc_get_envvarswaitpidtmpfileadd_exclude_fileversion_stringppb_from_argvstrtok_rstarting_filelist_sizerpc_get_responsepr_programprintfstdoutvsprintfprint_scriptlibrpc_rpc_handlerrpc_get_stringline_formatfind_reverse_changeswitch_stringungetcmessage5list_pushsigemptyset__internal_wcsrtombsstrerrorexcluded_filenamerpc_get_intrpl_reallocgetopt_longsnprintf_getopt_internalio_split_dirname__strtok_rmknodatolget_parent_pidre_syntax_optionsfree_excludelio_seekgetenviswcntrlgroup_formatfchmodlist_popiswpuncterrnostrtoldisblanksetlinebufiswalphagetsio_create_linkiswblankfiles_can_be_treated_as_binaryio_split_filenameppb_get_argctimer_cancelignore_file_name_casegetpidprint_normal_scriptfile_block_readqsorttime_formatio_get_absolute_pathfgets__getopt_initializediswxdigiterror_at_linegetcfind_changev_and_wait_for_rpcre_search_2memcpymem_freewait_for_rpcsetvbuftimer_callbackseekdirperrorignore_blank_linespaginatecreatinit_waitpidputsdup2rpc_send_string_responsebase_nameislowerprint_1_linetolowerrewinddiriswlowerinit_execvfeofread_filesmallocremovelist_is_emptyiswspaceprint_message_queuestrip_trailing_croptargbtowc_assertvsnprintfrpcstrtoumaxc_stack_actionstrtoul__dso_handleitoaispunctwctombopterrwcstombsreaddirre_matchjvprintferror_message_countisspacesuppress_common_linesfflushsetup_outputbrieflist_get_element_atinitial_tabregister_intr_handlerdirectory_openprint_ifdef_scriptmbstowcsputenv__umoddi3lseeksigaddsetconcatstrncasecmp__udivdi3setbufferabortprintf_putcgmtime_rchmodsprintf_putcmessageisxdigiterror_print_prognamealarmmessage_handlerstrtolstrnlencreate_shared_memorymblennew_excludeiswprintprogram_namerenamenstrftimeinit_memory_manageradd_excludestdio_initcallocposix2_versiondir_file_pathnameinit_dev_registerre_set_registersprint_context_headertranslate_rangestrtodlist_insertlist_destroytextwriteatofignore_regexpbegin_outputfstatexpand_tabsfprintfexit_failurekilliswgraphinit_service_registerctimechange_letterdirectory_createre_compile_patternadd_intr_handlerinit_sync_messagesvprintfspeed_large_filesmkfifo__deregister_frame_infochdiropen_shared_memorysdiff_merge_assist__dtor_end__fseekoutput_styleppb_is_validoptindmemchrfataljprintf_putcxcallocstdinwaitre_match_2send_messageinit_envvarsumaskmktime_startlstatferrorsyscall_pprint_context_scriptsignalreadcontextoutfileiswctypestrcollisupperstrncmpfpurgestrncpyunlinksetenvmem_allocate_physicalstrcasecmpgetenv_indexputsnrealloctowupperfilesset_rpc_handlerlines_differfunction_regexprpc_send_dword_responsesync_rpc_response_handlerinit_service_getsnprintf_putcstrtoksigfillsetfdopenxreallocinit_executeisalphaclose_shared_memorysigactionfreadstrduplist_createis_directorystrtoullregcompinit_messagingfopen__bss_startgetoptlocaltimememsetfnmatchmainfree_software_msgidprint_ed_scriptdebug_scriptftell__dtor_start__pr_forward_ed_scriptinit_service_get_namewctypeclearerrprint_rcs_scriptfclosegetenv_name_by_indexgetchargetppidregexechorizon_linestimeopendirisgraphignore_caseintr_handlerisalnumisprintmem_dma_allocateputcgetopt_long_onlystrcmpulltoaprintf_putsndupcreate_processsyscall_putsngetcwdcmdline_get_argcresponsessdiff_half_widthfgetcsprintfcmdline_copy_argvstrtofatexitstrcspnquote_system_argc_stack_dieblock_readrpc_get_dwordiswdigitregerrorstderroutput_1_line__internal_mbsrtowcserrorsdiff_column2_offsetre_compile_fastmapanalyze_hunksigismemberxalloc_msg_memory_exhausteddirectory_closelibrpc_c_rpc_handlerfputcprint_number_rangeoptoptdivmodpreadiswupperno_diff_means_no_outputlocaltime_rre_set_syntax__ctor_start__strftimepfatal_with_nameppb_copy_argvwait_child_addstatisdigitfwriteaccessdirectory_read_edatadestroy_process_endzallocrpl_malloc__ctor_end__mem_free_physicalminimalrewindre_max_failuresfreopenre_searchrpc_send_int_responserpc_response_handlerexitsyscall_timertowlowersigdelsetsetbufmem_allocateiswalnumerror_one_per_lineatoiiscntrlfprintf_putsnfprintf_putcgetenv_countfilenosyscall_vfile_label_exitregister_message_handlertimer_registergmtimestrlenopenbase_lentoupperleft_columnregfree__init_execstrchrio_remove_linkfputsdirectory_seekclosedir_Jv_RegisterClassesdiff_dirsbuffer_lcmlist_removefcntlignore_white_spacemkdir__register_frame_infoexcludedperror_with_namepwritecloseget_pid_signal_default_handlermbtowctelldirvfprintfget_cmdlinediff_2_filesraiseinit_process_exitfreeprint_sdiff_scriptsigprocmaskjprintf_putsnpackages/diffutils/2.8.1/man/0000755000175200017520000000000011517104606015507 5ustar tyndurtyndurpackages/diffutils/2.8.1/man/man1/0000755000175200017520000000000011517104606016343 5ustar tyndurtyndurpackages/diffutils/2.8.1/man/man1/diff3.10000644000175200017520000000365011517104606017424 0ustar tyndurtyndur.\" DO NOT MODIFY THIS FILE! It was generated by help2man 1.27. .TH DIFF3 "1" "April 2002" "diffutils 2.8.1" "User Commands" .SH NAME diff3 \- compare three files line by line .SH SYNOPSIS .B diff3 [\fIOPTION\fR]... \fIMYFILE OLDFILE YOURFILE\fR .SH DESCRIPTION Compare three files line by line. .TP \fB\-e\fR \fB\-\-ed\fR Output unmerged changes from OLDFILE to YOURFILE into MYFILE. .TP \fB\-E\fR \fB\-\-show\-overlap\fR Output unmerged changes, bracketing conflicts. .TP \fB\-A\fR \fB\-\-show\-all\fR Output all changes, bracketing conflicts. .TP \fB\-x\fR \fB\-\-overlap\-only\fR Output overlapping changes. .TP \fB\-X\fR Output overlapping changes, bracketing them. .TP \fB\-3\fR \fB\-\-easy\-only\fR Output unmerged nonoverlapping changes. .TP \fB\-m\fR \fB\-\-merge\fR Output merged file instead of ed script (default \fB\-A\fR). .TP \fB\-L\fR LABEL \fB\-\-label\fR=\fILABEL\fR Use LABEL instead of file name. .TP \fB\-i\fR Append `w' and `q' commands to ed scripts. .TP \fB\-a\fR \fB\-\-text\fR Treat all files as text. .TP \fB\-T\fR \fB\-\-initial\-tab\fR Make tabs line up by prepending a tab. .TP \fB\-\-diff\-program\fR=\fIPROGRAM\fR Use PROGRAM to compare files. .TP \fB\-v\fR \fB\-\-version\fR Output version info. .TP \fB\-\-help\fR Output this help. .PP If a FILE is `-', read standard input. .SH AUTHOR Written by Randy Smith. .SH "REPORTING BUGS" Report bugs to . .SH COPYRIGHT Copyright \(co 2002 Free Software Foundation, Inc. .PP This program comes with NO WARRANTY, to the extent permitted by law. You may redistribute copies of this program under the terms of the GNU General Public License. For more information about these matters, see the file named COPYING. .SH "SEE ALSO" The full documentation for .B diff3 is maintained as a Texinfo manual. If the .B info and .B diff3 programs are properly installed at your site, the command .IP .B info diff .PP should give you access to the complete manual. packages/diffutils/2.8.1/man/man1/cmp.10000644000175200017520000000357611517104606017217 0ustar tyndurtyndur.\" DO NOT MODIFY THIS FILE! It was generated by help2man 1.27. .TH CMP "1" "April 2002" "diffutils 2.8.1" "User Commands" .SH NAME cmp \- compare two files byte by byte .SH SYNOPSIS .B cmp [\fIOPTION\fR]... \fIFILE1 \fR[\fIFILE2 \fR[\fISKIP1 \fR[\fISKIP2\fR]]] .SH DESCRIPTION Compare two files byte by byte. .TP \fB\-b\fR \fB\-\-print\-bytes\fR Print differing bytes. .TP \fB\-i\fR SKIP \fB\-\-ignore\-initial\fR=\fISKIP\fR Skip the first SKIP bytes of input. .HP \fB\-i\fR SKIP1:SKIP2 \fB\-\-ignore\-initial\fR=\fISKIP1\fR:SKIP2 .IP Skip the first SKIP1 bytes of FILE1 and the first SKIP2 bytes of FILE2. .TP \fB\-l\fR \fB\-\-verbose\fR Output byte numbers and values of all differing bytes. .TP \fB\-n\fR LIMIT \fB\-\-bytes\fR=\fILIMIT\fR Compare at most LIMIT bytes. .TP \fB\-s\fR \fB\-\-quiet\fR \fB\-\-silent\fR Output nothing; yield exit status only. .TP \fB\-v\fR \fB\-\-version\fR Output version info. .TP \fB\-\-help\fR Output this help. .PP SKIP1 and SKIP2 are the number of bytes to skip in each file. SKIP values may be followed by the following multiplicative suffixes: kB 1000, K 1024, MB 1,000,000, M 1,048,576, GB 1,000,000,000, G 1,073,741,824, and so on for T, P, E, Z, Y. .PP If a FILE is `-' or missing, read standard input. .SH AUTHOR Written by Torbjorn Granlund and David MacKenzie. .SH "REPORTING BUGS" Report bugs to . .SH COPYRIGHT Copyright \(co 2002 Free Software Foundation, Inc. .PP This program comes with NO WARRANTY, to the extent permitted by law. You may redistribute copies of this program under the terms of the GNU General Public License. For more information about these matters, see the file named COPYING. .SH "SEE ALSO" The full documentation for .B cmp is maintained as a Texinfo manual. If the .B info and .B cmp programs are properly installed at your site, the command .IP .B info diff .PP should give you access to the complete manual. packages/diffutils/2.8.1/man/man1/sdiff.10000644000175200017520000000005711517104606017522 0ustar tyndurtyndur.ab help2man is required to generate this page packages/diffutils/2.8.1/man/man1/diff.10000644000175200017520000000005711517104606017337 0ustar tyndurtyndur.ab help2man is required to generate this page packages/diffutils/2.8.1/info/0000755000175200017520000000000011517104606015667 5ustar tyndurtyndurpackages/diffutils/2.8.1/info/diff.info0000644000175200017520000061355411517104606017472 0ustar tyndurtyndurThis is diff.info, produced by makeinfo version 4.2 from diff.texi. This manual is for GNU Diffutils (version 2.8.1, 5 April 2002), and documents the GNU `diff', `diff3', `sdiff', and `cmp' commands for showing the differences between files and the GNU `patch' command for using their output to update files. Copyright (C) 1992, 1993, 1994, 1998, 2001, 2002 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with no Invariant Sections, with the Front-Cover texts being "A GNU Manual," and with the Back-Cover Texts as in (a) below. A copy of the license is included in the section entitled "GNU Free Documentation License." (a) The FSF's Back-Cover Text is: "You have freedom to copy and modify this GNU Manual, like GNU software. Copies published by the Free Software Foundation raise funds for GNU development." INFO-DIR-SECTION Individual utilities START-INFO-DIR-ENTRY * cmp: (diff)Invoking cmp. Compare 2 files byte by byte. * diff: (diff)Invoking diff. Compare 2 files line by line. * diff3: (diff)Invoking diff3. Compare 3 files line by line. * patch: (diff)Invoking patch. Apply a patch to a file. * sdiff: (diff)Invoking sdiff. Merge 2 files side-by-side. END-INFO-DIR-ENTRY INFO-DIR-SECTION GNU packages START-INFO-DIR-ENTRY * Diff: (diff). Comparing and merging files. END-INFO-DIR-ENTRY  File: diff.info, Node: Top, Next: Overview, Up: (dir) Comparing and Merging Files *************************** This manual is for GNU Diffutils (version 2.8.1, 5 April 2002), and documents the GNU `diff', `diff3', `sdiff', and `cmp' commands for showing the differences between files and the GNU `patch' command for using their output to update files. Copyright (C) 1992, 1993, 1994, 1998, 2001, 2002 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with no Invariant Sections, with the Front-Cover texts being "A GNU Manual," and with the Back-Cover Texts as in (a) below. A copy of the license is included in the section entitled "GNU Free Documentation License." (a) The FSF's Back-Cover Text is: "You have freedom to copy and modify this GNU Manual, like GNU software. Copies published by the Free Software Foundation raise funds for GNU development." * Menu: * Overview:: Preliminary information. * Comparison:: What file comparison means. * Output Formats:: Formats for two-way difference reports. * Incomplete Lines:: Lines that lack trailing newlines. * Comparing Directories:: Comparing files and directories. * Adjusting Output:: Making `diff' output prettier. * diff Performance:: Making `diff' smarter or faster. * Comparing Three Files:: Formats for three-way difference reports. * diff3 Merging:: Merging from a common ancestor. * Interactive Merging:: Interactive merging with `sdiff'. * Merging with patch:: Using `patch' to change old files into new ones. * Making Patches:: Tips for making and using patch distributions. * Invoking cmp:: Compare two files byte by byte. * Invoking diff:: Compare two files line by line. * Invoking diff3:: Compare three files line by line. * Invoking patch:: Apply a diff file to an original. * Invoking sdiff:: Side-by-side merge of file differences. * Standards conformance:: Conformance to the POSIX standard. * Projects:: If you've found a bug or other shortcoming. * Copying This Manual:: How to make copies of this manual. * Index:: Index.  File: diff.info, Node: Overview, Next: Comparison, Prev: Top, Up: Top Overview ******** Computer users often find occasion to ask how two files differ. Perhaps one file is a newer version of the other file. Or maybe the two files started out as identical copies but were changed by different people. You can use the `diff' command to show differences between two files, or each corresponding file in two directories. `diff' outputs differences between files line by line in any of several formats, selectable by command line options. This set of differences is often called a "diff" or "patch". For files that are identical, `diff' normally produces no output; for binary (non-text) files, `diff' normally reports only that they are different. You can use the `cmp' command to show the byte and line numbers where two files differ. `cmp' can also show all the bytes that differ between the two files, side by side. A way to compare two files character by character is the Emacs command `M-x compare-windows'. *Note Other Window: (emacs)Other Window, for more information on that command. You can use the `diff3' command to show differences among three files. When two people have made independent changes to a common original, `diff3' can report the differences between the original and the two changed versions, and can produce a merged file that contains both persons' changes together with warnings about conflicts. You can use the `sdiff' command to merge two files interactively. You can use the set of differences produced by `diff' to distribute updates to text files (such as program source code) to other people. This method is especially useful when the differences are small compared to the complete files. Given `diff' output, you can use the `patch' program to update, or "patch", a copy of the file. If you think of `diff' as subtracting one file from another to produce their difference, you can think of `patch' as adding the difference to one file to reproduce the other. This manual first concentrates on making diffs, and later shows how to use diffs to update files. GNU `diff' was written by Paul Eggert, Mike Haertel, David Hayes, Richard Stallman, and Len Tower. Wayne Davison designed and implemented the unified output format. The basic algorithm is described in "An O(ND) Difference Algorithm and its Variations", Eugene W. Myers, `Algorithmica' Vol. 1 No. 2, 1986, pp. 251-266; and in "A File Comparison Program", Webb Miller and Eugene W. Myers, `Software--Practice and Experience' Vol. 15 No. 11, 1985, pp. 1025-1040. The algorithm was independently discovered as described in "Algorithms for Approximate String Matching", E. Ukkonen, `Information and Control' Vol. 64, 1985, pp. 100-118. GNU `diff3' was written by Randy Smith. GNU `sdiff' was written by Thomas Lord. GNU `cmp' was written by Torbjorn Granlund and David MacKenzie. `patch' was written mainly by Larry Wall and Paul Eggert; several GNU enhancements were contributed by Wayne Davison and David MacKenzie. Parts of this manual are adapted from a manual page written by Larry Wall, with his permission.  File: diff.info, Node: Comparison, Next: Output Formats, Prev: Overview, Up: Top What Comparison Means ********************* There are several ways to think about the differences between two files. One way to think of the differences is as a series of lines that were deleted from, inserted in, or changed in one file to produce the other file. `diff' compares two files line by line, finds groups of lines that differ, and reports each group of differing lines. It can report the differing lines in several formats, which have different purposes. GNU `diff' can show whether files are different without detailing the differences. It also provides ways to suppress certain kinds of differences that are not important to you. Most commonly, such differences are changes in the amount of white space between words or lines. `diff' also provides ways to suppress differences in alphabetic case or in lines that match a regular expression that you provide. These options can accumulate; for example, you can ignore changes in both white space and alphabetic case. Another way to think of the differences between two files is as a sequence of pairs of bytes that can be either identical or different. `cmp' reports the differences between two files byte by byte, instead of line by line. As a result, it is often more useful than `diff' for comparing binary files. For text files, `cmp' is useful mainly when you want to know only whether two files are identical, or whether one file is a prefix of the other. To illustrate the effect that considering changes byte by byte can have compared with considering them line by line, think of what happens if a single newline character is added to the beginning of a file. If that file is then compared with an otherwise identical file that lacks the newline at the beginning, `diff' will report that a blank line has been added to the file, while `cmp' will report that almost every byte of the two files differs. `diff3' normally compares three input files line by line, finds groups of lines that differ, and reports each group of differing lines. Its output is designed to make it easy to inspect two different sets of changes to the same file. * Menu: * Hunks:: Groups of differing lines. * White Space:: Suppressing differences in white space. * Blank Lines:: Suppressing differences in blank lines. * Case Folding:: Suppressing differences in alphabetic case. * Specified Folding:: Suppressing differences that match regular expressions. * Brief:: Summarizing which files are different. * Binary:: Comparing binary files or forcing text comparisons.  File: diff.info, Node: Hunks, Next: White Space, Up: Comparison Hunks ===== When comparing two files, `diff' finds sequences of lines common to both files, interspersed with groups of differing lines called "hunks". Comparing two identical files yields one sequence of common lines and no hunks, because no lines differ. Comparing two entirely different files yields no common lines and one large hunk that contains all lines of both files. In general, there are many ways to match up lines between two given files. `diff' tries to minimize the total hunk size by finding large sequences of common lines interspersed with small hunks of differing lines. For example, suppose the file `F' contains the three lines `a', `b', `c', and the file `G' contains the same three lines in reverse order `c', `b', `a'. If `diff' finds the line `c' as common, then the command `diff F G' produces this output: 1,2d0 < a < b 3a2,3 > b > a But if `diff' notices the common line `b' instead, it produces this output: 1c1 < a --- > c 3c3 < c --- > a It is also possible to find `a' as the common line. `diff' does not always find an optimal matching between the files; it takes shortcuts to run faster. But its output is usually close to the shortest possible. You can adjust this tradeoff with the `--minimal' option (*note diff Performance::).  File: diff.info, Node: White Space, Next: Blank Lines, Prev: Hunks, Up: Comparison Suppressing Differences in Blank and Tab Spacing ================================================ The `-E' and `--ignore-tab-expansion' options ignore the distinction between tabs and spaces on input. A tab is considered to be equivalent to the number of spaces to the next tab stop. `diff' assumes that tab stops are set every 8 print columns. The `-b' and `--ignore-space-change' options are stronger. They ignore white space at line end, and consider all other sequences of one or more white space characters to be equivalent. With these options, `diff' considers the following two lines to be equivalent, where `$' denotes the line end: Here lyeth muche rychnesse in lytell space. -- John Heywood$ Here lyeth muche rychnesse in lytell space. -- John Heywood $ The `-w' and `--ignore-all-space' options are stronger still. They ignore difference even if one line has white space where the other line has none. "White space" characters include tab, newline, vertical tab, form feed, carriage return, and space; some locales may define additional characters to be white space. With these options, `diff' considers the following two lines to be equivalent, where `$' denotes the line end and `^M' denotes a carriage return: Here lyeth muche rychnesse in lytell space.-- John Heywood$ He relyeth much erychnes seinly tells pace. --John Heywood ^M$  File: diff.info, Node: Blank Lines, Next: Case Folding, Prev: White Space, Up: Comparison Suppressing Differences in Blank Lines ====================================== The `-B' and `--ignore-blank-lines' options ignore insertions or deletions of blank lines. These options affect only lines that are completely empty; they do not affect lines that look empty but contain space or tab characters. With these options, for example, a file containing 1. A point is that which has no part. 2. A line is breadthless length. -- Euclid, The Elements, I is considered identical to a file containing 1. A point is that which has no part. 2. A line is breadthless length. -- Euclid, The Elements, I  File: diff.info, Node: Case Folding, Next: Specified Folding, Prev: Blank Lines, Up: Comparison Suppressing Case Differences ============================ GNU `diff' can treat lower case letters as equivalent to their upper case counterparts, so that, for example, it considers `Funky Stuff', `funky STUFF', and `fUNKy stuFf' to all be the same. To request this, use the `-i' or `--ignore-case' option.  File: diff.info, Node: Specified Folding, Next: Brief, Prev: Case Folding, Up: Comparison Suppressing Lines Matching a Regular Expression =============================================== To ignore insertions and deletions of lines that match a `grep'-style regular expression, use the `-I REGEXP' or `--ignore-matching-lines=REGEXP' option. You should escape regular expressions that contain shell metacharacters to prevent the shell from expanding them. For example, `diff -I '^[[:digit:]]'' ignores all changes to lines beginning with a digit. However, `-I' only ignores the insertion or deletion of lines that contain the regular expression if every changed line in the hunk--every insertion and every deletion--matches the regular expression. In other words, for each nonignorable change, `diff' prints the complete set of changes in its vicinity, including the ignorable ones. You can specify more than one regular expression for lines to ignore by using more than one `-I' option. `diff' tries to match each line against each regular expression.  File: diff.info, Node: Brief, Next: Binary, Prev: Specified Folding, Up: Comparison Summarizing Which Files Differ ============================== When you only want to find out whether files are different, and you don't care what the differences are, you can use the summary output format. In this format, instead of showing the differences between the files, `diff' simply reports whether files differ. The `-q' and `--brief' options select this output format. This format is especially useful when comparing the contents of two directories. It is also much faster than doing the normal line by line comparisons, because `diff' can stop analyzing the files as soon as it knows that there are any differences. You can also get a brief indication of whether two files differ by using `cmp'. For files that are identical, `cmp' produces no output. When the files differ, by default, `cmp' outputs the byte and line number where the first difference occurs. You can use the `-s' option to suppress that information, so that `cmp' produces no output and reports whether the files differ using only its exit status (*note Invoking cmp::). Unlike `diff', `cmp' cannot compare directories; it can only compare two files.  File: diff.info, Node: Binary, Prev: Brief, Up: Comparison Binary Files and Forcing Text Comparisons ========================================= If `diff' thinks that either of the two files it is comparing is binary (a non-text file), it normally treats that pair of files much as if the summary output format had been selected (*note Brief::), and reports only that the binary files are different. This is because line by line comparisons are usually not meaningful for binary files. `diff' determines whether a file is text or binary by checking the first few bytes in the file; the exact number of bytes is system dependent, but it is typically several thousand. If every byte in that part of the file is non-null, `diff' considers the file to be text; otherwise it considers the file to be binary. Sometimes you might want to force `diff' to consider files to be text. For example, you might be comparing text files that contain null characters; `diff' would erroneously decide that those are non-text files. Or you might be comparing documents that are in a format used by a word processing system that uses null characters to indicate special formatting. You can force `diff' to consider all files to be text files, and compare them line by line, by using the `-a' or `--text' option. If the files you compare using this option do not in fact contain text, they will probably contain few newline characters, and the `diff' output will consist of hunks showing differences between long lines of whatever characters the files contain. You can also force `diff' to consider all files to be binary files, and report only whether they differ (but not how). Use the `-q' or `--brief' option for this. Differing binary files are considered to cause trouble because the resulting `diff' output does not capture all the differences. This trouble causes `diff' to exit with status 2. However, this trouble cannot occur with the `--a' or `--text' option, or with the `-q' or `--brief' option, as these options both cause `diff' to treat binary files like text files. In operating systems that distinguish between text and binary files, `diff' normally reads and writes all data as text. Use the `--binary' option to force `diff' to read and write binary data instead. This option has no effect on a POSIX-compliant system like GNU or traditional Unix. However, many personal computer operating systems represent the end of a line with a carriage return followed by a newline. On such systems, `diff' normally ignores these carriage returns on input and generates them at the end of each output line, but with the `--binary' option `diff' treats each carriage return as just another input character, and does not generate a carriage return at the end of each output line. This can be useful when dealing with non-text files that are meant to be interchanged with POSIX-compliant systems. The `--strip-trailing-cr' causes `diff' to treat input lines that end in carriage return followed by newline as if they end in plain newline. This can be useful when comparing text that is imperfectly imported from many personal computer operating systems. This option affects how lines are read, which in turn affects how they are compared and output. If you want to compare two files byte by byte, you can use the `cmp' program with the `-l' option to show the values of each differing byte in the two files. With GNU `cmp', you can also use the `-b' option to show the ASCII representation of those bytes. *Note Invoking cmp::, for more information. If `diff3' thinks that any of the files it is comparing is binary (a non-text file), it normally reports an error, because such comparisons are usually not useful. `diff3' uses the same test as `diff' to decide whether a file is binary. As with `diff', if the input files contain a few non-text bytes but otherwise are like text files, you can force `diff3' to consider all files to be text files and compare them line by line by using the `-a' or `--text' options.  File: diff.info, Node: Output Formats, Next: Incomplete Lines, Prev: Comparison, Up: Top `diff' Output Formats ********************* `diff' has several mutually exclusive options for output format. The following sections describe each format, illustrating how `diff' reports the differences between two sample input files. * Menu: * Sample diff Input:: Sample `diff' input files for examples. * Normal:: Showing differences without surrounding text. * Context:: Showing differences with the surrounding text. * Side by Side:: Showing differences in two columns. * Scripts:: Generating scripts for other programs. * If-then-else:: Merging files with if-then-else.  File: diff.info, Node: Sample diff Input, Next: Normal, Up: Output Formats Two Sample Input Files ====================== Here are two sample files that we will use in numerous examples to illustrate the output of `diff' and how various options can change it. This is the file `lao': The Way that can be told of is not the eternal Way; The name that can be named is not the eternal name. The Nameless is the origin of Heaven and Earth; The Named is the mother of all things. Therefore let there always be non-being, so we may see their subtlety, And let there always be being, so we may see their outcome. The two are the same, But after they are produced, they have different names. This is the file `tzu': The Nameless is the origin of Heaven and Earth; The named is the mother of all things. Therefore let there always be non-being, so we may see their subtlety, And let there always be being, so we may see their outcome. The two are the same, But after they are produced, they have different names. They both may be called deep and profound. Deeper and more profound, The door of all subtleties! In this example, the first hunk contains just the first two lines of `lao', the second hunk contains the fourth line of `lao' opposing the second and third lines of `tzu', and the last hunk contains just the last three lines of `tzu'.  File: diff.info, Node: Normal, Next: Context, Prev: Sample diff Input, Up: Output Formats Showing Differences Without Context =================================== The "normal" `diff' output format shows each hunk of differences without any surrounding context. Sometimes such output is the clearest way to see how lines have changed, without the clutter of nearby unchanged lines (although you can get similar results with the context or unified formats by using 0 lines of context). However, this format is no longer widely used for sending out patches; for that purpose, the context format (*note Context Format::) and the unified format (*note Unified Format::) are superior. Normal format is the default for compatibility with older versions of `diff' and the POSIX standard. Use the `--normal' option to select this output format explicitly. * Menu: * Detailed Normal:: A detailed description of normal output format. * Example Normal:: Sample output in the normal format.  File: diff.info, Node: Detailed Normal, Next: Example Normal, Up: Normal Detailed Description of Normal Format ------------------------------------- The normal output format consists of one or more hunks of differences; each hunk shows one area where the files differ. Normal format hunks look like this: CHANGE-COMMAND < FROM-FILE-LINE < FROM-FILE-LINE... --- > TO-FILE-LINE > TO-FILE-LINE... There are three types of change commands. Each consists of a line number or comma-separated range of lines in the first file, a single character indicating the kind of change to make, and a line number or comma-separated range of lines in the second file. All line numbers are the original line numbers in each file. The types of change commands are: `LaR' Add the lines in range R of the second file after line L of the first file. For example, `8a12,15' means append lines 12-15 of file 2 after line 8 of file 1; or, if changing file 2 into file 1, delete lines 12-15 of file 2. `FcT' Replace the lines in range F of the first file with lines in range T of the second file. This is like a combined add and delete, but more compact. For example, `5,7c8,10' means change lines 5-7 of file 1 to read as lines 8-10 of file 2; or, if changing file 2 into file 1, change lines 8-10 of file 2 to read as lines 5-7 of file 1. `RdL' Delete the lines in range R from the first file; line L is where they would have appeared in the second file had they not been deleted. For example, `5,7d3' means delete lines 5-7 of file 1; or, if changing file 2 into file 1, append lines 5-7 of file 1 after line 3 of file 2.  File: diff.info, Node: Example Normal, Prev: Detailed Normal, Up: Normal An Example of Normal Format --------------------------- Here is the output of the command `diff lao tzu' (*note Sample diff Input::, for the complete contents of the two files). Notice that it shows only the lines that are different between the two files. 1,2d0 < The Way that can be told of is not the eternal Way; < The name that can be named is not the eternal name. 4c2,3 < The Named is the mother of all things. --- > The named is the mother of all things. > 11a11,13 > They both may be called deep and profound. > Deeper and more profound, > The door of all subtleties!  File: diff.info, Node: Context, Next: Side by Side, Prev: Normal, Up: Output Formats Showing Differences in Their Context ==================================== Usually, when you are looking at the differences between files, you will also want to see the parts of the files near the lines that differ, to help you understand exactly what has changed. These nearby parts of the files are called the "context". GNU `diff' provides two output formats that show context around the differing lines: "context format" and "unified format". It can optionally show in which function or section of the file the differing lines are found. If you are distributing new versions of files to other people in the form of `diff' output, you should use one of the output formats that show context so that they can apply the diffs even if they have made small changes of their own to the files. `patch' can apply the diffs in this case by searching in the files for the lines of context around the differing lines; if those lines are actually a few lines away from where the diff says they are, `patch' can adjust the line numbers accordingly and still apply the diff correctly. *Note Imperfect::, for more information on using `patch' to apply imperfect diffs. * Menu: * Context Format:: An output format that shows surrounding lines. * Unified Format:: A more compact output format that shows context. * Sections:: Showing which sections of the files differences are in. * Alternate Names:: Showing alternate file names in context headers.  File: diff.info, Node: Context Format, Next: Unified Format, Up: Context Context Format -------------- The context output format shows several lines of context around the lines that differ. It is the standard format for distributing updates to source code. To select this output format, use the `-C LINES', `--context[=LINES]', or `-c' option. The argument LINES that some of these options take is the number of lines of context to show. If you do not specify LINES, it defaults to three. For proper operation, `patch' typically needs at least two lines of context. * Menu: * Detailed Context:: A detailed description of the context output format. * Example Context:: Sample output in context format. * Less Context:: Another sample with less context.  File: diff.info, Node: Detailed Context, Next: Example Context, Up: Context Format Detailed Description of Context Format ...................................... The context output format starts with a two-line header, which looks like this: *** FROM-FILE FROM-FILE-MODIFICATION-TIME --- TO-FILE TO-FILE-MODIFICATION TIME The time stamp normally looks like `2002-02-21 23:30:39.942229878 -0800' to indicate the date, time with fractional seconds, and time zone in Internet RFC 2822 format (ftp://ftp.isi.edu/in-notes/rfc2822.txt). However, a traditional time stamp like `Thu Feb 21 23:30:39 2002' is used if the `LC_TIME' locale category is either `C' or `POSIX'. You can change the header's content with the `--label=LABEL' option; see *Note Alternate Names::. Next come one or more hunks of differences; each hunk shows one area where the files differ. Context format hunks look like this: *************** *** FROM-FILE-LINE-RANGE **** FROM-FILE-LINE FROM-FILE-LINE... --- TO-FILE-LINE-RANGE ---- TO-FILE-LINE TO-FILE-LINE... The lines of context around the lines that differ start with two space characters. The lines that differ between the two files start with one of the following indicator characters, followed by a space character: `!' A line that is part of a group of one or more lines that changed between the two files. There is a corresponding group of lines marked with `!' in the part of this hunk for the other file. `+' An "inserted" line in the second file that corresponds to nothing in the first file. `-' A "deleted" line in the first file that corresponds to nothing in the second file. If all of the changes in a hunk are insertions, the lines of FROM-FILE are omitted. If all of the changes are deletions, the lines of TO-FILE are omitted.  File: diff.info, Node: Example Context, Next: Less Context, Prev: Detailed Context, Up: Context Format An Example of Context Format ............................ Here is the output of `diff -c lao tzu' (*note Sample diff Input::, for the complete contents of the two files). Notice that up to three lines that are not different are shown around each line that is different; they are the context lines. Also notice that the first two hunks have run together, because their contents overlap. *** lao 2002-02-21 23:30:39.942229878 -0800 --- tzu 2002-02-21 23:30:50.442260588 -0800 *************** *** 1,7 **** - The Way that can be told of is not the eternal Way; - The name that can be named is not the eternal name. The Nameless is the origin of Heaven and Earth; ! The Named is the mother of all things. Therefore let there always be non-being, so we may see their subtlety, And let there always be being, --- 1,6 ---- The Nameless is the origin of Heaven and Earth; ! The named is the mother of all things. ! Therefore let there always be non-being, so we may see their subtlety, And let there always be being, *************** *** 9,11 **** --- 8,13 ---- The two are the same, But after they are produced, they have different names. + They both may be called deep and profound. + Deeper and more profound, + The door of all subtleties!  File: diff.info, Node: Less Context, Prev: Example Context, Up: Context Format An Example of Context Format with Less Context .............................................. Here is the output of `diff -C 1 lao tzu' (*note Sample diff Input::, for the complete contents of the two files). Notice that at most one context line is reported here. *** lao 2002-02-21 23:30:39.942229878 -0800 --- tzu 2002-02-21 23:30:50.442260588 -0800 *************** *** 1,5 **** - The Way that can be told of is not the eternal Way; - The name that can be named is not the eternal name. The Nameless is the origin of Heaven and Earth; ! The Named is the mother of all things. Therefore let there always be non-being, --- 1,4 ---- The Nameless is the origin of Heaven and Earth; ! The named is the mother of all things. ! Therefore let there always be non-being, *************** *** 11 **** --- 10,13 ---- they have different names. + They both may be called deep and profound. + Deeper and more profound, + The door of all subtleties!  File: diff.info, Node: Unified Format, Next: Sections, Prev: Context Format, Up: Context Unified Format -------------- The unified output format is a variation on the context format that is more compact because it omits redundant context lines. To select this output format, use the `-U LINES', `--unified[=LINES]', or `-u' option. The argument LINES is the number of lines of context to show. When it is not given, it defaults to three. At present, only GNU `diff' can produce this format and only GNU `patch' can automatically apply diffs in this format. For proper operation, `patch' typically needs at least three lines of context. * Menu: * Detailed Unified:: A detailed description of unified format. * Example Unified:: Sample output in unified format.  File: diff.info, Node: Detailed Unified, Next: Example Unified, Up: Unified Format Detailed Description of Unified Format ...................................... The unified output format starts with a two-line header, which looks like this: --- FROM-FILE FROM-FILE-MODIFICATION-TIME +++ TO-FILE TO-FILE-MODIFICATION-TIME The time stamp looks like `2002-02-21 23:30:39.942229878 -0800' to indicate the date, time with fractional seconds, and time zone. You can change the header's content with the `--label=LABEL' option; see *Note Alternate Names::. Next come one or more hunks of differences; each hunk shows one area where the files differ. Unified format hunks look like this: @@ FROM-FILE-RANGE TO-FILE-RANGE @@ LINE-FROM-EITHER-FILE LINE-FROM-EITHER-FILE... The lines common to both files begin with a space character. The lines that actually differ between the two files have one of the following indicator characters in the left print column: `+' A line was added here to the first file. `-' A line was removed here from the first file.  File: diff.info, Node: Example Unified, Prev: Detailed Unified, Up: Unified Format An Example of Unified Format ............................ Here is the output of the command `diff -u lao tzu' (*note Sample diff Input::, for the complete contents of the two files): --- lao 2002-02-21 23:30:39.942229878 -0800 +++ tzu 2002-02-21 23:30:50.442260588 -0800 @@ -1,7 +1,6 @@ -The Way that can be told of is not the eternal Way; -The name that can be named is not the eternal name. The Nameless is the origin of Heaven and Earth; -The Named is the mother of all things. +The named is the mother of all things. + Therefore let there always be non-being, so we may see their subtlety, And let there always be being, @@ -9,3 +8,6 @@ The two are the same, But after they are produced, they have different names. +They both may be called deep and profound. +Deeper and more profound, +The door of all subtleties!  File: diff.info, Node: Sections, Next: Alternate Names, Prev: Unified Format, Up: Context Showing Which Sections Differences Are in ----------------------------------------- Sometimes you might want to know which part of the files each change falls in. If the files are source code, this could mean which function was changed. If the files are documents, it could mean which chapter or appendix was changed. GNU `diff' can show this by displaying the nearest section heading line that precedes the differing lines. Which lines are "section headings" is determined by a regular expression. * Menu: * Specified Headings:: Showing headings that match regular expressions. * C Function Headings:: Showing headings of C functions.  File: diff.info, Node: Specified Headings, Next: C Function Headings, Up: Sections Showing Lines That Match Regular Expressions ............................................ To show in which sections differences occur for files that are not source code for C or similar languages, use the `-F REGEXP' or `--show-function-line=REGEXP' option. `diff' considers lines that match the `grep'-style regular expression REGEXP to be the beginning of a section of the file. Here are suggested regular expressions for some common languages: `^[[:alpha:]$_]' C, C++, Prolog `^(' Lisp `^@node' Texinfo This option does not automatically select an output format; in order to use it, you must select the context format (*note Context Format::) or unified format (*note Unified Format::). In other output formats it has no effect. The `-F' and `--show-function-line' options find the nearest unchanged line that precedes each hunk of differences and matches the given regular expression. Then they add that line to the end of the line of asterisks in the context format, or to the `@@' line in unified format. If no matching line exists, they leave the output for that hunk unchanged. If that line is more than 40 characters long, they output only the first 40 characters. You can specify more than one regular expression for such lines; `diff' tries to match each line against each regular expression, starting with the last one given. This means that you can use `-p' and `-F' together, if you wish.  File: diff.info, Node: C Function Headings, Prev: Specified Headings, Up: Sections Showing C Function Headings ........................... To show in which functions differences occur for C and similar languages, you can use the `-p' or `--show-c-function' option. This option automatically defaults to the context output format (*note Context Format::), with the default number of lines of context. You can override that number with `-C LINES' elsewhere in the command line. You can override both the format and the number with `-U LINES' elsewhere in the command line. The `-p' and `--show-c-function' options are equivalent to `-F '^[[:alpha:]$_]'' if the unified format is specified, otherwise `-c -F '^[[:alpha:]$_]'' (*note Specified Headings::). GNU `diff' provides them for the sake of convenience.  File: diff.info, Node: Alternate Names, Prev: Sections, Up: Context Showing Alternate File Names ---------------------------- If you are comparing two files that have meaningless or uninformative names, you might want `diff' to show alternate names in the header of the context and unified output formats. To do this, use the `--label=LABEL' option. The first time you give this option, its argument replaces the name and date of the first file in the header; the second time, its argument replaces the name and date of the second file. If you give this option more than twice, `diff' reports an error. The `--label' option does not affect the file names in the `pr' header when the `-l' or `--paginate' option is used (*note Pagination::). Here are the first two lines of the output from `diff -C 2 --label=original --label=modified lao tzu': *** original --- modified  File: diff.info, Node: Side by Side, Next: Scripts, Prev: Context, Up: Output Formats Showing Differences Side by Side ================================ `diff' can produce a side by side difference listing of two files. The files are listed in two columns with a gutter between them. The gutter contains one of the following markers: white space The corresponding lines are in common. That is, either the lines are identical, or the difference is ignored because of one of the `--ignore' options (*note White Space::). `|' The corresponding lines differ, and they are either both complete or both incomplete. `<' The files differ and only the first file contains the line. `>' The files differ and only the second file contains the line. `(' Only the first file contains the line, but the difference is ignored. `)' Only the second file contains the line, but the difference is ignored. `\' The corresponding lines differ, and only the first line is incomplete. `/' The corresponding lines differ, and only the second line is incomplete. Normally, an output line is incomplete if and only if the lines that it contains are incomplete; *Note Incomplete Lines::. However, when an output line represents two differing lines, one might be incomplete while the other is not. In this case, the output line is complete, but its the gutter is marked `\' if the first line is incomplete, `/' if the second line is. Side by side format is sometimes easiest to read, but it has limitations. It generates much wider output than usual, and truncates lines that are too long to fit. Also, it relies on lining up output more heavily than usual, so its output looks particularly bad if you use varying width fonts, nonstandard tab stops, or nonprinting characters. You can use the `sdiff' command to interactively merge side by side differences. *Note Interactive Merging::, for more information on merging files. * Menu: * Side by Side Format:: Controlling side by side output format. * Example Side by Side:: Sample side by side output.  File: diff.info, Node: Side by Side Format, Next: Example Side by Side, Up: Side by Side Controlling Side by Side Format ------------------------------- The `-y' or `--side-by-side' option selects side by side format. Because side by side output lines contain two input lines, the output is wider than usual: normally 130 print columns, which can fit onto a traditional printer line. You can set the width of the output with the `-W COLUMNS' or `--width=COLUMNS' option. The output is split into two halves of equal width, separated by a small gutter to mark differences; the right half is aligned to a tab stop so that tabs line up. Input lines that are too long to fit in half of an output line are truncated for output. The `--left-column' option prints only the left column of two common lines. The `--suppress-common-lines' option suppresses common lines entirely.  File: diff.info, Node: Example Side by Side, Prev: Side by Side Format, Up: Side by Side An Example of Side by Side Format --------------------------------- Here is the output of the command `diff -y -W 72 lao tzu' (*note Sample diff Input::, for the complete contents of the two files). The Way that can be told of is n < The name that can be named is no < The Nameless is the origin of He The Nameless is the origin of He The Named is the mother of all t | The named is the mother of all t > Therefore let there always be no Therefore let there always be no so we may see their subtlety, so we may see their subtlety, And let there always be being, And let there always be being, so we may see their outcome. so we may see their outcome. The two are the same, The two are the same, But after they are produced, But after they are produced, they have different names. they have different names. > They both may be called deep and > Deeper and more profound, > The door of all subtleties!  File: diff.info, Node: Scripts, Next: If-then-else, Prev: Side by Side, Up: Output Formats Making Edit Scripts =================== Several output modes produce command scripts for editing FROM-FILE to produce TO-FILE. * Menu: * ed Scripts:: Using `diff' to produce commands for `ed'. * Forward ed:: Making forward `ed' scripts. * RCS:: A special `diff' output format used by RCS.  File: diff.info, Node: ed Scripts, Next: Forward ed, Up: Scripts `ed' Scripts ------------ `diff' can produce commands that direct the `ed' text editor to change the first file into the second file. Long ago, this was the only output mode that was suitable for editing one file into another automatically; today, with `patch', it is almost obsolete. Use the `-e' or `--ed' option to select this output format. Like the normal format (*note Normal::), this output format does not show any context; unlike the normal format, it does not include the information necessary to apply the diff in reverse (to produce the first file if all you have is the second file and the diff). If the file `d' contains the output of `diff -e old new', then the command `(cat d && echo w) | ed - old' edits `old' to make it a copy of `new'. More generally, if `d1', `d2', ..., `dN' contain the outputs of `diff -e old new1', `diff -e new1 new2', ..., `diff -e newN-1 newN', respectively, then the command `(cat d1 d2 ... dN && echo w) | ed - old' edits `old' to make it a copy of `newN'. * Menu: * Detailed ed:: A detailed description of `ed' format. * Example ed:: A sample `ed' script.  File: diff.info, Node: Detailed ed, Next: Example ed, Up: ed Scripts Detailed Description of `ed' Format ................................... The `ed' output format consists of one or more hunks of differences. The changes closest to the ends of the files come first so that commands that change the number of lines do not affect how `ed' interprets line numbers in succeeding commands. `ed' format hunks look like this: CHANGE-COMMAND TO-FILE-LINE TO-FILE-LINE... . Because `ed' uses a single period on a line to indicate the end of input, GNU `diff' protects lines of changes that contain a single period on a line by writing two periods instead, then writing a subsequent `ed' command to change the two periods into one. The `ed' format cannot represent an incomplete line, so if the second file ends in a changed incomplete line, `diff' reports an error and then pretends that a newline was appended. There are three types of change commands. Each consists of a line number or comma-separated range of lines in the first file and a single character indicating the kind of change to make. All line numbers are the original line numbers in the file. The types of change commands are: `La' Add text from the second file after line L in the first file. For example, `8a' means to add the following lines after line 8 of file 1. `Rc' Replace the lines in range R in the first file with the following lines. Like a combined add and delete, but more compact. For example, `5,7c' means change lines 5-7 of file 1 to read as the text file 2. `Rd' Delete the lines in range R from the first file. For example, `5,7d' means delete lines 5-7 of file 1.  File: diff.info, Node: Example ed, Prev: Detailed ed, Up: ed Scripts Example `ed' Script ................... Here is the output of `diff -e lao tzu' (*note Sample diff Input::, for the complete contents of the two files): 11a They both may be called deep and profound. Deeper and more profound, The door of all subtleties! . 4c The named is the mother of all things. . 1,2d  File: diff.info, Node: Forward ed, Next: RCS, Prev: ed Scripts, Up: Scripts Forward `ed' Scripts -------------------- `diff' can produce output that is like an `ed' script, but with hunks in forward (front to back) order. The format of the commands is also changed slightly: command characters precede the lines they modify, spaces separate line numbers in ranges, and no attempt is made to disambiguate hunk lines consisting of a single period. Like `ed' format, forward `ed' format cannot represent incomplete lines. Forward `ed' format is not very useful, because neither `ed' nor `patch' can apply diffs in this format. It exists mainly for compatibility with older versions of `diff'. Use the `-f' or `--forward-ed' option to select it.  File: diff.info, Node: RCS, Prev: Forward ed, Up: Scripts RCS Scripts ----------- The RCS output format is designed specifically for use by the Revision Control System, which is a set of free programs used for organizing different versions and systems of files. Use the `-n' or `--rcs' option to select this output format. It is like the forward `ed' format (*note Forward ed::), but it can represent arbitrary changes to the contents of a file because it avoids the forward `ed' format's problems with lines consisting of a single period and with incomplete lines. Instead of ending text sections with a line consisting of a single period, each command specifies the number of lines it affects; a combination of the `a' and `d' commands are used instead of `c'. Also, if the second file ends in a changed incomplete line, then the output also ends in an incomplete line. Here is the output of `diff -n lao tzu' (*note Sample diff Input::, for the complete contents of the two files): d1 2 d4 1 a4 2 The named is the mother of all things. a11 3 They both may be called deep and profound. Deeper and more profound, The door of all subtleties!  File: diff.info, Node: If-then-else, Prev: Scripts, Up: Output Formats Merging Files with If-then-else =============================== You can use `diff' to merge two files of C source code. The output of `diff' in this format contains all the lines of both files. Lines common to both files are output just once; the differing parts are separated by the C preprocessor directives `#ifdef NAME' or `#ifndef NAME', `#else', and `#endif'. When compiling the output, you select which version to use by either defining or leaving undefined the macro NAME. To merge two files, use `diff' with the `-D NAME' or `--ifdef=NAME' option. The argument NAME is the C preprocessor identifier to use in the `#ifdef' and `#ifndef' directives. For example, if you change an instance of `wait (&s)' to `waitpid (-1, &s, 0)' and then merge the old and new files with the `--ifdef=HAVE_WAITPID' option, then the affected part of your code might look like this: do { #ifndef HAVE_WAITPID if ((w = wait (&s)) < 0 && errno != EINTR) #else /* HAVE_WAITPID */ if ((w = waitpid (-1, &s, 0)) < 0 && errno != EINTR) #endif /* HAVE_WAITPID */ return w; } while (w != child); You can specify formats for languages other than C by using line group formats and line formats, as described in the next sections. * Menu: * Line Group Formats:: Formats for general if-then-else line groups. * Line Formats:: Formats for each line in a line group. * Detailed If-then-else:: A detailed description of if-then-else format. * Example If-then-else:: Sample if-then-else format output.  File: diff.info, Node: Line Group Formats, Next: Line Formats, Up: If-then-else Line Group Formats ------------------ Line group formats let you specify formats suitable for many applications that allow if-then-else input, including programming languages and text formatting languages. A line group format specifies the output format for a contiguous group of similar lines. For example, the following command compares the TeX files `old' and `new', and outputs a merged file in which old regions are surrounded by `\begin{em}'-`\end{em}' lines, and new regions are surrounded by `\begin{bf}'-`\end{bf}' lines. diff \ --old-group-format='\begin{em} %<\end{em} ' \ --new-group-format='\begin{bf} %>\end{bf} ' \ old new The following command is equivalent to the above example, but it is a little more verbose, because it spells out the default line group formats. diff \ --old-group-format='\begin{em} %<\end{em} ' \ --new-group-format='\begin{bf} %>\end{bf} ' \ --unchanged-group-format='%=' \ --changed-group-format='\begin{em} %<\end{em} \begin{bf} %>\end{bf} ' \ old new Here is a more advanced example, which outputs a diff listing with headers containing line numbers in a "plain English" style. diff \ --unchanged-group-format='' \ --old-group-format='-------- %dn line%(n=1?:s) deleted at %df: %<' \ --new-group-format='-------- %dN line%(N=1?:s) added after %de: %>' \ --changed-group-format='-------- %dn line%(n=1?:s) changed at %df: %<-------- to: %>' \ old new To specify a line group format, use `diff' with one of the options listed below. You can specify up to four line group formats, one for each kind of line group. You should quote FORMAT, because it typically contains shell metacharacters. `--old-group-format=FORMAT' These line groups are hunks containing only lines from the first file. The default old group format is the same as the changed group format if it is specified; otherwise it is a format that outputs the line group as-is. `--new-group-format=FORMAT' These line groups are hunks containing only lines from the second file. The default new group format is same as the changed group format if it is specified; otherwise it is a format that outputs the line group as-is. `--changed-group-format=FORMAT' These line groups are hunks containing lines from both files. The default changed group format is the concatenation of the old and new group formats. `--unchanged-group-format=FORMAT' These line groups contain lines common to both files. The default unchanged group format is a format that outputs the line group as-is. In a line group format, ordinary characters represent themselves; conversion specifications start with `%' and have one of the following forms. `%<' stands for the lines from the first file, including the trailing newline. Each line is formatted according to the old line format (*note Line Formats::). `%>' stands for the lines from the second file, including the trailing newline. Each line is formatted according to the new line format. `%=' stands for the lines common to both files, including the trailing newline. Each line is formatted according to the unchanged line format. `%%' stands for `%'. `%c'C'' where C is a single character, stands for C. C may not be a backslash or an apostrophe. For example, `%c':'' stands for a colon, even inside the then-part of an if-then-else format, which a colon would normally terminate. `%c'\O'' where O is a string of 1, 2, or 3 octal digits, stands for the character with octal code O. For example, `%c'\0'' stands for a null character. `FN' where F is a `printf' conversion specification and N is one of the following letters, stands for N's value formatted with F. `e' The line number of the line just before the group in the old file. `f' The line number of the first line in the group in the old file; equals E + 1. `l' The line number of the last line in the group in the old file. `m' The line number of the line just after the group in the old file; equals L + 1. `n' The number of lines in the group in the old file; equals L - F + 1. `E, F, L, M, N' Likewise, for lines in the new file. The `printf' conversion specification can be `%d', `%o', `%x', or `%X', specifying decimal, octal, lower case hexadecimal, or upper case hexadecimal output respectively. After the `%' the following options can appear in sequence: a series of zero or more flags; an integer specifying the minimum field width; and a period followed by an optional integer specifying the minimum number of digits. The flags are `-' for left-justification, `'' for separating the digit into groups as specified by the `LC_NUMERIC' locale category, and `0' for padding with zeros instead of spaces. For example, `%5dN' prints the number of new lines in the group in a field of width 5 characters, using the `printf' format `"%5d"'. `(A=B?T:E)' If A equals B then T else E. A and B are each either a decimal constant or a single letter interpreted as above. This format spec is equivalent to T if A's value equals B's; otherwise it is equivalent to E. For example, `%(N=0?no:%dN) line%(N=1?:s)' is equivalent to `no lines' if N (the number of lines in the group in the the new file) is 0, to `1 line' if N is 1, and to `%dN lines' otherwise.  File: diff.info, Node: Line Formats, Next: Detailed If-then-else, Prev: Line Group Formats, Up: If-then-else Line Formats ------------ Line formats control how each line taken from an input file is output as part of a line group in if-then-else format. For example, the following command outputs text with a one-character change indicator to the left of the text. The first character of output is `-' for deleted lines, `|' for added lines, and a space for unchanged lines. The formats contain newline characters where newlines are desired on output. diff \ --old-line-format='-%l ' \ --new-line-format='|%l ' \ --unchanged-line-format=' %l ' \ old new To specify a line format, use one of the following options. You should quote FORMAT, since it often contains shell metacharacters. `--old-line-format=FORMAT' formats lines just from the first file. `--new-line-format=FORMAT' formats lines just from the second file. `--unchanged-line-format=FORMAT' formats lines common to both files. `--line-format=FORMAT' formats all lines; in effect, it sets all three above options simultaneously. In a line format, ordinary characters represent themselves; conversion specifications start with `%' and have one of the following forms. `%l' stands for the contents of the line, not counting its trailing newline (if any). This format ignores whether the line is incomplete; *Note Incomplete Lines::. `%L' stands for the contents of the line, including its trailing newline (if any). If a line is incomplete, this format preserves its incompleteness. `%%' stands for `%'. `%c'C'' where C is a single character, stands for C. C may not be a backslash or an apostrophe. For example, `%c':'' stands for a colon. `%c'\O'' where O is a string of 1, 2, or 3 octal digits, stands for the character with octal code O. For example, `%c'\0'' stands for a null character. `Fn' where F is a `printf' conversion specification, stands for the line number formatted with F. For example, `%.5dn' prints the line number using the `printf' format `"%.5d"'. *Note Line Group Formats::, for more about printf conversion specifications. The default line format is `%l' followed by a newline character. If the input contains tab characters and it is important that they line up on output, you should ensure that `%l' or `%L' in a line format is just after a tab stop (e.g. by preceding `%l' or `%L' with a tab character), or you should use the `-t' or `--expand-tabs' option. Taken together, the line and line group formats let you specify many different formats. For example, the following command uses a format similar to normal `diff' format. You can tailor this command to get fine control over `diff' output. diff \ --old-line-format='< %l ' \ --new-line-format='> %l ' \ --old-group-format='%df%(f=l?:,%dl)d%dE %<' \ --new-group-format='%dea%dF%(F=L?:,%dL) %>' \ --changed-group-format='%df%(f=l?:,%dl)c%dF%(F=L?:,%dL) %<--- %>' \ --unchanged-group-format='' \ old new  File: diff.info, Node: Detailed If-then-else, Next: Example If-then-else, Prev: Line Formats, Up: If-then-else Detailed Description of If-then-else Format ------------------------------------------- For lines common to both files, `diff' uses the unchanged line group format. For each hunk of differences in the merged output format, if the hunk contains only lines from the first file, `diff' uses the old line group format; if the hunk contains only lines from the second file, `diff' uses the new group format; otherwise, `diff' uses the changed group format. The old, new, and unchanged line formats specify the output format of lines from the first file, lines from the second file, and lines common to both files, respectively. The option `--ifdef=NAME' is equivalent to the following sequence of options using shell syntax: --old-group-format='#ifndef NAME %<#endif /* ! NAME */ ' \ --new-group-format='#ifdef NAME %>#endif /* NAME */ ' \ --unchanged-group-format='%=' \ --changed-group-format='#ifndef NAME %<#else /* NAME */ %>#endif /* NAME */ ' You should carefully check the `diff' output for proper nesting. For example, when using the `-D NAME' or `--ifdef=NAME' option, you should check that if the differing lines contain any of the C preprocessor directives `#ifdef', `#ifndef', `#else', `#elif', or `#endif', they are nested properly and match. If they don't, you must make corrections manually. It is a good idea to carefully check the resulting code anyway to make sure that it really does what you want it to; depending on how the input files were produced, the output might contain duplicate or otherwise incorrect code. The `patch' `-D NAME' option behaves like the `diff' `-D NAME' option, except it operates on a file and a diff to produce a merged file; *Note patch Options::.  File: diff.info, Node: Example If-then-else, Prev: Detailed If-then-else, Up: If-then-else An Example of If-then-else Format --------------------------------- Here is the output of `diff -DTWO lao tzu' (*note Sample diff Input::, for the complete contents of the two files): #ifndef TWO The Way that can be told of is not the eternal Way; The name that can be named is not the eternal name. #endif /* ! TWO */ The Nameless is the origin of Heaven and Earth; #ifndef TWO The Named is the mother of all things. #else /* TWO */ The named is the mother of all things. #endif /* TWO */ Therefore let there always be non-being, so we may see their subtlety, And let there always be being, so we may see their outcome. The two are the same, But after they are produced, they have different names. #ifdef TWO They both may be called deep and profound. Deeper and more profound, The door of all subtleties! #endif /* TWO */  File: diff.info, Node: Incomplete Lines, Next: Comparing Directories, Prev: Output Formats, Up: Top Incomplete Lines **************** When an input file ends in a non-newline character, its last line is called an "incomplete line" because its last character is not a newline. All other lines are called "full lines" and end in a newline character. Incomplete lines do not match full lines unless differences in white space are ignored (*note White Space::). An incomplete line is normally distinguished on output from a full line by a following line that starts with `\'. However, the RCS format (*note RCS::) outputs the incomplete line as-is, without any trailing newline or following line. The side by side format normally represents incomplete lines as-is, but in some cases uses a `\' or `/' gutter marker; *Note Side by Side::. The if-then-else line format preserves a line's incompleteness with `%L', and discards the newline with `%l'; *Note Line Formats::. Finally, with the `ed' and forward `ed' output formats (*note Output Formats::) `diff' cannot represent an incomplete line, so it pretends there was a newline and reports an error. For example, suppose `F' and `G' are one-byte files that contain just `f' and `g', respectively. Then `diff F G' outputs 1c1 < f \ No newline at end of file --- > g \ No newline at end of file (The exact message may differ in non-English locales.) `diff -n F G' outputs the following without a trailing newline: d1 1 a1 1 g `diff -e F G' reports two errors and outputs the following: 1c g .  File: diff.info, Node: Comparing Directories, Next: Adjusting Output, Prev: Incomplete Lines, Up: Top Comparing Directories ********************* You can use `diff' to compare some or all of the files in two directory trees. When both file name arguments to `diff' are directories, it compares each file that is contained in both directories, examining file names in alphabetical order as specified by the `LC_COLLATE' locale category. Normally `diff' is silent about pairs of files that contain no differences, but if you use the `-s' or `--report-identical-files' option, it reports pairs of identical files. Normally `diff' reports subdirectories common to both directories without comparing subdirectories' files, but if you use the `-r' or `--recursive' option, it compares every corresponding pair of files in the directory trees, as many levels deep as they go. For file names that are in only one of the directories, `diff' normally does not show the contents of the file that exists; it reports only that the file exists in that directory and not in the other. You can make `diff' act as though the file existed but was empty in the other directory, so that it outputs the entire contents of the file that actually exists. (It is output as either an insertion or a deletion, depending on whether it is in the first or the second directory given.) To do this, use the `-N' or `--new-file' option. If the older directory contains one or more large files that are not in the newer directory, you can make the patch smaller by using the `--unidirectional-new-file' option instead of `-N'. This option is like `-N' except that it only inserts the contents of files that appear in the second directory but not the first (that is, files that were added). At the top of the patch, write instructions for the user applying the patch to remove the files that were deleted before applying the patch. *Note Making Patches::, for more discussion of making patches for distribution. To ignore some files while comparing directories, use the `-x PATTERN' or `--exclude=PATTERN' option. This option ignores any files or subdirectories whose base names match the shell pattern PATTERN. Unlike in the shell, a period at the start of the base of a file name matches a wildcard at the start of a pattern. You should enclose PATTERN in quotes so that the shell does not expand it. For example, the option `-x '*.[ao]'' ignores any file whose name ends with `.a' or `.o'. This option accumulates if you specify it more than once. For example, using the options `-x 'RCS' -x '*,v'' ignores any file or subdirectory whose base name is `RCS' or ends with `,v'. If you need to give this option many times, you can instead put the patterns in a file, one pattern per line, and use the `-X FILE' or `--exclude-from=FILE' option. If you have been comparing two directories and stopped partway through, later you might want to continue where you left off. You can do this by using the `-S FILE' or `--starting-file=FILE' option. This compares only the file FILE and all alphabetically later files in the topmost directory level. If two directories differ only in that file names are lower case in one directory and upper case in the upper, `diff' normally reports many differences because it compares file names in a case sensitive way. With the `--ignore-file-name-case' option, `diff' ignores case differences in file names, so that for example the contents of the file `Tao' in one directory are compared to the contents of the file `TAO' in the other. The `--no-ignore-file-name-case' option cancels the effect of the `--ignore-file-name-case' option, reverting to the default behavior. If an `-x PATTERN', `--exclude=PATTERN', `-X FILE', or `--exclude-from=FILE' option is specified while the `--ignore-file-name-case' option is in effect, case is ignored when excluding file names matching the specified patterns.  File: diff.info, Node: Adjusting Output, Next: diff Performance, Prev: Comparing Directories, Up: Top Making `diff' Output Prettier ***************************** `diff' provides several ways to adjust the appearance of its output. These adjustments can be applied to any output format. * Menu: * Tabs:: Preserving the alignment of tab stops. * Pagination:: Page numbering and time-stamping `diff' output.  File: diff.info, Node: Tabs, Next: Pagination, Up: Adjusting Output Preserving Tab Stop Alignment ============================= The lines of text in some of the `diff' output formats are preceded by one or two characters that indicate whether the text is inserted, deleted, or changed. The addition of those characters can cause tabs to move to the next tab stop, throwing off the alignment of columns in the line. GNU `diff' provides two ways to make tab-aligned columns line up correctly. The first way is to have `diff' convert all tabs into the correct number of spaces before outputting them; select this method with the `-t' or `--expand-tabs' option. `diff' assumes that tab stops are set every 8 print columns. To use this form of output with `patch', you must give `patch' the `-l' or `--ignore-white-space' option (*note Changed White Space::, for more information). The other method for making tabs line up correctly is to add a tab character instead of a space after the indicator character at the beginning of the line. This ensures that all following tab characters are in the same position relative to tab stops that they were in the original files, so that the output is aligned correctly. Its disadvantage is that it can make long lines too long to fit on one line of the screen or the paper. It also does not work with the unified output format, which does not have a space character after the change type indicator character. Select this method with the `-T' or `--initial-tab' option.  File: diff.info, Node: Pagination, Prev: Tabs, Up: Adjusting Output Paginating `diff' Output ======================== It can be convenient to have long output page-numbered and time-stamped. The `-l' and `--paginate' options do this by sending the `diff' output through the `pr' program. Here is what the page header might look like for `diff -lc lao tzu': 2002-02-22 14:20 diff -lc lao tzu Page 1  File: diff.info, Node: diff Performance, Next: Comparing Three Files, Prev: Adjusting Output, Up: Top `diff' Performance Tradeoffs **************************** GNU `diff' runs quite efficiently; however, in some circumstances you can cause it to run faster or produce a more compact set of changes. One way to improve `diff' performance is to use hard or symbolic links to files instead of copies. This improves performance because `diff' normally does not need to read two hard or symbolic links to the same file, since their contents must be identical. For example, suppose you copy a large directory hierarchy, make a few changes to the copy, and then often use `diff -r' to compare the original to the copy. If the original files are read-only, you can greatly improve performance by creating the copy using hard or symbolic links (e.g., with GNU `cp -lR' or `cp -sR'). Before editing a file in the copy for the first time, you should break the link and replace it with a regular copy. You can also affect the performance of GNU `diff' by giving it options that change the way it compares files. Performance has more than one dimension. These options improve one aspect of performance at the cost of another, or they improve performance in some cases while hurting it in others. The way that GNU `diff' determines which lines have changed always comes up with a near-minimal set of differences. Usually it is good enough for practical purposes. If the `diff' output is large, you might want `diff' to use a modified algorithm that sometimes produces a smaller set of differences. The `-d' or `--minimal' option does this; however, it can also cause `diff' to run more slowly than usual, so it is not the default behavior. When the files you are comparing are large and have small groups of changes scattered throughout them, you can use the `--speed-large-files' option to make a different modification to the algorithm that `diff' uses. If the input files have a constant small density of changes, this option speeds up the comparisons without changing the output. If not, `diff' might produce a larger set of differences; however, the output will still be correct. Normally `diff' discards the prefix and suffix that is common to both files before it attempts to find a minimal set of differences. This makes `diff' run faster, but occasionally it may produce non-minimal output. The `--horizon-lines=LINES' option prevents `diff' from discarding the last LINES lines of the prefix and the first LINES lines of the suffix. This gives `diff' further opportunities to find a minimal output. Suppose a run of changed lines includes a sequence of lines at one end and there is an identical sequence of lines just outside the other end. The `diff' command is free to choose which identical sequence is included in the hunk. In this case, `diff' normally shifts the hunk's boundaries when this merges adjacent hunks, or shifts a hunk's lines towards the end of the file. Merging hunks can make the output look nicer in some cases.  File: diff.info, Node: Comparing Three Files, Next: diff3 Merging, Prev: diff Performance, Up: Top Comparing Three Files ********************* Use the program `diff3' to compare three files and show any differences among them. (`diff3' can also merge files; see *Note diff3 Merging::). The "normal" `diff3' output format shows each hunk of differences without surrounding context. Hunks are labeled depending on whether they are two-way or three-way, and lines are annotated by their location in the input files. *Note Invoking diff3::, for more information on how to run `diff3'. * Menu: * Sample diff3 Input:: Sample `diff3' input for examples. * Detailed diff3 Normal:: A detailed description of normal output format. * diff3 Hunks:: The format of normal output format. * Example diff3 Normal:: Sample output in the normal format.  File: diff.info, Node: Sample diff3 Input, Next: Detailed diff3 Normal, Up: Comparing Three Files A Third Sample Input File ========================= Here is a third sample file that will be used in examples to illustrate the output of `diff3' and how various options can change it. The first two files are the same that we used for `diff' (*note Sample diff Input::). This is the third sample file, called `tao': The Way that can be told of is not the eternal Way; The name that can be named is not the eternal name. The Nameless is the origin of Heaven and Earth; The named is the mother of all things. Therefore let there always be non-being, so we may see their subtlety, And let there always be being, so we may see their result. The two are the same, But after they are produced, they have different names. -- The Way of Lao-Tzu, tr. Wing-tsit Chan  File: diff.info, Node: Detailed diff3 Normal, Next: diff3 Hunks, Prev: Sample diff3 Input, Up: Comparing Three Files Detailed Description of `diff3' Normal Format ============================================= Each hunk begins with a line marked `===='. Three-way hunks have plain `====' lines, and two-way hunks have `1', `2', or `3' appended to specify which of the three input files differ in that hunk. The hunks contain copies of two or three sets of input lines each preceded by one or two commands identifying where the lines came from. Normally, two spaces precede each copy of an input line to distinguish it from the commands. But with the `-T' or `--initial-tab' option, `diff3' uses a tab instead of two spaces; this lines up tabs correctly. *Note Tabs::, for more information. Commands take the following forms: `FILE:La' This hunk appears after line L of file FILE, and contains no lines in that file. To edit this file to yield the other files, one must append hunk lines taken from the other files. For example, `1:11a' means that the hunk follows line 11 in the first file and contains no lines from that file. `FILE:Rc' This hunk contains the lines in the range R of file FILE. The range R is a comma-separated pair of line numbers, or just one number if the range is a singleton. To edit this file to yield the other files, one must change the specified lines to be the lines taken from the other files. For example, `2:11,13c' means that the hunk contains lines 11 through 13 from the second file. If the last line in a set of input lines is incomplete (*note Incomplete Lines::), it is distinguished on output from a full line by a following line that starts with `\'.  File: diff.info, Node: diff3 Hunks, Next: Example diff3 Normal, Prev: Detailed diff3 Normal, Up: Comparing Three Files `diff3' Hunks ============= Groups of lines that differ in two or three of the input files are called "diff3 hunks", by analogy with `diff' hunks (*note Hunks::). If all three input files differ in a `diff3' hunk, the hunk is called a "three-way hunk"; if just two input files differ, it is a "two-way hunk". As with `diff', several solutions are possible. When comparing the files `A', `B', and `C', `diff3' normally finds `diff3' hunks by merging the two-way hunks output by the two commands `diff A B' and `diff A C'. This does not necessarily minimize the size of the output, but exceptions should be rare. For example, suppose `F' contains the three lines `a', `b', `f', `G' contains the lines `g', `b', `g', and `H' contains the lines `a', `b', `h'. `diff3 F G H' might output the following: ====2 1:1c 3:1c a 2:1c g ==== 1:3c f 2:3c g 3:3c h because it found a two-way hunk containing `a' in the first and third files and `g' in the second file, then the single line `b' common to all three files, then a three-way hunk containing the last line of each file.  File: diff.info, Node: Example diff3 Normal, Prev: diff3 Hunks, Up: Comparing Three Files An Example of `diff3' Normal Format =================================== Here is the output of the command `diff3 lao tzu tao' (*note Sample diff3 Input::, for the complete contents of the files). Notice that it shows only the lines that are different among the three files. ====2 1:1,2c 3:1,2c The Way that can be told of is not the eternal Way; The name that can be named is not the eternal name. 2:0a ====1 1:4c The Named is the mother of all things. 2:2,3c 3:4,5c The named is the mother of all things. ====3 1:8c 2:7c so we may see their outcome. 3:9c so we may see their result. ==== 1:11a 2:11,13c They both may be called deep and profound. Deeper and more profound, The door of all subtleties! 3:13,14c -- The Way of Lao-Tzu, tr. Wing-tsit Chan  File: diff.info, Node: diff3 Merging, Next: Interactive Merging, Prev: Comparing Three Files, Up: Top Merging From a Common Ancestor ****************************** When two people have made changes to copies of the same file, `diff3' can produce a merged output that contains both sets of changes together with warnings about conflicts. One might imagine programs with names like `diff4' and `diff5' to compare more than three files simultaneously, but in practice the need rarely arises. You can use `diff3' to merge three or more sets of changes to a file by merging two change sets at a time. `diff3' can incorporate changes from two modified versions into a common preceding version. This lets you merge the sets of changes represented by the two newer files. Specify the common ancestor version as the second argument and the two newer versions as the first and third arguments, like this: diff3 MINE OLDER YOURS You can remember the order of the arguments by noting that they are in alphabetical order. You can think of this as subtracting OLDER from YOURS and adding the result to MINE, or as merging into MINE the changes that would turn OLDER into YOURS. This merging is well-defined as long as MINE and OLDER match in the neighborhood of each such change. This fails to be true when all three input files differ or when only OLDER differs; we call this a "conflict". When all three input files differ, we call the conflict an "overlap". `diff3' gives you several ways to handle overlaps and conflicts. You can omit overlaps or conflicts, or select only overlaps, or mark conflicts with special `<<<<<<<' and `>>>>>>>' lines. `diff3' can output the merge results as an `ed' script that that can be applied to the first file to yield the merged output. However, it is usually better to have `diff3' generate the merged output directly; this bypasses some problems with `ed'. * Menu: * Which Changes:: Selecting changes to incorporate. * Marking Conflicts:: Marking conflicts. * Bypassing ed:: Generating merged output directly. * Merging Incomplete Lines:: How `diff3' merges incomplete lines. * Saving the Changed File:: Emulating System V behavior.  File: diff.info, Node: Which Changes, Next: Marking Conflicts, Up: diff3 Merging Selecting Which Changes to Incorporate ====================================== You can select all unmerged changes from OLDER to YOURS for merging into MINE with the `-e' or `--ed' option. You can select only the nonoverlapping unmerged changes with `-3' or `--easy-only', and you can select only the overlapping changes with `-x' or `--overlap-only'. The `-e', `-3' and `-x' options select only "unmerged changes", i.e. changes where MINE and YOURS differ; they ignore changes from OLDER to YOURS where MINE and YOURS are identical, because they assume that such changes have already been merged. If this assumption is not a safe one, you can use the `-A' or `--show-all' option (*note Marking Conflicts::). Here is the output of the command `diff3' with each of these three options (*note Sample diff3 Input::, for the complete contents of the files). Notice that `-e' outputs the union of the disjoint sets of changes output by `-3' and `-x'. Output of `diff3 -e lao tzu tao': 11a -- The Way of Lao-Tzu, tr. Wing-tsit Chan . 8c so we may see their result. . Output of `diff3 -3 lao tzu tao': 8c so we may see their result. . Output of `diff3 -x lao tzu tao': 11a -- The Way of Lao-Tzu, tr. Wing-tsit Chan .  File: diff.info, Node: Marking Conflicts, Next: Bypassing ed, Prev: Which Changes, Up: diff3 Merging Marking Conflicts ================= `diff3' can mark conflicts in the merged output by bracketing them with special marker lines. A conflict that comes from two files A and B is marked as follows: <<<<<<< A lines from A ======= lines from B >>>>>>> B A conflict that comes from three files A, B and C is marked as follows: <<<<<<< A lines from A ||||||| B lines from B ======= lines from C >>>>>>> C The `-A' or `--show-all' option acts like the `-e' option, except that it brackets conflicts, and it outputs all changes from OLDER to YOURS, not just the unmerged changes. Thus, given the sample input files (*note Sample diff3 Input::), `diff3 -A lao tzu tao' puts brackets around the conflict where only `tzu' differs: <<<<<<< tzu ======= The Way that can be told of is not the eternal Way; The name that can be named is not the eternal name. >>>>>>> tao And it outputs the three-way conflict as follows: <<<<<<< lao ||||||| tzu They both may be called deep and profound. Deeper and more profound, The door of all subtleties! ======= -- The Way of Lao-Tzu, tr. Wing-tsit Chan >>>>>>> tao The `-E' or `--show-overlap' option outputs less information than the `-A' or `--show-all' option, because it outputs only unmerged changes, and it never outputs the contents of the second file. Thus the `-E' option acts like the `-e' option, except that it brackets the first and third files from three-way overlapping changes. Similarly, `-X' acts like `-x', except it brackets all its (necessarily overlapping) changes. For example, for the three-way overlapping change above, the `-E' and `-X' options output the following: <<<<<<< lao ======= -- The Way of Lao-Tzu, tr. Wing-tsit Chan >>>>>>> tao If you are comparing files that have meaningless or uninformative names, you can use the `-L LABEL' or `--label=LABEL' option to show alternate names in the `<<<<<<<', `|||||||' and `>>>>>>>' brackets. This option can be given up to three times, once for each input file. Thus `diff3 -A -L X -L Y -L Z A B C' acts like `diff3 -A A B C', except that the output looks like it came from files named `X', `Y' and `Z' rather than from files named `A', `B' and `C'.  File: diff.info, Node: Bypassing ed, Next: Merging Incomplete Lines, Prev: Marking Conflicts, Up: diff3 Merging Generating the Merged Output Directly ===================================== With the `-m' or `--merge' option, `diff3' outputs the merged file directly. This is more efficient than using `ed' to generate it, and works even with non-text files that `ed' would reject. If you specify `-m' without an `ed' script option, `-A' (`--show-all') is assumed. For example, the command `diff3 -m lao tzu tao' (*note Sample diff3 Input:: for a copy of the input files) would output the following: <<<<<<< tzu ======= The Way that can be told of is not the eternal Way; The name that can be named is not the eternal name. >>>>>>> tao The Nameless is the origin of Heaven and Earth; The Named is the mother of all things. Therefore let there always be non-being, so we may see their subtlety, And let there always be being, so we may see their result. The two are the same, But after they are produced, they have different names. <<<<<<< lao ||||||| tzu They both may be called deep and profound. Deeper and more profound, The door of all subtleties! ======= -- The Way of Lao-Tzu, tr. Wing-tsit Chan >>>>>>> tao  File: diff.info, Node: Merging Incomplete Lines, Next: Saving the Changed File, Prev: Bypassing ed, Up: diff3 Merging How `diff3' Merges Incomplete Lines =================================== With `-m', incomplete lines (*note Incomplete Lines::) are simply copied to the output as they are found; if the merged output ends in an conflict and one of the input files ends in an incomplete line, succeeding `|||||||', `=======' or `>>>>>>>' brackets appear somewhere other than the start of a line because they are appended to the incomplete line. Without `-m', if an `ed' script option is specified and an incomplete line is found, `diff3' generates a warning and acts as if a newline had been present.  File: diff.info, Node: Saving the Changed File, Prev: Merging Incomplete Lines, Up: diff3 Merging Saving the Changed File ======================= Traditional Unix `diff3' generates an `ed' script without the trailing `w' and `q' commands that save the changes. System V `diff3' generates these extra commands. GNU `diff3' normally behaves like traditional Unix `diff3', but with the `-i' option it behaves like System V `diff3' and appends the `w' and `q' commands. The `-i' option requires one of the `ed' script options `-AeExX3', and is incompatible with the merged output option `-m'.  File: diff.info, Node: Interactive Merging, Next: Merging with patch, Prev: diff3 Merging, Up: Top Interactive Merging with `sdiff' ******************************** With `sdiff', you can merge two files interactively based on a side-by-side `-y' format comparison (*note Side by Side::). Use `-o FILE' or `--output=FILE' to specify where to put the merged text. *Note Invoking sdiff::, for more details on the options to `sdiff'. Another way to merge files interactively is to use the Emacs Lisp package `emerge'. *Note emerge: (emacs)emerge, for more information. * Menu: * sdiff Option Summary:: Summary of `sdiff' options. * Merge Commands:: Merging two files interactively.  File: diff.info, Node: sdiff Option Summary, Next: Merge Commands, Up: Interactive Merging Specifying `diff' Options to `sdiff' ==================================== The following `sdiff' options have the same meaning as for `diff'. *Note diff Options::, for the use of these options. -a -b -d -i -t -v -B -E -I REGEXP --ignore-blank-lines --ignore-case --ignore-matching-lines=REGEXP --ignore-space-change --ignore-tab-expansion --left-column --minimal --speed-large-files --strip-trailing-cr --suppress-common-lines --expand-tabs --text --version --width=COLUMNS For historical reasons, `sdiff' has alternate names for some options. The `-l' option is equivalent to the `--left-column' option, and similarly `-s' is equivalent to `--suppress-common-lines'. The meaning of the `sdiff' `-w' and `-W' options is interchanged from that of `diff': with `sdiff', `-w COLUMNS' is equivalent to `--width=COLUMNS', and `-W' is equivalent to `--ignore-all-space'. `sdiff' without the `-o' option is equivalent to `diff' with the `-y' or `--side-by-side' option (*note Side by Side::).  File: diff.info, Node: Merge Commands, Prev: sdiff Option Summary, Up: Interactive Merging Merge Commands ============== Groups of common lines, with a blank gutter, are copied from the first file to the output. After each group of differing lines, `sdiff' prompts with `%' and pauses, waiting for one of the following commands. Follow each command with . `e' Discard both versions. Invoke a text editor on an empty temporary file, then copy the resulting file to the output. `eb' Concatenate the two versions, edit the result in a temporary file, then copy the edited result to the output. `ed' Like `eb', except precede each version with a header that shows what file and lines the version came from. `el' Edit a copy of the left version, then copy the result to the output. `er' Edit a copy of the right version, then copy the result to the output. `l' Copy the left version to the output. `q' Quit. `r' Copy the right version to the output. `s' Silently copy common lines. `v' Verbosely copy common lines. This is the default. The text editor invoked is specified by the `EDITOR' environment variable if it is set. The default is system-dependent.  File: diff.info, Node: Merging with patch, Next: Making Patches, Prev: Interactive Merging, Up: Top Merging with `patch' ******************** `patch' takes comparison output produced by `diff' and applies the differences to a copy of the original file, producing a patched version. With `patch', you can distribute just the changes to a set of files instead of distributing the entire file set; your correspondents can apply `patch' to update their copy of the files with your changes. `patch' automatically determines the diff format, skips any leading or trailing headers, and uses the headers to determine which file to patch. This lets your correspondents feed a mail message containing a difference listing directly to `patch'. `patch' detects and warns about common problems like forward patches. It saves any patches that it could not apply. It can also maintain a `patchlevel.h' file to ensure that your correspondents apply diffs in the proper order. `patch' accepts a series of diffs in its standard input, usually separated by headers that specify which file to patch. It applies `diff' hunks (*note Hunks::) one by one. If a hunk does not exactly match the original file, `patch' uses heuristics to try to patch the file as well as it can. If no approximate match can be found, `patch' rejects the hunk and skips to the next hunk. `patch' normally replaces each file F with its new version, putting reject hunks (if any) into `F.rej'. *Note Invoking patch::, for detailed information on the options to `patch'. * Menu: * patch Input:: Selecting the type of `patch' input. * Revision Control:: Getting files from RCS, SCCS, etc. * Imperfect:: Dealing with imperfect patches. * Creating and Removing:: Creating and removing files with a patch. * Patching Time Stamps:: Updating time stamps on patched files. * Multiple Patches:: Handling multiple patches in a file. * patch Directories:: Changing directory and stripping directories. * Backups:: Whether backup files are made. * Backup Names:: Backup file names. * Reject Names:: Reject file names. * patch Messages:: Messages and questions `patch' can produce. * patch and POSIX:: Conformance to the POSIX standard. * patch and Tradition:: GNU versus traditional `patch'.  File: diff.info, Node: patch Input, Next: Revision Control, Up: Merging with patch Selecting the `patch' Input Format ================================== `patch' normally determines which `diff' format the patch file uses by examining its contents. For patch files that contain particularly confusing leading text, you might need to use one of the following options to force `patch' to interpret the patch file as a certain format of diff. The output formats listed here are the only ones that `patch' can understand. `-c' `--context' context diff. `-e' `--ed' `ed' script. `-n' `--normal' normal diff. `-u' `--unified' unified diff.  File: diff.info, Node: Revision Control, Next: Imperfect, Prev: patch Input, Up: Merging with patch Revision Control ================ If a nonexistent input file is under a revision control system supported by `patch', `patch' normally asks the user whether to get (or check out) the file from the revision control system. Patch currently supports RCS, ClearCase and SCCS. Under RCS and SCCS, `patch' also asks when the input file is read-only and matches the default version in the revision control system. The `-g NUM' or `--get=NUM' affects access to files under supported revision control systems. If NUM is positive, `patch' gets the file without asking the user; if zero, `patch' neither asks the user nor gets the file; and if negative, `patch' asks the user before getting the file. The default value of NUM is given by the value of the `PATCH_GET' environment variable if it is set; if not, the default value is zero if `patch' is conforming to POSIX, negative otherwise. *Note patch and POSIX::. The choice of revision control system is unaffected by the `VERSION_CONTROL' environment variable (*note Backup Names::).  File: diff.info, Node: Imperfect, Next: Creating and Removing, Prev: Revision Control, Up: Merging with patch Applying Imperfect Patches ========================== `patch' tries to skip any leading text in the patch file, apply the diff, and then skip any trailing text. Thus you can feed a mail message directly to `patch', and it should work. If the entire diff is indented by a constant amount of white space, `patch' automatically ignores the indentation. If a context diff contains trailing carriage return on each line, `patch' automatically ignores the carriage return. If a context diff has been encapsulated by prepending `- ' to lines beginning with `-' as per Internet RFC 934 (ftp://ftp.isi.edu/in-notes/rfc934.txt), `patch' automatically unencapsulates the input. However, certain other types of imperfect input require user intervention or testing. * Menu: * Changed White Space:: When tabs and spaces don't match exactly. * Reversed Patches:: Applying reversed patches correctly. * Inexact:: Helping `patch' find close matches. * Dry Runs:: Predicting what `patch' will do.  File: diff.info, Node: Changed White Space, Next: Reversed Patches, Up: Imperfect Applying Patches with Changed White Space ----------------------------------------- Sometimes mailers, editors, or other programs change spaces into tabs, or vice versa. If this happens to a patch file or an input file, the files might look the same, but `patch' will not be able to match them properly. If this problem occurs, use the `-l' or `--ignore-white-space' option, which makes `patch' compare blank characters (i.e. spaces and tabs) loosely so that any nonempty sequence of blanks in the patch file matches any nonempty sequence of blanks in the input files. Non-blank characters must still match exactly. Each line of the context must still match a line in the input file.  File: diff.info, Node: Reversed Patches, Next: Inexact, Prev: Changed White Space, Up: Imperfect Applying Reversed Patches ------------------------- Sometimes people run `diff' with the new file first instead of second. This creates a diff that is "reversed". To apply such patches, give `patch' the `-R' or `--reverse' option. `patch' then attempts to swap each hunk around before applying it. Rejects come out in the swapped format. Often `patch' can guess that the patch is reversed. If the first hunk of a patch fails, `patch' reverses the hunk to see if it can apply it that way. If it can, `patch' asks you if you want to have the `-R' option set; if it can't, `patch' continues to apply the patch normally. This method cannot detect a reversed patch if it is a normal diff and the first command is an append (which should have been a delete) since appends always succeed, because a null context matches anywhere. But most patches add or change lines rather than delete them, so most reversed normal diffs begin with a delete, which fails, and `patch' notices. If you apply a patch that you have already applied, `patch' thinks it is a reversed patch and offers to un-apply the patch. This could be construed as a feature. If you did this inadvertently and you don't want to un-apply the patch, just answer `n' to this offer and to the subsequent "apply anyway" question--or type `C-c' to kill the `patch' process.  File: diff.info, Node: Inexact, Next: Dry Runs, Prev: Reversed Patches, Up: Imperfect Helping `patch' Find Inexact Matches ------------------------------------ For context diffs, and to a lesser extent normal diffs, `patch' can detect when the line numbers mentioned in the patch are incorrect, and it attempts to find the correct place to apply each hunk of the patch. As a first guess, it takes the line number mentioned in the hunk, plus or minus any offset used in applying the previous hunk. If that is not the correct place, `patch' scans both forward and backward for a set of lines matching the context given in the hunk. First `patch' looks for a place where all lines of the context match. If it cannot find such a place, and it is reading a context or unified diff, and the maximum fuzz factor is set to 1 or more, then `patch' makes another scan, ignoring the first and last line of context. If that fails, and the maximum fuzz factor is set to 2 or more, it makes another scan, ignoring the first two and last two lines of context are ignored. It continues similarly if the maximum fuzz factor is larger. The `-F LINES' or `--fuzz=LINES' option sets the maximum fuzz factor to LINES. This option only applies to context and unified diffs; it ignores up to LINES lines while looking for the place to install a hunk. Note that a larger fuzz factor increases the odds of making a faulty patch. The default fuzz factor is 2; there is no point to setting it to more than the number of lines of context in the diff, ordinarily 3. If `patch' cannot find a place to install a hunk of the patch, it writes the hunk out to a reject file (*note Reject Names::, for information on how reject files are named). It writes out rejected hunks in context format no matter what form the input patch is in. If the input is a normal or `ed' diff, many of the contexts are simply null. The line numbers on the hunks in the reject file may be different from those in the patch file: they show the approximate location where `patch' thinks the failed hunks belong in the new file rather than in the old one. If the `--verbose' option is given, then as it completes each hunk `patch' tells you whether the hunk succeeded or failed, and if it failed, on which line (in the new file) `patch' thinks the hunk should go. If this is different from the line number specified in the diff, it tells you the offset. A single large offset _may_ indicate that `patch' installed a hunk in the wrong place. `patch' also tells you if it used a fuzz factor to make the match, in which case you should also be slightly suspicious. `patch' cannot tell if the line numbers are off in an `ed' script, and can only detect wrong line numbers in a normal diff when it finds a change or delete command. It may have the same problem with a context diff using a fuzz factor equal to or greater than the number of lines of context shown in the diff (typically 3). In these cases, you should probably look at a context diff between your original and patched input files to see if the changes make sense. Compiling without errors is a pretty good indication that the patch worked, but not a guarantee. A patch against an empty file applies to a nonexistent file, and vice versa. *Note Creating and Removing::. `patch' usually produces the correct results, even when it must make many guesses. However, the results are guaranteed only when the patch is applied to an exact copy of the file that the patch was generated from.  File: diff.info, Node: Dry Runs, Prev: Inexact, Up: Imperfect Predicting what `patch' will do ------------------------------- It may not be obvious in advance what `patch' will do with a complicated or poorly formatted patch. If you are concerned that the input might cause `patch' to modify the wrong files, you can use the `--dry-run' option, which causes `patch' to print the results of applying patches without actually changing any files. You can then inspect the diagnostics generated by the dry run to see whether `patch' will modify the files that you expect. If the patch does not do what you want, you can modify the patch (or the other options to `patch') and try another dry run. Once you are satisfied with the proposed patch you can apply it by invoking `patch' as before, but this time without the `--dry-run' option.  File: diff.info, Node: Creating and Removing, Next: Patching Time Stamps, Prev: Imperfect, Up: Merging with patch Creating and Removing Files =========================== Sometimes when comparing two directories, a file may exist in one directory but not the other. If you give `diff' the `-N' or `--new-file' option, or if you supply an old or new file that is named `/dev/null' or is empty and is dated the Epoch (1970-01-01 00:00:00 UTC), `diff' outputs a patch that adds or deletes the contents of this file. When given such a patch, `patch' normally creates a new file or removes the old file. However, when conforming to POSIX (*note patch and POSIX::), `patch' does not remove the old file, but leaves it empty. The `-E' or `--remove-empty-files' option causes `patch' to remove output files that are empty after applying a patch, even if the patch does not appear to be one that removed the file. If the patch appears to create a file that already exists, `patch' asks for confirmation before applying the patch.  File: diff.info, Node: Patching Time Stamps, Next: Multiple Patches, Prev: Creating and Removing, Up: Merging with patch Updating Time Stamps on Patched Files ===================================== When `patch' updates a file, it normally sets the file's last-modified time stamp to the current time of day. If you are using `patch' to track a software distribution, this can cause `make' to incorrectly conclude that a patched file is out of date. For example, if `syntax.c' depends on `syntax.y', and `patch' updates `syntax.c' and then `syntax.y', then `syntax.c' will normally appear to be out of date with respect to `syntax.y' even though its contents are actually up to date. The `-Z' or `--set-utc' option causes `patch' to set a patched file's modification and access times to the time stamps given in context diff headers. If the context diff headers do not specify a time zone, they are assumed to use Coordinated Universal Time (UTC, often known as GMT). The `-T' or `--set-time' option acts like `-Z' or `--set-utc', except that it assumes that the context diff headers' time stamps use local time instead of UTC. This option is not recommended, because patches using local time cannot easily be used by people in other time zones, and because local time stamps are ambiguous when local clocks move backwards during daylight-saving time adjustments. If the context diff headers specify a time zone, this option is equivalent to `-Z' or `--set-utc'. `patch' normally refrains from setting a file's time stamps if the file's original last-modified time stamp does not match the time given in the diff header, of if the file's contents do not exactly match the patch. However, if the `-f' or `--force' option is given, the file's time stamps are set regardless. Due to the limitations of the current `diff' format, `patch' cannot update the times of files whose contents have not changed. Also, if you set file time stamps to values other than the current time of day, you should also remove (e.g., with `make clean') all files that depend on the patched files, so that later invocations of `make' do not get confused by the patched files' times.  File: diff.info, Node: Multiple Patches, Next: patch Directories, Prev: Patching Time Stamps, Up: Merging with patch Multiple Patches in a File ========================== If the patch file contains more than one patch, and if you do not specify an input file on the command line, `patch' tries to apply each patch as if they came from separate patch files. This means that it determines the name of the file to patch for each patch, and that it examines the leading text before each patch for file names and prerequisite revision level (*note Making Patches::, for more on that topic). `patch' uses the following rules to intuit a file name from the leading text before a patch. First, `patch' takes an ordered list of candidate file names as follows: * If the header is that of a context diff, `patch' takes the old and new file names in the header. A name is ignored if it does not have enough slashes to satisfy the `-pNUM' or `--strip=NUM' option. The name `/dev/null' is also ignored. * If there is an `Index:' line in the leading garbage and if either the old and new names are both absent or if `patch' is conforming to POSIX, `patch' takes the name in the `Index:' line. * For the purpose of the following rules, the candidate file names are considered to be in the order (old, new, index), regardless of the order that they appear in the header. Then `patch' selects a file name from the candidate list as follows: * If some of the named files exist, `patch' selects the first name if conforming to POSIX, and the best name otherwise. * If `patch' is not ignoring RCS, ClearCase, and SCCS (*note Revision Control::), and no named files exist but an RCS, ClearCase, or SCCS master is found, `patch' selects the first named file with an RCS, ClearCase, or SCCS master. * If no named files exist, no RCS, ClearCase, or SCCS master was found, some names are given, `patch' is not conforming to POSIX, and the patch appears to create a file, `patch' selects the best name requiring the creation of the fewest directories. * If no file name results from the above heuristics, you are asked for the name of the file to patch, and `patch' selects that name. To determine the "best" of a nonempty list of file names, `patch' first takes all the names with the fewest path name components; of those, it then takes all the names with the shortest basename; of those, it then takes all the shortest names; finally, it takes the first remaining name. *Note patch and POSIX::, to see whether `patch' is conforming to POSIX.  File: diff.info, Node: patch Directories, Next: Backups, Prev: Multiple Patches, Up: Merging with patch Applying Patches in Other Directories ===================================== The `-d DIRECTORY' or `--directory=DIRECTORY' option to `patch' makes directory DIRECTORY the current directory for interpreting both file names in the patch file, and file names given as arguments to other options (such as `-B' and `-o'). For example, while in a mail reading program, you can patch a file in the `/usr/src/emacs' directory directly from a message containing the patch like this: | patch -d /usr/src/emacs Sometimes the file names given in a patch contain leading directories, but you keep your files in a directory different from the one given in the patch. In those cases, you can use the `-pNUMBER' or `--strip=NUMBER' option to set the file name strip count to NUMBER. The strip count tells `patch' how many slashes, along with the directory names between them, to strip from the front of file names. A sequence of one or more adjacent slashes is counted as a single slash. By default, `patch' strips off all leading directories, leaving just the base file names. For example, suppose the file name in the patch file is `/gnu/src/emacs/etc/NEWS'. Using `-p0' gives the entire file name unmodified, `-p1' gives `gnu/src/emacs/etc/NEWS' (no leading slash), `-p4' gives `etc/NEWS', and not specifying `-p' at all gives `NEWS'. `patch' looks for each file (after any slashes have been stripped) in the current directory, or if you used the `-d DIRECTORY' option, in that directory.  File: diff.info, Node: Backups, Next: Backup Names, Prev: patch Directories, Up: Merging with patch Backup Files ============ Normally, `patch' creates a backup file if the patch does not exactly match the original input file, because in that case the original data might not be recovered if you undo the patch with `patch -R' (*note Reversed Patches::). However, when conforming to POSIX, `patch' does not create backup files by default. *Note patch and POSIX::. The `-b' or `--backup' option causes `patch' to make a backup file regardless of whether the patch matches the original input. The `--backup-if-mismatch' option causes `patch' to create backup files for mismatches files; this is the default when not conforming to POSIX. The `--no-backup-if-mismatch' option causes `patch' to not create backup files, even for mismatched patches; this is the default when conforming to POSIX. When backing up a file that does not exist, an empty, unreadable backup file is created as a placeholder to represent the nonexistent file.  File: diff.info, Node: Backup Names, Next: Reject Names, Prev: Backups, Up: Merging with patch Backup File Names ================= Normally, `patch' renames an original input file into a backup file by appending to its name the extension `.orig', or `~' if using `.orig' would make the backup file name too long.(1) The `-z BACKUP-SUFFIX' or `--suffix=BACKUP-SUFFIX' option causes `patch' to use BACKUP-SUFFIX as the backup extension instead. Alternately, you can specify the extension for backup files with the `SIMPLE_BACKUP_SUFFIX' environment variable, which the options override. `patch' can also create numbered backup files the way GNU Emacs does. With this method, instead of having a single backup of each file, `patch' makes a new backup file name each time it patches a file. For example, the backups of a file named `sink' would be called, successively, `sink.~1~', `sink.~2~', `sink.~3~', etc. The `-V BACKUP-STYLE' or `--version-control=BACKUP-STYLE' option takes as an argument a method for creating backup file names. You can alternately control the type of backups that `patch' makes with the `PATCH_VERSION_CONTROL' environment variable, which the `-V' option overrides. If `PATCH_VERSION_CONTROL' is not set, the `VERSION_CONTROL' environment variable is used instead. Please note that these options and variables control backup file names; they do not affect the choice of revision control system (*note Revision Control::). The values of these environment variables and the argument to the `-V' option are like the GNU Emacs `version-control' variable (*note Backup Names: (emacs)Backup Names., for more information on backup versions in Emacs). They also recognize synonyms that are more descriptive. The valid values are listed below; unique abbreviations are acceptable. `t' `numbered' Always make numbered backups. `nil' `existing' Make numbered backups of files that already have them, simple backups of the others. This is the default. `never' `simple' Always make simple backups. You can also tell `patch' to prepend a prefix, such as a directory name, to produce backup file names. The `-B PREFIX' or `--prefix=PREFIX' option makes backup files by prepending PREFIX to them. The `-Y PREFIX' or `--basename-prefix=PREFIX' prepends PREFIX to the last file name component of backup file names instead; for example, `-Y ~' causes the backup name for `dir/file.c' to be `dir/~file.c'. If you use either of these prefix options, the suffix-based options are ignored. If you specify the output file with the `-o' option, that file is the one that is backed up, not the input file. Options that affect the names of backup files do not affect whether backups are made. For example, if you specify the `--no-backup-if-mismatch' option, none of the options described in this section have any affect, because no backups are made. ---------- Footnotes ---------- (1) A coding error in GNU `patch' version 2.5.4 causes it to always use `~', but this should be fixed in the next release.  File: diff.info, Node: Reject Names, Next: patch Messages, Prev: Backup Names, Up: Merging with patch Reject File Names ================= The names for reject files (files containing patches that `patch' could not find a place to apply) are normally the name of the output file with `.rej' appended (or `#' if if using `.rej' would make the backup file name too long). Alternatively, you can tell `patch' to place all of the rejected patches in a single file. The `-r REJECT-FILE' or `--reject-file=REJECT-FILE' option uses REJECT-FILE as the reject file name.  File: diff.info, Node: patch Messages, Next: patch and POSIX, Prev: Reject Names, Up: Merging with patch Messages and Questions from `patch' =================================== `patch' can produce a variety of messages, especially if it has trouble decoding its input. In a few situations where it's not sure how to proceed, `patch' normally prompts you for more information from the keyboard. There are options to produce more or fewer messages, to have it not ask for keyboard input, and to affect the way that file names are quoted in messages. * Menu: * More or Fewer Messages:: Controlling the verbosity of `patch'. * patch and Keyboard Input:: Inhibiting keyboard input. * patch Quoting Style:: Quoting file names in diagnostics. `patch' exits with status 0 if all hunks are applied successfully, 1 if some hunks cannot be applied, and 2 if there is more serious trouble. When applying a set of patches in a loop, you should check the exit status, so you don't apply a later patch to a partially patched file.  File: diff.info, Node: More or Fewer Messages, Next: patch and Keyboard Input, Up: patch Messages Controlling the Verbosity of `patch' ------------------------------------ You can cause `patch' to produce more messages by using the `--verbose' option. For example, when you give this option, the message `Hmm...' indicates that `patch' is reading text in the patch file, attempting to determine whether there is a patch in that text, and if so, what kind of patch it is. You can inhibit all terminal output from `patch', unless an error occurs, by using the `-s', `--quiet', or `--silent' option.  File: diff.info, Node: patch and Keyboard Input, Next: patch Quoting Style, Prev: More or Fewer Messages, Up: patch Messages Inhibiting Keyboard Input ------------------------- There are two ways you can prevent `patch' from asking you any questions. The `-f' or `--force' option assumes that you know what you are doing. It causes `patch' to do the following: * Skip patches that do not contain file names in their headers. * Patch files even though they have the wrong version for the `Prereq:' line in the patch; * Assume that patches are not reversed even if they look like they are. The `-t' or `--batch' option is similar to `-f', in that it suppresses questions, but it makes somewhat different assumptions: * Skip patches that do not contain file names in their headers (the same as `-f'). * Skip patches for which the file has the wrong version for the `Prereq:' line in the patch; * Assume that patches are reversed if they look like they are.  File: diff.info, Node: patch Quoting Style, Prev: patch and Keyboard Input, Up: patch Messages `patch' Quoting Style --------------------- When `patch' outputs a file name in a diagnostic message, it can format the name in any of several ways. This can be useful to output file names unambiguously, even if they contain punctuation or special characters like newlines. The `--quoting-style=WORD' option controls how names are output. The WORD should be one of the following: `literal' Output names as-is. `shell' Quote names for the shell if they contain shell metacharacters or would cause ambiguous output. `shell-always' Quote names for the shell, even if they would normally not require quoting. `c' Quote names as for a C language string. `escape' Quote as with `c' except omit the surrounding double-quote characters. You can specify the default value of the `--quoting-style' option with the environment variable `QUOTING_STYLE'. If that environment variable is not set, the default value is `shell', but this default may change in a future version of `patch'.  File: diff.info, Node: patch and POSIX, Next: patch and Tradition, Prev: patch Messages, Up: Merging with patch `patch' and the POSIX Standard ============================== If you specify the `--posix' option, or set the `POSIXLY_CORRECT' environment variable, `patch' conforms more strictly to the POSIX standard, as follows: * Take the first existing file from the list (old, new, index) when intuiting file names from diff headers. *Note Multiple Patches::. * Do not remove files that are removed by a diff. *Note Creating and Removing::. * Do not ask whether to get files from RCS, ClearCase, or SCCS. *Note Revision Control::. * Require that all options precede the files in the command line. * Do not backup files, even when there is a mismatch. *Note Backups::.  File: diff.info, Node: patch and Tradition, Prev: patch and POSIX, Up: Merging with patch GNU `patch' and Traditional `patch' =================================== The current version of GNU `patch' normally follows the POSIX standard. *Note patch and POSIX::, for the few exceptions to this general rule. Unfortunately, POSIX redefined the behavior of `patch' in several important ways. You should be aware of the following differences if you must interoperate with traditional `patch', or with GNU `patch' version 2.1 and earlier. * In traditional `patch', the `-p' option's operand was optional, and a bare `-p' was equivalent to `-p0'. The `-p' option now requires an operand, and `-p 0' is now equivalent to `-p0'. For maximum compatibility, use options like `-p0' and `-p1'. Also, traditional `patch' simply counted slashes when stripping path prefixes; `patch' now counts pathname components. That is, a sequence of one or more adjacent slashes now counts as a single slash. For maximum portability, avoid sending patches containing `//' in file names. * In traditional `patch', backups were enabled by default. This behavior is now enabled with the `-b' or `--backup' option. Conversely, in POSIX `patch', backups are never made, even when there is a mismatch. In GNU `patch', this behavior is enabled with the `--no-backup-if-mismatch' option, or by conforming to POSIX. The `-b SUFFIX' option of traditional `patch' is equivalent to the `-b -z SUFFIX' options of GNU `patch'. * Traditional `patch' used a complicated (and incompletely documented) method to intuit the name of the file to be patched from the patch header. This method did not conform to POSIX, and had a few gotchas. Now `patch' uses a different, equally complicated (but better documented) method that is optionally POSIX-conforming; we hope it has fewer gotchas. The two methods are compatible if the file names in the context diff header and the `Index:' line are all identical after prefix-stripping. Your patch is normally compatible if each header's file names all contain the same number of slashes. * When traditional `patch' asked the user a question, it sent the question to standard error and looked for an answer from the first file in the following list that was a terminal: standard error, standard output, `/dev/tty', and standard input. Now `patch' sends questions to standard output and gets answers from `/dev/tty'. Defaults for some answers have been changed so that `patch' never goes into an infinite loop when using default answers. * Traditional `patch' exited with a status value that counted the number of bad hunks, or with status 1 if there was real trouble. Now `patch' exits with status 1 if some hunks failed, or with 2 if there was real trouble. * Limit yourself to the following options when sending instructions meant to be executed by anyone running GNU `patch', traditional `patch', or a `patch' that conforms to POSIX. Spaces are significant in the following list, and operands are required. `-c' `-d DIR' `-D DEFINE' `-e' `-l' `-n' `-N' `-o OUTFILE' `-pNUM' `-R' `-r REJECTFILE'  File: diff.info, Node: Making Patches, Next: Invoking cmp, Prev: Merging with patch, Up: Top Tips for Making and Using Patches ********************************* Use some common sense when making and using patches. For example, when sending bug fixes to a program's maintainer, send several small patches, one per independent subject, instead of one large, harder-to-digest patch that covers all the subjects. Here are some other things you should keep in mind if you are going to distribute patches for updating a software package. * Menu: * Tips for Patch Producers:: Advice for making patches. * Tips for Patch Consumers:: Advice for using patches. * Avoiding Common Mistakes:: Avoiding common mistakes when using `patch'. * Generating Smaller Patches:: How to generate smaller patches.  File: diff.info, Node: Tips for Patch Producers, Next: Tips for Patch Consumers, Up: Making Patches Tips for Patch Producers ======================== To create a patch that changes an older version of a package into a newer version, first make a copy of the older and newer versions in adjacent subdirectories. It is common to do that by unpacking `tar' archives of the two versions. To generate the patch, use the command `diff -Naur OLD NEW' where OLD and NEW identify the old and new directories. The names OLD and NEW should not contain any slashes. The `-N' option lets the patch create and remove files; `-a' lets the patch update non-text files; `-u' generates useful time stamps and enough context; and `-r' lets the patch update subdirectories. Here is an example command, using Bourne shell syntax: diff -Naur gcc-3.0.3 gcc-3.0.4 Tell your recipients how to apply the patches. This should include which working directory to use, and which `patch' options to use; the option `-p1' is recommended. Test your procedure by pretending to be a recipient and applying your patches to a copy of the original files. *Note Avoiding Common Mistakes::, for how to avoid common mistakes when generating a patch.  File: diff.info, Node: Tips for Patch Consumers, Next: Avoiding Common Mistakes, Prev: Tips for Patch Producers, Up: Making Patches Tips for Patch Consumers ======================== A patch producer should tell recipients how to apply the patches, so the first rule of thumb for a patch consumer is to follow the instructions supplied with the patch. GNU `diff' can analyze files with arbitrarily long lines and files that end in incomplete lines. However, older versions of `patch' cannot patch such files. If you are having trouble applying such patches, try upgrading to a recent version of GNU `patch'.  File: diff.info, Node: Avoiding Common Mistakes, Next: Generating Smaller Patches, Prev: Tips for Patch Consumers, Up: Making Patches Avoiding Common Mistakes ======================== When producing a patch for multiple files, apply `diff' to directories whose names do not have slashes. This reduces confusion when the patch consumer specifies the `-pNUMBER' option, since this option can have surprising results when the old and new file names have different numbers of slashes. For example, do not send a patch with a header that looks like this: diff -Naur v2.0.29/prog/README prog/README --- v2.0.29/prog/README 2002-03-10 23:30:39.942229878 -0800 +++ prog/README 2002-03-17 20:49:32.442260588 -0800 because the two file names have different numbers of slashes, and different versions of `patch' interpret the file names differently. To avoid confusion, send output that looks like this instead: diff -Naur v2.0.29/prog/README v2.0.30/prog/README --- v2.0.29/prog/README 2002-03-10 23:30:39.942229878 -0800 +++ v2.0.30/prog/README 2002-03-17 20:49:32.442260588 -0800 Make sure you have specified the file names correctly, either in a context diff header or with an `Index:' line. Take care to not send out reversed patches, since these make people wonder whether they have already applied the patch. Avoid sending patches that compare backup file names like `README.orig' or `README~', since this might confuse `patch' into patching a backup file instead of the real file. Instead, send patches that compare the same base file names in different directories, e.g. `old/README' and `new/README'. To save people from partially applying a patch before other patches that should have gone before it, you can make the first patch in the patch file update a file with a name like `patchlevel.h' or `version.c', which contains a patch level or version number. If the input file contains the wrong version number, `patch' will complain immediately. An even clearer way to prevent this problem is to put a `Prereq:' line before the patch. If the leading text in the patch file contains a line that starts with `Prereq:', `patch' takes the next word from that line (normally a version number) and checks whether the next input file contains that word, preceded and followed by either white space or a newline. If not, `patch' prompts you for confirmation before proceeding. This makes it difficult to accidentally apply patches in the wrong order.  File: diff.info, Node: Generating Smaller Patches, Prev: Avoiding Common Mistakes, Up: Making Patches Generating Smaller Patches ========================== The simplest way to generate a patch is to use `diff -Naur' (*note Tips for Patch Producers::), but you might be able to reduce the size of the patch by renaming or removing some files before making the patch. If the older version of the package contains any files that the newer version does not, or if any files have been renamed between the two versions, make a list of `rm' and `mv' commands for the user to execute in the old version directory before applying the patch. Then run those commands yourself in the scratch directory. If there are any files that you don't need to include in the patch because they can easily be rebuilt from other files (for example, `TAGS' and output from `yacc' and `makeinfo'), exclude them from the patch by giving `diff' the `-x PATTERN' option (*note Comparing Directories::). If you want your patch to modify a derived file because your recipients lack tools to build it, make sure that the patch for the derived file follows any patches for files that it depends on, so that the recipients' time stamps will not confuse `make'. Now you can create the patch using `diff -Naur'. Make sure to specify the scratch directory first and the newer directory second. Add to the top of the patch a note telling the user any `rm' and `mv' commands to run before applying the patch. Then you can remove the scratch directory. You can also shrink the patch size by using fewer lines of context, but bear in mind that `patch' typically needs at least two lines for proper operation when patches do not exactly match the input files.  File: diff.info, Node: Invoking cmp, Next: Invoking diff, Prev: Making Patches, Up: Top Invoking `cmp' ************** The `cmp' command compares two files, and if they differ, tells the first byte and line number where they differ. Bytes and lines are numbered starting with 1. The arguments of `cmp' are as follows: cmp OPTIONS... FROM-FILE [TO-FILE [FROM-SKIP [TO-SKIP]]] The file name `-' is always the standard input. `cmp' also uses the standard input if one file name is omitted. The FROM-SKIP and TO-SKIP operands specify how many bytes to ignore at the start of each file; they are equivalent to the `--ignore-initial=FROM-SKIP:TO-SKIP' option. An exit status of 0 means no differences were found, 1 means some differences were found, and 2 means trouble. * Menu: * cmp Options:: Summary of options to `cmp'.  File: diff.info, Node: cmp Options, Up: Invoking cmp Options to `cmp' ================ Below is a summary of all of the options that GNU `cmp' accepts. Most options have two equivalent names, one of which is a single letter preceded by `-', and the other of which is a long name preceded by `--'. Multiple single letter options (unless they take an argument) can be combined into a single command line word: `-bl' is equivalent to `-b -l'. `-b' `--print-bytes' Print the differing bytes. Display control bytes as a `^' followed by a letter of the alphabet and precede bytes that have the high bit set with `M-' (which stands for "meta"). `--help' Output a summary of usage and then exit. `-i SKIP' `--ignore-initial=SKIP' Ignore any differences in the first SKIP bytes of the input files. Treat files with fewer than SKIP bytes as if they are empty. If SKIP is of the form `FROM-SKIP:TO-SKIP', skip the first FROM-SKIP bytes of the first input file and the first TO-SKIP bytes of the second. `-l' `--verbose' Print the (decimal) byte numbers and (octal) values of all differing bytes. `-n COUNT' `--bytes=COUNT' Compare at most COUNT input bytes. `-s' `--quiet' `--silent' Do not print anything; only return an exit status indicating whether the files differ. `-v' `--version' Output version information and then exit. In the above table, operands that are byte counts are normally decimal, but may be preceded by `0' for octal and `0x' for hexadecimal. A byte count can be followed by a suffix to specify a multiple of that count; in this case an omitted integer is understood to be 1. A bare size letter, or one followed by `iB', specifies a multiple using powers of 1024. A size letter followed by `B' specifies powers of 1000 instead. For example, `-n 4M' and `-n 4MiB' are equivalent to `-n 4194304', whereas `-n 4MB' is equivalent to `-n 4000000'. This notation is upward compatible with the SI prefixes (http://www.bipm.fr/enus/3_SI/si-prefixes.html) for decimal multiples and with the IEC 60027-2 prefixes for binary multiples (http://physics.nist.gov/cuu/Units/binary.html). The following suffixes are defined. Large sizes like `1Y' may be rejected by your computer due to limitations of its arithmetic. `kB' kilobyte: 10^3 = 1000. `k' `K' `KiB' kibibyte: 2^10 = 1024. `K' is special: the SI prefix is `k' and the IEC 60027-2 prefix is `Ki', but tradition and POSIX use `k' to mean `KiB'. `MB' megabyte: 10^6 = 1,000,000. `M' `MiB' mebibyte: 2^20 = 1,048,576. `GB' gigabyte: 10^9 = 1,000,000,000. `G' `GiB' gibibyte: 2^30 = 1,073,741,824. `TB' terabyte: 10^12 = 1,000,000,000,000. `T' `TiB' tebibyte: 2^40 = 1,099,511,627,776. `PB' petabyte: 10^15 = 1,000,000,000,000,000. `P' `PiB' pebibyte: 2^50 = 1,125,899,906,842,624. `EB' exabyte: 10^18 = 1,000,000,000,000,000,000. `E' `EiB' exbibyte: 2^60 = 1,152,921,504,606,846,976. `ZB' zettabyte: 10^21 = 1,000,000,000,000,000,000,000 `Z' `ZiB' 2^70 = 1,180,591,620,717,411,303,424. (`Zi' is a GNU extension to IEC 60027-2.) `YB' yottabyte: 10^24 = 1,000,000,000,000,000,000,000,000. `Y' `YiB' 2^80 = 1,208,925,819,614,629,174,706,176. (`Yi' is a GNU extension to IEC 60027-2.)  File: diff.info, Node: Invoking diff, Next: Invoking diff3, Prev: Invoking cmp, Up: Top Invoking `diff' *************** The format for running the `diff' command is: diff OPTIONS... FILES... In the simplest case, two file names FROM-FILE and TO-FILE are given, and `diff' compares the contents of FROM-FILE and TO-FILE. A file name of `-' stands for text read from the standard input. As a special case, `diff - -' compares a copy of standard input to itself. If one file is a directory and the other is not, `diff' compares the file in the directory whose name is that of the non-directory. The non-directory file must not be `-'. If two file names are given and both are directories, `diff' compares corresponding files in both directories, in alphabetical order; this comparison is not recursive unless the `-r' or `--recursive' option is given. `diff' never compares the actual contents of a directory as if it were a file. The file that is fully specified may not be standard input, because standard input is nameless and the notion of "file with the same name" does not apply. If the `--from-file=FILE' option is given, the number of file names is arbitrary, and FILE is compared to each named file. Similarly, if the `--to-file=FILE' option is given, each named file is compared to FILE. `diff' options begin with `-', so normally file names may not begin with `-'. However, `--' as an argument by itself treats the remaining arguments as file names even if they begin with `-'. An exit status of 0 means no differences were found, 1 means some differences were found, and 2 means trouble. * Menu: * diff Options:: Summary of options to `diff'.  File: diff.info, Node: diff Options, Up: Invoking diff Options to `diff' ================= Below is a summary of all of the options that GNU `diff' accepts. Most options have two equivalent names, one of which is a single letter preceded by `-', and the other of which is a long name preceded by `--'. Multiple single letter options (unless they take an argument) can be combined into a single command line word: `-ac' is equivalent to `-a -c'. Long named options can be abbreviated to any unique prefix of their name. Brackets ([ and ]) indicate that an option takes an optional argument. `-a' `--text' Treat all files as text and compare them line-by-line, even if they do not seem to be text. *Note Binary::. `-b' `--ignore-space-change' Ignore changes in amount of white space. *Note White Space::. `-B' `--ignore-blank-lines' Ignore changes that just insert or delete blank lines. *Note Blank Lines::. `--binary' Read and write data in binary mode. *Note Binary::. `-c' Use the context output format, showing three lines of context. *Note Context Format::. `-C LINES' `--context[=LINES]' Use the context output format, showing LINES (an integer) lines of context, or three if LINES is not given. *Note Context Format::. For proper operation, `patch' typically needs at least two lines of context. On older systems, `diff' supports an obsolete option `-LINES' that has effect when combined with `-c' or `-p'. POSIX 1003.1-2001 (*note Standards conformance::) does not allow this; use `-C LINES' instead. `--changed-group-format=FORMAT' Use FORMAT to output a line group containing differing lines from both files in if-then-else format. *Note Line Group Formats::. `-d' `--minimal' Change the algorithm perhaps find a smaller set of changes. This makes `diff' slower (sometimes much slower). *Note diff Performance::. `-D NAME' `--ifdef=NAME' Make merged `#ifdef' format output, conditional on the preprocessor macro NAME. *Note If-then-else::. `-e' `--ed' Make output that is a valid `ed' script. *Note ed Scripts::. `-E' `--ignore-tab-expansion' Ignore changes due to tab expansion. *Note White Space::. `-f' `--forward-ed' Make output that looks vaguely like an `ed' script but has changes in the order they appear in the file. *Note Forward ed::. `-F REGEXP' `--show-function-line=REGEXP' In context and unified format, for each hunk of differences, show some of the last preceding line that matches REGEXP. *Note Specified Headings::. `--from-file=FILE' Compare FILE to each operand; FILE may be a directory. `--help' Output a summary of usage and then exit. `--horizon-lines=LINES' Do not discard the last LINES lines of the common prefix and the first LINES lines of the common suffix. *Note diff Performance::. `-i' `--ignore-case' Ignore changes in case; consider upper- and lower-case letters equivalent. *Note Case Folding::. `-I REGEXP' `--ignore-matching-lines=REGEXP' Ignore changes that just insert or delete lines that match REGEXP. *Note Specified Folding::. `--ignore-file-name-case' Ignore case when comparing file names during recursive comparison. *Note Comparing Directories::. `-l' `--paginate' Pass the output through `pr' to paginate it. *Note Pagination::. `--label=LABEL' Use LABEL instead of the file name in the context format (*note Context Format::) and unified format (*note Unified Format::) headers. *Note RCS::. `--left-column' Print only the left column of two common lines in side by side format. *Note Side by Side Format::. `--line-format=FORMAT' Use FORMAT to output all input lines in if-then-else format. *Note Line Formats::. `-n' `--rcs' Output RCS-format diffs; like `-f' except that each command specifies the number of lines affected. *Note RCS::. `-N' `--new-file' In directory comparison, if a file is found in only one directory, treat it as present but empty in the other directory. *Note Comparing Directories::. `--new-group-format=FORMAT' Use FORMAT to output a group of lines taken from just the second file in if-then-else format. *Note Line Group Formats::. `--new-line-format=FORMAT' Use FORMAT to output a line taken from just the second file in if-then-else format. *Note Line Formats::. `--old-group-format=FORMAT' Use FORMAT to output a group of lines taken from just the first file in if-then-else format. *Note Line Group Formats::. `--old-line-format=FORMAT' Use FORMAT to output a line taken from just the first file in if-then-else format. *Note Line Formats::. `-p' `--show-c-function' Show which C function each change is in. *Note C Function Headings::. `-q' `--brief' Report only whether the files differ, not the details of the differences. *Note Brief::. `-r' `--recursive' When comparing directories, recursively compare any subdirectories found. *Note Comparing Directories::. `-s' `--report-identical-files' Report when two files are the same. *Note Comparing Directories::. `-S FILE' `--starting-file=FILE' When comparing directories, start with the file FILE. This is used for resuming an aborted comparison. *Note Comparing Directories::. `--speed-large-files' Use heuristics to speed handling of large files that have numerous scattered small changes. *Note diff Performance::. `--strip-trailing-cr' Strip any trailing carriage return at the end of an input line. *Note Binary::. `--suppress-common-lines' Do not print common lines in side by side format. *Note Side by Side Format::. `-t' `--expand-tabs' Expand tabs to spaces in the output, to preserve the alignment of tabs in the input files. *Note Tabs::. `-T' `--initial-tab' Output a tab rather than a space before the text of a line in normal or context format. This causes the alignment of tabs in the line to look normal. *Note Tabs::. `--to-file=FILE' Compare each operand to FILE; FILE may be a directory. `-u' Use the unified output format, showing three lines of context. *Note Unified Format::. `--unchanged-group-format=FORMAT' Use FORMAT to output a group of common lines taken from both files in if-then-else format. *Note Line Group Formats::. `--unchanged-line-format=FORMAT' Use FORMAT to output a line common to both files in if-then-else format. *Note Line Formats::. `--unidirectional-new-file' When comparing directories, if a file appears only in the second directory of the two, treat it as present but empty in the other. *Note Comparing Directories::. `-U LINES' `--unified[=LINES]' Use the unified output format, showing LINES (an integer) lines of context, or three if LINES is not given. *Note Unified Format::. For proper operation, `patch' typically needs at least two lines of context. On older systems, `diff' supports an obsolete option `-LINES' that has effect when combined with `-u'. POSIX 1003.1-2001 (*note Standards conformance::) does not allow this; use `-U LINES' instead. `-v' `--version' Output version information and then exit. `-w' `--ignore-all-space' Ignore white space when comparing lines. *Note White Space::. `-W COLUMNS' `--width=COLUMNS' Output at most COLUMNS (default 130) print columns per line in side by side format. *Note Side by Side Format::. `-x PATTERN' `--exclude=PATTERN' When comparing directories, ignore files and subdirectories whose basenames match PATTERN. *Note Comparing Directories::. `-X FILE' `--exclude-from=FILE' When comparing directories, ignore files and subdirectories whose basenames match any pattern contained in FILE. *Note Comparing Directories::. `-y' `--side-by-side' Use the side by side output format. *Note Side by Side Format::.  File: diff.info, Node: Invoking diff3, Next: Invoking patch, Prev: Invoking diff, Up: Top Invoking `diff3' **************** The `diff3' command compares three files and outputs descriptions of their differences. Its arguments are as follows: diff3 OPTIONS... MINE OLDER YOURS The files to compare are MINE, OLDER, and YOURS. At most one of these three file names may be `-', which tells `diff3' to read the standard input for that file. An exit status of 0 means `diff3' was successful, 1 means some conflicts were found, and 2 means trouble. * Menu: * diff3 Options:: Summary of options to `diff3'.  File: diff.info, Node: diff3 Options, Up: Invoking diff3 Options to `diff3' ================== Below is a summary of all of the options that GNU `diff3' accepts. Multiple single letter options (unless they take an argument) can be combined into a single command line argument. `-a' `--text' Treat all files as text and compare them line-by-line, even if they do not appear to be text. *Note Binary::. `-A' `--show-all' Incorporate all unmerged changes from OLDER to YOURS into MINE, surrounding conflicts with bracket lines. *Note Marking Conflicts::. `--diff-program=PROGRAM' Use the compatible comparison program PROGRAM to compare files instead of `diff'. `-e' `--ed' Generate an `ed' script that incorporates all the changes from OLDER to YOURS into MINE. *Note Which Changes::. `-E' `--show-overlap' Like `-e', except bracket lines from overlapping changes' first and third files. *Note Marking Conflicts::. With `-E', an overlapping change looks like this: <<<<<<< MINE lines from MINE ======= lines from YOURS >>>>>>> YOURS `--help' Output a summary of usage and then exit. `-i' Generate `w' and `q' commands at the end of the `ed' script for System V compatibility. This option must be combined with one of the `-AeExX3' options, and may not be combined with `-m'. *Note Saving the Changed File::. `-L LABEL' `--label=LABEL' Use the label LABEL for the brackets output by the `-A', `-E' and `-X' options. This option may be given up to three times, one for each input file. The default labels are the names of the input files. Thus `diff3 -L X -L Y -L Z -m A B C' acts like `diff3 -m A B C', except that the output looks like it came from files named `X', `Y' and `Z' rather than from files named `A', `B' and `C'. *Note Marking Conflicts::. `-m' `--merge' Apply the edit script to the first file and send the result to standard output. Unlike piping the output from `diff3' to `ed', this works even for binary files and incomplete lines. `-A' is assumed if no edit script option is specified. *Note Bypassing ed::. `-T' `--initial-tab' Output a tab rather than two spaces before the text of a line in normal format. This causes the alignment of tabs in the line to look normal. *Note Tabs::. `-v' `--version' Output version information and then exit. `-x' `--overlap-only' Like `-e', except output only the overlapping changes. *Note Which Changes::. `-X' Like `-E', except output only the overlapping changes. In other words, like `-x', except bracket changes as in `-E'. *Note Marking Conflicts::. `-3' `--easy-only' Like `-e', except output only the nonoverlapping changes. *Note Which Changes::.  File: diff.info, Node: Invoking patch, Next: Invoking sdiff, Prev: Invoking diff3, Up: Top Invoking `patch' **************** Normally `patch' is invoked like this: patch to coordinate with other volunteers. * Menu: * Shortcomings:: Suggested projects for improvements. * Bugs:: Reporting bugs.  File: diff.info, Node: Shortcomings, Next: Bugs, Up: Projects Suggested Projects for Improving GNU `diff' and `patch' ======================================================= One should be able to use GNU `diff' to generate a patch from any pair of directory trees, and given the patch and a copy of one such tree, use `patch' to generate a faithful copy of the other. Unfortunately, some changes to directory trees cannot be expressed using current patch formats; also, `patch' does not handle some of the existing formats. These shortcomings motivate the following suggested projects. * Menu: * Internationalization:: Handling multibyte and varying-width characters. * Changing Structure:: Handling changes to the directory structure. * Special Files:: Handling symbolic links, device special files, etc. * Unusual File Names:: Handling file names that contain unusual characters. * Time Stamp Order:: Outputting diffs in time stamp order. * Ignoring Changes:: Ignoring certain changes while showing others. * Speedups:: Improving performance.  File: diff.info, Node: Internationalization, Next: Changing Structure, Up: Shortcomings Handling Multibyte and Varying-Width Characters ----------------------------------------------- `diff', `diff3' and `sdiff' treat each line of input as a string of unibyte characters. This can mishandle multibyte characters in some cases. For example, when asked to ignore spaces, `diff' does not properly ignore a multibyte space character. Also, `diff' currently assumes that each byte is one column wide, and this assumption is incorrect in some locales, e.g., locales that use UTF-8 encoding. This causes problems with the `-y' or `--side-by-side' option of `diff'. These problems need to be fixed without unduly affecting the performance of the utilities in unibyte environments. The IBM GNU/Linux Technology Center Internationalization Team has proposed some patches to support internationalized `diff' `http://oss.software.ibm.com/developer/opensource/linux/patches/i18n/diffutils-2.7.2-i18n-0.1.patch.gz'. Unfortunately, these patches are incomplete and are to an older version of `diff', so more work needs to be done in this area.  File: diff.info, Node: Changing Structure, Next: Special Files, Prev: Internationalization, Up: Shortcomings Handling Changes to the Directory Structure ------------------------------------------- `diff' and `patch' do not handle some changes to directory structure. For example, suppose one directory tree contains a directory named `D' with some subsidiary files, and another contains a file with the same name `D'. `diff -r' does not output enough information for `patch' to transform the directory subtree into the file. There should be a way to specify that a file has been removed without having to include its entire contents in the patch file. There should also be a way to tell `patch' that a file was renamed, even if there is no way for `diff' to generate such information. There should be a way to tell `patch' that a file's time stamp has changed, even if its contents have not changed. These problems can be fixed by extending the `diff' output format to represent changes in directory structure, and extending `patch' to understand these extensions.  File: diff.info, Node: Special Files, Next: Unusual File Names, Prev: Changing Structure, Up: Shortcomings Files that are Neither Directories Nor Regular Files ---------------------------------------------------- Some files are neither directories nor regular files: they are unusual files like symbolic links, device special files, named pipes, and sockets. Currently, `diff' treats symbolic links like regular files; it treats other special files like regular files if they are specified at the top level, but simply reports their presence when comparing directories. This means that `patch' cannot represent changes to such files. For example, if you change which file a symbolic link points to, `diff' outputs the difference between the two files, instead of the change to the symbolic link. `diff' should optionally report changes to special files specially, and `patch' should be extended to understand these extensions.  File: diff.info, Node: Unusual File Names, Next: Time Stamp Order, Prev: Special Files, Up: Shortcomings File Names that Contain Unusual Characters ------------------------------------------ When a file name contains an unusual character like a newline or white space, `diff -r' generates a patch that `patch' cannot parse. The problem is with format of `diff' output, not just with `patch', because with odd enough file names one can cause `diff' to generate a patch that is syntactically correct but patches the wrong files. The format of `diff' output should be extended to handle all possible file names.  File: diff.info, Node: Time Stamp Order, Next: Ignoring Changes, Prev: Unusual File Names, Up: Shortcomings Outputting Diffs in Time Stamp Order ------------------------------------ Applying `patch' to a multiple-file diff can result in files whose time stamps are out of order. GNU `patch' has options to restore the time stamps of the updated files (*note Patching Time Stamps::), but sometimes it is useful to generate a patch that works even if the recipient does not have GNU patch, or does not use these options. One way to do this would be to implement a `diff' option to output diffs in time stamp order.  File: diff.info, Node: Ignoring Changes, Next: Speedups, Prev: Time Stamp Order, Up: Shortcomings Ignoring Certain Changes ------------------------ It would be nice to have a feature for specifying two strings, one in FROM-FILE and one in TO-FILE, which should be considered to match. Thus, if the two strings are `foo' and `bar', then if two lines differ only in that `foo' in file 1 corresponds to `bar' in file 2, the lines are treated as identical. It is not clear how general this feature can or should be, or what syntax should be used for it. A partial substitute is to filter one or both files before comparing, e.g.: sed 's/foo/bar/g' file1 | diff - file2 However, this outputs the filtered text, not the original.  File: diff.info, Node: Speedups, Prev: Ignoring Changes, Up: Shortcomings Improving Performance --------------------- When comparing two large directory structures, one of which was originally copied from the other with time stamps preserved (e.g., with `cp -pR'), it would greatly improve performance if an option told `diff' to assume that two files with the same size and time stamps have the same content. *Note diff Performance::.  File: diff.info, Node: Bugs, Prev: Shortcomings, Up: Projects Reporting Bugs ============== If you think you have found a bug in GNU `cmp', `diff', `diff3', or `sdiff', please report it by electronic mail to the GNU utilities bug report mailing list (http://mail.gnu.org/mailman/listinfo/bug-gnu-utils) . Please send bug reports for GNU `patch' to . Send as precise a description of the problem as you can, including the output of the `--version' option and sample input files that produce the bug, if applicable. If you have a nontrivial fix for the bug, please send it as well. If you have a patch, please send it too. It may simplify the maintainer's job if the patch is relative to a recent test release, which you can find in the directory `ftp://alpha.gnu.org/gnu/diffutils/'.  File: diff.info, Node: Copying This Manual, Next: Index, Prev: Projects, Up: Top Copying This Manual ******************* * Menu: * GNU Free Documentation License:: License for copying this manual.  File: diff.info, Node: GNU Free Documentation License, Up: Copying This Manual GNU Free Documentation License ============================== Version 1.1, March 2000 Copyright (C) 2000 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. 0. PREAMBLE The purpose of this License is to make a manual, textbook, or other written document "free" in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others. This License is a kind of "copyleft", which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software. We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference. 1. APPLICABILITY AND DEFINITIONS This License applies to any manual or other work that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. The "Document", below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as "you". A "Modified Version" of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language. A "Secondary Section" is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document's overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (For example, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them. The "Invariant Sections" are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. The "Cover Texts" are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A "Transparent" copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, whose contents can be viewed and edited directly and straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup has been designed to thwart or discourage subsequent modification by readers is not Transparent. A copy that is not "Transparent" is called "Opaque". Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML designed for human modification. Opaque formats include PostScript, PDF, proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML produced by some word processors for output purposes only. The "Title Page" means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, "Title Page" means the text near the most prominent appearance of the work's title, preceding the beginning of the body of the text. 2. VERBATIM COPYING You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3. You may also lend copies, under the same conditions stated above, and you may publicly display copies. 3. COPYING IN QUANTITY If you publish printed copies of the Document numbering more than 100, and the Document's license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects. If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages. If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a publicly-accessible computer-network location containing a complete Transparent copy of the Document, free of added material, which the general network-using public has access to download anonymously at no charge using public-standard network protocols. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public. It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document. 4. MODIFICATIONS You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version: A. Use in the Title Page (and on the covers, if any) a title distinct from that of the Document, and from those of previous versions (which should, if there were any, be listed in the History section of the Document). You may use the same title as a previous version if the original publisher of that version gives permission. B. List on the Title Page, as authors, one or more persons or entities responsible for authorship of the modifications in the Modified Version, together with at least five of the principal authors of the Document (all of its principal authors, if it has less than five). C. State on the Title page the name of the publisher of the Modified Version, as the publisher. D. Preserve all the copyright notices of the Document. E. Add an appropriate copyright notice for your modifications adjacent to the other copyright notices. F. Include, immediately after the copyright notices, a license notice giving the public permission to use the Modified Version under the terms of this License, in the form shown in the Addendum below. G. Preserve in that license notice the full lists of Invariant Sections and required Cover Texts given in the Document's license notice. H. Include an unaltered copy of this License. I. Preserve the section entitled "History", and its title, and add to it an item stating at least the title, year, new authors, and publisher of the Modified Version as given on the Title Page. If there is no section entitled "History" in the Document, create one stating the title, year, authors, and publisher of the Document as given on its Title Page, then add an item describing the Modified Version as stated in the previous sentence. J. Preserve the network location, if any, given in the Document for public access to a Transparent copy of the Document, and likewise the network locations given in the Document for previous versions it was based on. These may be placed in the "History" section. You may omit a network location for a work that was published at least four years before the Document itself, or if the original publisher of the version it refers to gives permission. K. In any section entitled "Acknowledgments" or "Dedications", preserve the section's title, and preserve in the section all the substance and tone of each of the contributor acknowledgments and/or dedications given therein. L. Preserve all the Invariant Sections of the Document, unaltered in their text and in their titles. Section numbers or the equivalent are not considered part of the section titles. M. Delete any section entitled "Endorsements". Such a section may not be included in the Modified Version. N. Do not retitle any existing section as "Endorsements" or to conflict in title with any Invariant Section. If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version's license notice. These titles must be distinct from any other section titles. You may add a section entitled "Endorsements", provided it contains nothing but endorsements of your Modified Version by various parties--for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard. You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one. The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version. 5. COMBINING DOCUMENTS You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice. The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work. In the combination, you must combine any sections entitled "History" in the various original documents, forming one section entitled "History"; likewise combine any sections entitled "Acknowledgments", and any sections entitled "Dedications". You must delete all sections entitled "Endorsements." 6. COLLECTIONS OF DOCUMENTS You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects. You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document. 7. AGGREGATION WITH INDEPENDENT WORKS A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, does not as a whole count as a Modified Version of the Document, provided no compilation copyright is claimed for the compilation. Such a compilation is called an "aggregate", and this License does not apply to the other self-contained works thus compiled with the Document, on account of their being thus compiled, if they are not themselves derivative works of the Document. If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one quarter of the entire aggregate, the Document's Cover Texts may be placed on covers that surround only the Document within the aggregate. Otherwise they must appear on covers around the whole aggregate. 8. TRANSLATION Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License provided that you also include the original English version of this License. In case of a disagreement between the translation and the original English version of this License, the original English version will prevail. 9. TERMINATION You may not copy, modify, sublicense, or distribute the Document except as expressly provided for under this License. Any other attempt to copy, modify, sublicense or distribute the Document is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 10. FUTURE REVISIONS OF THIS LICENSE The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See `http://www.gnu.org/copyleft/'. Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License "or any later version" applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. ADDENDUM: How to use this License for your documents ---------------------------------------------------- To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page: Copyright (C) YEAR YOUR NAME. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.1 or any later version published by the Free Software Foundation; with the Invariant Sections being LIST THEIR TITLES, with the Front-Cover Texts being LIST, and with the Back-Cover Texts being LIST. A copy of the license is included in the section entitled ``GNU Free Documentation License''. If you have no Invariant Sections, write "with no Invariant Sections" instead of saying which ones are invariant. If you have no Front-Cover Texts, write "no Front-Cover Texts" instead of "Front-Cover Texts being LIST"; likewise for Back-Cover Texts. If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software.  File: diff.info, Node: Index, Prev: Copying This Manual, Up: Top Index ***** * Menu: * ! output format: Context. * +- output format: Unified Format. * < output format: Normal. * <<<<<<< for marking conflicts: Marking Conflicts. * _POSIX2_VERSION: Standards conformance. * aligning tab stops: Tabs. * alternate file names: Alternate Names. * backup file names: Backup Names. * backup file strategy: Backups. * binary file diff: Binary. * blank and tab difference suppression: White Space. * blank line difference suppression: Blank Lines. * brief difference reports: Brief. * bug reports: Bugs. * C function headings: C Function Headings. * C if-then-else output format: If-then-else. * case difference suppression: Case Folding. * ClearCase: Revision Control. * cmp invocation: Invoking cmp. * cmp options: cmp Options. * columnar output: Side by Side. * common mistakes with patches: Avoiding Common Mistakes. * comparing three files: Comparing Three Files. * conflict: diff3 Merging. * conflict marking: Marking Conflicts. * context output format: Context. * creating files: Creating and Removing. * diagnostics from patch: patch Messages. * diff invocation: Invoking diff. * diff merging: Interactive Merging. * diff options: diff Options. * diff sample input: Sample diff Input. * diff3 hunks: diff3 Hunks. * diff3 invocation: Invoking diff3. * diff3 options: diff3 Options. * diff3 sample input: Sample diff3 Input. * directories and patch: patch Directories. * directory structure changes: Changing Structure. * dry runs for patch: Dry Runs. * ed script output format: ed Scripts. * EDITOR: Merge Commands. * empty files, removing: Creating and Removing. * exabyte, definition of: cmp Options. * exbibyte, definition of: cmp Options. * FDL, GNU Free Documentation License: GNU Free Documentation License. * file name alternates: Alternate Names. * file names with unusual characters: Unusual File Names. * format of diff output: Output Formats. * format of diff3 output: Comparing Three Files. * formats for if-then-else line groups: Line Group Formats. * forward ed script output format: Forward ed. * full lines: Incomplete Lines. * function headings, C: C Function Headings. * fuzz factor when patching: Inexact. * gibibyte, definition of: cmp Options. * gigabyte, definition of: cmp Options. * headings: Sections. * hunks: Hunks. * hunks for diff3: diff3 Hunks. * if-then-else output format: If-then-else. * ifdef output format: If-then-else. * imperfect patch application: Imperfect. * incomplete line merging: Merging Incomplete Lines. * incomplete lines: Incomplete Lines. * inexact patches: Inexact. * inhibit messages from patch: More or Fewer Messages. * interactive merging: Interactive Merging. * introduction: Comparison. * intuiting file names from patches: Multiple Patches. * invoking cmp: Invoking cmp. * invoking diff: Invoking diff. * invoking diff3: Invoking diff3. * invoking patch: Invoking patch. * invoking sdiff: Invoking sdiff. * keyboard input to patch: patch and Keyboard Input. * kibibyte, definition of: cmp Options. * kilobyte, definition of: cmp Options. * LC_COLLATE: Comparing Directories. * LC_NUMERIC: Line Group Formats. * LC_TIME: Detailed Context. * line formats: Line Formats. * line group formats: Line Group Formats. * mebibyte, definition of: cmp Options. * megabyte, definition of: cmp Options. * merge commands: Merge Commands. * merged diff3 format: Bypassing ed. * merged output format: If-then-else. * merging from a common ancestor: diff3 Merging. * merging interactively: Merge Commands. * messages from patch: patch Messages. * multibyte characters: Internationalization. * multiple patches: Multiple Patches. * newline treatment by diff: Incomplete Lines. * normal output format: Normal. * options for cmp: cmp Options. * options for diff: diff Options. * options for diff3: diff3 Options. * options for patch: patch Options. * options for sdiff: sdiff Options. * output formats: Output Formats. * overlap: diff3 Merging. * overlapping change, selection of: Which Changes. * overview of diff and patch: Overview. * paginating diff output: Pagination. * patch consumer tips: Tips for Patch Consumers. * patch input format: patch Input. * patch invocation: Invoking patch. * patch messages and questions: patch Messages. * patch options: patch Options. * patch producer tips: Tips for Patch Producers. * patch, common mistakes: Avoiding Common Mistakes. * PATCH_GET: Revision Control. * PATCH_VERSION_CONTROL: Backup Names. * patches, shrinking: Generating Smaller Patches. * patching directories: patch Directories. * pebibyte, definition of: cmp Options. * performance of diff: diff Performance. * petabyte, definition of: cmp Options. * POSIX <1>: Standards conformance. * POSIX: patch and POSIX. * POSIXLY_CORRECT <1>: patch and POSIX. * POSIXLY_CORRECT: Standards conformance. * projects for directories: Shortcomings. * quoting style: patch Quoting Style. * QUOTING_STYLE: patch Quoting Style. * RCS: Revision Control. * RCS script output format: RCS. * regular expression matching headings: Specified Headings. * regular expression suppression: Specified Folding. * reject file names: Reject Names. * removing empty files: Creating and Removing. * reporting bugs: Bugs. * reversed patches: Reversed Patches. * revision control: Revision Control. * sample input for diff: Sample diff Input. * sample input for diff3: Sample diff3 Input. * SCCS: Revision Control. * script output formats: Scripts. * sdiff invocation: Invoking sdiff. * sdiff options: sdiff Options. * sdiff output format: sdiff Option Summary. * section headings: Sections. * side by side: Side by Side. * side by side format: Side by Side Format. * SIMPLE_BACKUP_SUFFIX: Backup Names. * special files: Special Files. * specified headings: Specified Headings. * summarizing which files differ: Brief. * System V diff3 compatibility: Saving the Changed File. * tab and blank difference suppression: White Space. * tab stop alignment: Tabs. * tebibyte, definition of: cmp Options. * terabyte, definition of: cmp Options. * testing patch: Dry Runs. * text versus binary diff: Binary. * time stamp format, context diffs: Detailed Context. * time stamp format, unified diffs: Detailed Unified. * time stamps on patched files: Patching Time Stamps. * traditional patch: patch and Tradition. * two-column output: Side by Side. * unified output format: Unified Format. * unmerged change: Which Changes. * varying-width characters: Internationalization. * verbose messages from patch: More or Fewer Messages. * version control: Revision Control. * VERSION_CONTROL <1>: Backup Names. * VERSION_CONTROL: Revision Control. * white space in patches: Changed White Space. * yottabyte, definition of: cmp Options. * zettabyte, definition of: cmp Options.  Tag Table: Node: Top1653 Node: Overview4045 Node: Comparison7202 Node: Hunks9888 Node: White Space11313 Node: Blank Lines12807 Node: Case Folding13562 Node: Specified Folding13977 Node: Brief15052 Node: Binary16295 Node: Output Formats20358 Node: Sample diff Input21076 Node: Normal22569 Node: Detailed Normal23564 Node: Example Normal25289 Node: Context26011 Node: Context Format27567 Node: Detailed Context28345 Node: Example Context30234 Node: Less Context31748 Node: Unified Format32894 Node: Detailed Unified33676 Node: Example Unified34787 Node: Sections35807 Node: Specified Headings36552 Node: C Function Headings38083 Node: Alternate Names38908 Node: Side by Side39808 Node: Side by Side Format41947 Node: Example Side by Side42836 Node: Scripts44162 Node: ed Scripts44563 Node: Detailed ed45756 Node: Example ed47497 Node: Forward ed47934 Node: RCS48696 Node: If-then-else49904 Node: Line Group Formats51572 Node: Line Formats57437 Node: Detailed If-then-else60693 Node: Example If-then-else62583 Node: Incomplete Lines63632 Node: Comparing Directories65263 Node: Adjusting Output69220 Node: Tabs69645 Node: Pagination71177 Node: diff Performance71626 Node: Comparing Three Files74708 Node: Sample diff3 Input75580 Node: Detailed diff3 Normal76528 Node: diff3 Hunks78307 Node: Example diff3 Normal79593 Node: diff3 Merging80616 Node: Which Changes82854 Node: Marking Conflicts84258 Node: Bypassing ed86714 Node: Merging Incomplete Lines88068 Node: Saving the Changed File88784 Node: Interactive Merging89390 Node: sdiff Option Summary90094 Node: Merge Commands91242 Node: Merging with patch92503 Node: patch Input94867 Node: Revision Control95537 Node: Imperfect96689 Node: Changed White Space97825 Node: Reversed Patches98606 Node: Inexact100056 Node: Dry Runs103599 Node: Creating and Removing104447 Node: Patching Time Stamps105486 Node: Multiple Patches107677 Node: patch Directories110328 Node: Backups111942 Node: Backup Names112996 Ref: Backup Names-Footnote-1115955 Node: Reject Names116082 Node: patch Messages116660 Node: More or Fewer Messages117706 Node: patch and Keyboard Input118319 Node: patch Quoting Style119332 Node: patch and POSIX120464 Node: patch and Tradition121290 Node: Making Patches124734 Node: Tips for Patch Producers125552 Node: Tips for Patch Consumers126796 Node: Avoiding Common Mistakes127421 Node: Generating Smaller Patches129934 Node: Invoking cmp131683 Node: cmp Options132532 Node: Invoking diff135896 Node: diff Options137599 Node: Invoking diff3145722 Node: diff3 Options146352 Node: Invoking patch149255 Node: patch Options150455 Node: Invoking sdiff155669 Node: sdiff Options156808 Node: Standards conformance159561 Node: Projects161299 Node: Shortcomings162002 Node: Internationalization163092 Node: Changing Structure164247 Node: Special Files165336 Node: Unusual File Names166282 Node: Time Stamp Order166904 Node: Ignoring Changes167531 Node: Speedups168285 Node: Bugs168733 Node: Copying This Manual169574 Node: GNU Free Documentation License169782 Node: Index189646  End Tag Table packages/diffutils/2.8.1/packageinfo-bin0000644000175200017520000000003111517104606017666 0ustar tyndurtyndurdiffutils 2.8.1 bin i386 packages/diffutils/2.8.1/postinstall-bin0000644000175200017520000000020611517104606017777 0ustar tyndurtyndur#!file:/apps/sh lpt cfg-addbin file:/packages/diffutils/2.8.1/bin/cmp cmp lpt cfg-addbin file:/packages/diffutils/2.8.1/bin/diff diff